4ZVZA

Co-crystal structures of pp5 in complex with 5-methyl-7-oxabicyclo[2.2.1]heptane-2,3-dicarboxylic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
312
structure length
312
Chain Sequence
YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures and mutagenesis of PPP-family ser/thr protein phosphatases elucidate the selectivity of cantharidin and novel norcantharidin-based inhibitors of PP5C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine/threonine-protein phosphatase 5
total genus 112
structure length 312
sequence length 312
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2015-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4zvzA00
3RQZA 5HPEA 4I5NC 1U32A 3KBPA 3EGGA 3AV0A 1OI8A 1OIDA 2CV9A 1JK7A 2A22A 3PSOA 2NYLC 1S3NA 3RL3A 5JPFA 2O8GA 5JJTA 2IE3C 3C9FA 3T1IA 4G9JA 4Q7FA 4F0ZA 1G5BA 2JOGA 3EGHA 5EQVA 4UT2A 1AUIA 1HPUA 4FCXA 4H1YP 1WARA 4H2IA 4V0VA 2WDCA 2WDEA 5B8IA 1HP1A 1TCOA 4UWQA 1W24A 1Z2WA 3P71C 1FJMA 3IB8A 2Z72A 1II7A 3E7AA 3H66A 2YVTA 3QFOA 4UT3A 2R17A 2QFRA 4FBKA 4DT2A 1UF3A 4MOVA 3DSCA 2USHA 1V73A 2HYPA 3LL8A 3TGHA 5IOHA 2NYMC 1OIEA 4FBQA 1HO5A 4H1SA 4M0VA 4MOYA 2Z1AA 1QHWA 4YKEA 1USHA 2AHDA 3AUZA 2O8AA 4LTYA 2BDXA 1UTEA 3RL4A 2IE4C 5GTUA 3IB7A 4V0WA 1Z2XA 3K7WC 3CK2A 2DFJA 1S70A 2HYOA 5DNYA 2BCDA 4V0XA 2KKNA 3THOB 4I5LC 1M63A 3IVDA 3QFNA 4TUGA 1NNWA 4H2BA 4O5GA 1IT6A 4ZVZA 4H2GA 2IAEC 3DSDA 4TUIA 3RL5A 1T70A 3ZU0A 4NZVA 3H64A 3H61A 1T71A 4FBWA 3FGAC 3H67A 4UT3B 4ORAA 1XZWA 1S3MA 3N5UA 1WAO1 3PSNA 1S8EA 4LACC 3E7BA 4H2FA 3DW8C 2ZBMA 4ORCA 2Z06A 3H69A 3H62B 4MP0A 4JA9A 1S95A 4J6OA 5J28A 4KKZA 3QG5C 3H68A 4DSYA 4O4KA 5C1VA 2WDDA 4B2OA 4ORBA 2Q8UA 3HVQA 1KBPA 4LU9A 3JYFA 4WWLA 4IL1A 4XPNA 3C5WC 3GVEA 4O24A 3H60A 4JA7A 1QFCA 3THNA 2P6BA 4O43A 2NPPC 2QFPA 3ICFA 4OR9A 3H63A 3K7VC 4ZX2A 1MF8A 2NXFA 2WDFA 2HY1A 4HD0A 1S3LA 1XM7A 2QJCA 4DHLA 5JPEA 5INBA 5F3WA 4IYPC 3IVEA 3V4YA 2GJUA 3ZTVA 2XMOA 3QFKA 2BQ8X 1SU1A 4KBPA 3QFMA
chains in the Genus database with same CATH superfamily
3RQZA 5HPEA 4I5NC 1U32A 3KBPA 3EGGA 3AV0A 1OI8A 1OIDA 2CV9A 1JK7A 2A22A 3PSOA 2NYLC 1S3NA 3RL3A 5JPFA 2O8GA 5JJTA 2IE3C 3C9FA 3T1IA 4G9JA 4Q7FA 4F0ZA 2YEQA 1G5BA 2JOGA 3EGHA 5EQVA 4UT2A 1AUIA 1HPUA 4FCXA 4H1YP 1WARA 2DXLA 4H2IA 4V0VA 2WDCA 2WDEA 5B8IA 1HP1A 1TCOA 4UWQA 1W24A 1Z2WA 3P71C 1FJMA 3IB8A 2Z72A 1II7A 3E7AA 3H66A 2YVTA 3QFOA 4UT3A 2R17A 2QFRA 4FBKA 4DT2A 1UF3A 4MOVA 3DSCA 2USHA 1V73A 2HYPA 3LL8A 3TGHA 5IOHA 2NYMC 1OIEA 4FBQA 1HO5A 4H1SA 4M0VA 4MOYA 2Z1AA 1QHWA 2ZOAA 4YKEA 1USHA 2AHDA 3AUZA 2O8AA 4LTYA 2BDXA 1UTEA 3E0JA 2IE4C 5GTUA 3RL4A 3IB7A 4V0WA 1Z2XA 3K7WC 3CK2A 2DFJA 1S70A 2HYOA 5DNYA 2BCDA 4V0XA 2KKNA 3THOB 4I5LC 1M63A 3IVDA 3QFNA 4TUGA 1NNWA 4H2BA 4O5GA 1IT6A 4ZVZA 4H2GA 2IAEC 3DSDA 4TUIA 3RL5A 1T70A 3ZU0A 4NZVA 3H64A 3H61A 1T71A 4FBWA 3FGAC 3H67A 4UT3B 4ORAA 1XZWA 1S3MA 3N5UA 1WAO1 3PSNA 1S8EA 4LACC 3E7BA 4H2FA 3DW8C 2ZBMA 4ORCA 2Z06A 3H69A 3H62B 4MP0A 4JA9A 1S95A 4J6OA 5J28A 4KKZA 3QG5C 3H68A 4DSYA 4O4KA 5C1VA 2WDDA 4B2OA 4ORBA 2Q8UA 3HVQA 1KBPA 4LU9A 3JYFA 4WWLA 4IL1A 4XPNA 3C5WC 3GVEA 4O24A 3H60A 4JA7A 1QFCA 2ZO9B 3THNA 2P6BA 4O43A 2NPPC 2QFPA 3D03A 2DXNA 3ICFA 4OR9A 3H63A 3K7VC 4ZX2A 1MF8A 2NXFA 2WDFA 2HY1A 4HD0A 1S3LA 1XM7A 2QJCA 4DHLA 5JPEA 3FLOA 5INBA 5F3WA 4IYPC 3IVEA 3V4YA 2GJUA 3ZTVA 2XMOA 3QFKA 2BQ8X 1SU1A 4KBPA 3QFMA
chains in the Genus database with same CATH topology
3RQZA 5HPEA 4I5NC 1U32A 3KBPA 3EGGA 3AV0A 1OI8A 1OIDA 2CV9A 1JK7A 2A22A 3PSOA 2NYLC 1S3NA 3RL3A 5JPFA 2O8GA 5JJTA 2IE3C 3C9FA 3T1IA 4G9JA 4Q7FA 4F0ZA 2YEQA 1G5BA 2JOGA 3EGHA 5EQVA 4UT2A 1AUIA 1HPUA 4FCXA 4H1YP 1WARA 2DXLA 4H2IA 4V0VA 2WDCA 2WDEA 5B8IA 1HP1A 1TCOA 4UWQA 1W24A 1Z2WA 3P71C 1FJMA 3IB8A 2Z72A 1II7A 3E7AA 3H66A 2YVTA 3QFOA 4UT3A 2R17A 2QFRA 4FBKA 4DT2A 1UF3A 4MOVA 3DSCA 2USHA 1V73A 2HYPA 3LL8A 3TGHA 5IOHA 2NYMC 1OIEA 4FBQA 1HO5A 4H1SA 4M0VA 4MOYA 2Z1AA 1QHWA 2ZOAA 4YKEA 1USHA 2AHDA 3AUZA 2O8AA 4LTYA 2BDXA 1UTEA 3E0JA 2IE4C 5GTUA 3RL4A 3IB7A 4V0WA 1Z2XA 3K7WC 3CK2A 2DFJA 1S70A 2HYOA 5DNYA 2BCDA 4V0XA 2KKNA 3THOB 4I5LC 1M63A 3IVDA 3QFNA 4TUGA 1NNWA 4H2BA 4O5GA 1IT6A 4ZVZA 4H2GA 2IAEC 3DSDA 4TUIA 3RL5A 1T70A 3ZU0A 4NZVA 3H64A 3H61A 1T71A 4FBWA 3FGAC 3H67A 4UT3B 4ORAA 1XZWA 1S3MA 3N5UA 1WAO1 3PSNA 1S8EA 4LACC 3E7BA 4H2FA 3DW8C 2ZBMA 4ORCA 2Z06A 3H69A 3H62B 4MP0A 4JA9A 1S95A 4J6OA 5J28A 4KKZA 3QG5C 3H68A 4DSYA 4O4KA 5C1VA 2WDDA 4B2OA 4ORBA 2Q8UA 3HVQA 1KBPA 4LU9A 3JYFA 4WWLA 4IL1A 4XPNA 3C5WC 3GVEA 4O24A 3H60A 4JA7A 1QFCA 2ZO9B 3THNA 2P6BA 4O43A 2NPPC 2QFPA 3D03A 2DXNA 3ICFA 4OR9A 3H63A 3K7VC 4ZX2A 1MF8A 2NXFA 2WDFA 2HY1A 4HD0A 1S3LA 1XM7A 2QJCA 4DHLA 5JPEA 3FLOA 5INBA 5F3WA 4IYPC 3IVEA 3V4YA 2GJUA 3ZTVA 2XMOA 3QFKA 2BQ8X 1SU1A 4KBPA 3QFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQZ A;  5HPE A;  4I5N C;  1U32 A;  3KBP A;  3EGG A;  3AV0 A;  1OI8 A;  1OID A;  2CV9 A;  1JK7 A;  2A22 A;  3PSO A;  2NYL C;  1S3N A;  3RL3 A;  5JPF A;  2O8G A;  5JJT A;  2IE3 C;  3C9F A;  3T1I A;  4G9J A;  4Q7F A;  4F0Z A;  1G5B A;  2JOG A;  3EGH A;  5EQV A;  4UT2 A;  1AUI A;  1HPU A;  4FCX A;  4H1Y P;  1WAR A;  4H2I A;  4V0V A;  2WDC A;  2WDE A;  5B8I A;  1HP1 A;  1TCO A;  4UWQ A;  1W24 A;  1Z2W A;  3P71 C;  1FJM A;  3IB8 A;  2Z72 A;  1II7 A;  3E7A A;  3H66 A;  2YVT A;  3QFO A;  4UT3 A;  2R17 A;  2QFR A;  4FBK A;  4DT2 A;  1UF3 A;  4MOV A;  3DSC A;  2USH A;  1V73 A;  2HYP A;  3LL8 A;  3TGH A;  5IOH A;  2NYM C;  1OIE A;  4FBQ A;  1HO5 A;  4H1S A;  4M0V A;  4MOY A;  2Z1A A;  1QHW A;  4YKE A;  1USH A;  2AHD A;  3AUZ A;  2O8A A;  4LTY A;  2BDX A;  1UTE A;  3RL4 A;  2IE4 C;  5GTU A;  3IB7 A;  4V0W A;  1Z2X A;  3K7W C;  3CK2 A;  2DFJ A;  1S70 A;  2HYO A;  5DNY A;  2BCD A;  4V0X A;  2KKN A;  3THO B;  4I5L C;  1M63 A;  3IVD A;  3QFN A;  4TUG A;  1NNW A;  4H2B A;  4O5G A;  1IT6 A;  4ZVZ A;  4H2G A;  2IAE C;  3DSD A;  4TUI A;  3RL5 A;  1T70 A;  3ZU0 A;  4NZV A;  3H64 A;  3H61 A;  1T71 A;  4FBW A;  3FGA C;  3H67 A;  4UT3 B;  4ORA A;  1XZW A;  1S3M A;  3N5U A;  1WAO 1;  3PSN A;  1S8E A;  4LAC C;  3E7B A;  4H2F A;  3DW8 C;  2ZBM A;  4ORC A;  2Z06 A;  3H69 A;  3H62 B;  4MP0 A;  4JA9 A;  1S95 A;  4J6O A;  5J28 A;  4KKZ A;  3QG5 C;  3H68 A;  4DSY A;  4O4K A;  5C1V A;  2WDD A;  4B2O A;  4ORB A;  2Q8U A;  3HVQ A;  1KBP A;  4LU9 A;  3JYF A;  4WWL A;  4IL1 A;  4XPN A;  3C5W C;  3GVE A;  4O24 A;  3H60 A;  4JA7 A;  1QFC A;  3THN A;  2P6B A;  4O43 A;  2NPP C;  2QFP A;  3ICF A;  4OR9 A;  3H63 A;  3K7V C;  4ZX2 A;  1MF8 A;  2NXF A;  2WDF A;  2HY1 A;  4HD0 A;  1S3L A;  1XM7 A;  2QJC A;  4DHL A;  5JPE A;  5INB A;  5F3W A;  4IYP C;  3IVE A;  3V4Y A;  2GJU A;  3ZTV A;  2XMO A;  3QFK A;  2BQ8 X;  1SU1 A;  4KBP A;  3QFM A; 
#chains in the Genus database with same CATH topology
 3RQZ A;  5HPE A;  4I5N C;  1U32 A;  3KBP A;  3EGG A;  3AV0 A;  1OI8 A;  1OID A;  2CV9 A;  1JK7 A;  2A22 A;  3PSO A;  2NYL C;  1S3N A;  3RL3 A;  5JPF A;  2O8G A;  5JJT A;  2IE3 C;  3C9F A;  3T1I A;  4G9J A;  4Q7F A;  4F0Z A;  2YEQ A;  1G5B A;  2JOG A;  3EGH A;  5EQV A;  4UT2 A;  1AUI A;  1HPU A;  4FCX A;  4H1Y P;  1WAR A;  2DXL A;  4H2I A;  4V0V A;  2WDC A;  2WDE A;  5B8I A;  1HP1 A;  1TCO A;  4UWQ A;  1W24 A;  1Z2W A;  3P71 C;  1FJM A;  3IB8 A;  2Z72 A;  1II7 A;  3E7A A;  3H66 A;  2YVT A;  3QFO A;  4UT3 A;  2R17 A;  2QFR A;  4FBK A;  4DT2 A;  1UF3 A;  4MOV A;  3DSC A;  2USH A;  1V73 A;  2HYP A;  3LL8 A;  3TGH A;  5IOH A;  2NYM C;  1OIE A;  4FBQ A;  1HO5 A;  4H1S A;  4M0V A;  4MOY A;  2Z1A A;  1QHW A;  2ZOA A;  4YKE A;  1USH A;  2AHD A;  3AUZ A;  2O8A A;  4LTY A;  2BDX A;  1UTE A;  3E0J A;  2IE4 C;  5GTU A;  3RL4 A;  3IB7 A;  4V0W A;  1Z2X A;  3K7W C;  3CK2 A;  2DFJ A;  1S70 A;  2HYO A;  5DNY A;  2BCD A;  4V0X A;  2KKN A;  3THO B;  4I5L C;  1M63 A;  3IVD A;  3QFN A;  4TUG A;  1NNW A;  4H2B A;  4O5G A;  1IT6 A;  4ZVZ A;  4H2G A;  2IAE C;  3DSD A;  4TUI A;  3RL5 A;  1T70 A;  3ZU0 A;  4NZV A;  3H64 A;  3H61 A;  1T71 A;  4FBW A;  3FGA C;  3H67 A;  4UT3 B;  4ORA A;  1XZW A;  1S3M A;  3N5U A;  1WAO 1;  3PSN A;  1S8E A;  4LAC C;  3E7B A;  4H2F A;  3DW8 C;  2ZBM A;  4ORC A;  2Z06 A;  3H69 A;  3H62 B;  4MP0 A;  4JA9 A;  1S95 A;  4J6O A;  5J28 A;  4KKZ A;  3QG5 C;  3H68 A;  4DSY A;  4O4K A;  5C1V A;  2WDD A;  4B2O A;  4ORB A;  2Q8U A;  3HVQ A;  1KBP A;  4LU9 A;  3JYF A;  4WWL A;  4IL1 A;  4XPN A;  3C5W C;  3GVE A;  4O24 A;  3H60 A;  4JA7 A;  1QFC A;  2ZO9 B;  3THN A;  2P6B A;  4O43 A;  2NPP C;  2QFP A;  3D03 A;  2DXN A;  3ICF A;  4OR9 A;  3H63 A;  3K7V C;  4ZX2 A;  1MF8 A;  2NXF A;  2WDF A;  2HY1 A;  4HD0 A;  1S3L A;  1XM7 A;  2QJC A;  4DHL A;  5JPE A;  3FLO A;  5INB A;  5F3W A;  4IYP C;  3IVE A;  3V4Y A;  2GJU A;  3ZTV A;  2XMO A;  3QFK A;  2BQ8 X;  1SU1 A;  4KBP A;  3QFM A; 
#chains in the Genus database with same CATH homology
 3RQZ A;  5HPE A;  4I5N C;  1U32 A;  3KBP A;  3EGG A;  3AV0 A;  1OI8 A;  1OID A;  2CV9 A;  1JK7 A;  2A22 A;  3PSO A;  2NYL C;  1S3N A;  3RL3 A;  5JPF A;  2O8G A;  5JJT A;  2IE3 C;  3C9F A;  3T1I A;  4G9J A;  4Q7F A;  4F0Z A;  2YEQ A;  1G5B A;  2JOG A;  3EGH A;  5EQV A;  4UT2 A;  1AUI A;  1HPU A;  4FCX A;  4H1Y P;  1WAR A;  2DXL A;  4H2I A;  4V0V A;  2WDC A;  2WDE A;  5B8I A;  1HP1 A;  1TCO A;  4UWQ A;  1W24 A;  1Z2W A;  3P71 C;  1FJM A;  3IB8 A;  2Z72 A;  1II7 A;  3E7A A;  3H66 A;  2YVT A;  3QFO A;  4UT3 A;  2R17 A;  2QFR A;  4FBK A;  4DT2 A;  1UF3 A;  4MOV A;  3DSC A;  2USH A;  1V73 A;  2HYP A;  3LL8 A;  3TGH A;  5IOH A;  2NYM C;  1OIE A;  4FBQ A;  1HO5 A;  4H1S A;  4M0V A;  4MOY A;  2Z1A A;  1QHW A;  2ZOA A;  4YKE A;  1USH A;  2AHD A;  3AUZ A;  2O8A A;  4LTY A;  2BDX A;  1UTE A;  3E0J A;  2IE4 C;  5GTU A;  3RL4 A;  3IB7 A;  4V0W A;  1Z2X A;  3K7W C;  3CK2 A;  2DFJ A;  1S70 A;  2HYO A;  5DNY A;  2BCD A;  4V0X A;  2KKN A;  3THO B;  4I5L C;  1M63 A;  3IVD A;  3QFN A;  4TUG A;  1NNW A;  4H2B A;  4O5G A;  1IT6 A;  4ZVZ A;  4H2G A;  2IAE C;  3DSD A;  4TUI A;  3RL5 A;  1T70 A;  3ZU0 A;  4NZV A;  3H64 A;  3H61 A;  1T71 A;  4FBW A;  3FGA C;  3H67 A;  4UT3 B;  4ORA A;  1XZW A;  1S3M A;  3N5U A;  1WAO 1;  3PSN A;  1S8E A;  4LAC C;  3E7B A;  4H2F A;  3DW8 C;  2ZBM A;  4ORC A;  2Z06 A;  3H69 A;  3H62 B;  4MP0 A;  4JA9 A;  1S95 A;  4J6O A;  5J28 A;  4KKZ A;  3QG5 C;  3H68 A;  4DSY A;  4O4K A;  5C1V A;  2WDD A;  4B2O A;  4ORB A;  2Q8U A;  3HVQ A;  1KBP A;  4LU9 A;  3JYF A;  4WWL A;  4IL1 A;  4XPN A;  3C5W C;  3GVE A;  4O24 A;  3H60 A;  4JA7 A;  1QFC A;  2ZO9 B;  3THN A;  2P6B A;  4O43 A;  2NPP C;  2QFP A;  3D03 A;  2DXN A;  3ICF A;  4OR9 A;  3H63 A;  3K7V C;  4ZX2 A;  1MF8 A;  2NXF A;  2WDF A;  2HY1 A;  4HD0 A;  1S3L A;  1XM7 A;  2QJC A;  4DHL A;  5JPE A;  3FLO A;  5INB A;  5F3W A;  4IYP C;  3IVE A;  3V4Y A;  2GJU A;  3ZTV A;  2XMO A;  3QFK A;  2BQ8 X;  1SU1 A;  4KBP A;  3QFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...