4ZWBA

Crystal structure of maltose-bound human glut3 in the outward-occluded conformation at 2.4 angstrom
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
468
structure length
468
Chain Sequence
TQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFITKTLTDKGNAPPSEVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of ligand recognition and transport by glucose transporters
pubmed doi rcsb
molecule keywords Solute carrier family 2, facilitated glucose transporter mem
molecule tags Transport protein
source organism Homo sapiens
total genus 206
structure length 468
sequence length 468
ec nomenclature
pdb deposition date 2015-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00083 Sugar_tr Sugar (and other) transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.20 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; MFS general substrate transporter like domains 4zwbA00
5EQGA 4GBYA 4ZWBA 4TPHA 4U4VA 4U4WA 4U4TA 4OH3A 5D58A 4ZWCA 4ZW9A 4LEPA 4YBQA 4APSA 4GC0A 2Y5YA 1PV6A 5EQIA 4YB9D 5D59A 1PV7A 4GBZA 4IKYA 4D2BA 4UVMA 4IKXA 4TPGA 4IKVA 4W6VA 4IU9A 4ZYRA 4IKWA 4XNJA 5EQHA 3O7QA 4OAAA 4LDSA 4IKZA 5D6KA 3WDOA 2V8NA 4TPJA 4JREA 4QIQA 4Q65A 4JA3A 1PW4A 4D2CA 4D2DA 5C65A 5GXBA 3O7PA 4PYPA 2CFQA 4XNIA 2XUTA 4JR9A 5A2OA 4IU8A 2CFPA 4J05A 5A2NA
chains in the Genus database with same CATH superfamily
4Z5RD 3I4ND 4EXNA 3SE3B 5D28B 1PV6A 1JLIA 2ERJD 1HWGA 1N1FA 4ZYRA 2PSMA 5C7XA 4D2CA 5C3ED 1ITLA 1F45B 3EW3A 3SE4B 4GBYA 4X51A 1RW5A 4GC0A 4YB9D 4A93D 1PW6A 1V7NV 3NCFA 4J4LC 4W6VA 1IL6A 1HIKA 5C65A 2Q14A 1BCNA 2IL6A 2JA7D 3BESL 5C4XD 3D87A 1M48A 1HUWA 2B91A 4A3GD 5FLMD 3WCYI 3MZGA 4IKZA 3WDOA 5LQBA 1Y1WD 4EXPA 4A3ID 2Z3QA 1Y6NL 5A2OA 3DI3A 1Y6KL 4U4TA 4NEJA 2B8UA 2GMFA 1HGUA 3HMXB 1A22A 3IRHA 4GBZA 3S9DA 1M4AA 4MHLA 1EKUA 3L5XA 3OG4A 2OQPA 1AU1A 4BXXD 1RFBA 3HOYD 1IK0A 4BY7D 2R7ZD 5GXBA 3L5WI 1BUYA 1M49A 5A2NA 1QVNA 4YDYI 1PY2A 1CNT1 3NCBA 1KF9A 2H24A 4IKYA 2D48A 4YQXA 5IP7D 4YUEC 3O7QA 1Z7CA 1NBPA 1EERA 2L3YA 1FYHA 1SCFA 3H0GD 3NCEA 4GS7A 2CFPA 3LB6B 4DKCA 4BBRD 4CNIC 5IYCD 1IARA 3QAZA 1Y6ML 3BPOA 4IKWA 5EQHA 4LDSA 5D72A 3LB6A 1HIJA 2LAGA 4LRLA 3H3VE 5EQGA 4ZWBA 3TGXB 4YBQA 1ETEA 2XQBA 4D2BA 1HZIA 1PVHB 4NI9A 3BPLA 2L3OA 3BPNA 1BP3A 1HWHA 1RHGA 5D70A 4D2DA 3N0PA 1CSGA 3O7PA 4BY1D 4ZF7A 2B63D 4J05A 4DKEA 2R92D 2INTA 2O26A 4A3MD 1A7MA 4LEPA 3QT2C 3HHCA 3EJJA 4A3BD 3HHRA 3DGCL 1CD9A 3HOWD 4NN5A 4QIQA 3Q1SI 4A3FD 4PYPA 5IYBD 3G9VB 2JA6D 2HYMB 1M4BA 2JA5D 5L6YC 5D58A 4ZW9A 2B8XA 3D48P 2CYKA 2Z3RA 4A3CD 5D71A 4A3DD 5D6KA 3AYHA 5KNHI 4NN7A 2B8ZA 1BBNA 3DI2A 1ITMA 1D9CA 5TS9A 4A3ED 5FHXA 1HULA 3INKC 4O6KA 2ILKA 4NKQC 3PIVA 3PO2D 1LQSL 1PW4A 1INRA 4GRWA 4IU8A 1VLKA 1Y14A 5C44D 2O27A 1EXZA 5EQIA 3UX9A 1D9GA 4UVMA 4IKXA 3NCCA 4A3KD 3UEZE 4PS4A 1V7MV 4ZS7A 4TPJA 1GA3A 2B90A 1AX8A 4JA3A 1BGCA 1M4RA 1B5LA 3HOVD 3PO3D 4U4VA 1M47A 1ILKA 3DUHC 4OH3A 3UF2A 3FKID 1EVSA 4DOHA 5IP9D 4BBSD 4IKVA 1IRLA 3N06A 3D85C 4A3JD 1F6FA 2Q98A 2LMSA 1Y1VD 1CN4C 1LKIA 4O9HA 4NEMA 3HOZD 4U4WA 1J7VL 3NPZA 4APSA 1I1RB 5IYDD 1IJZA 3HOUD 1GNCA 1PV7A 1RCBA 1Z92A 2E9WC 4YPGC 3B5KA 2C35A 1BGDA 4DKDA 1ITFA 3G6DA 3PIWA 1LK3A 2CFQA 2B5IA 2O6IA 4JR9A 3VA2A 1ALUA 1BGEA 2R93D 2Y5YA 5D59A 1WCMD 4WRLB 2JA8D 4OAAA 2V8NA 4A3LD 1YKBA 1PGRA 3QB7A 4TPHA 4ZWCA 2B8YA 2KZ1A 4NN6A 5FUCA 2Q7NB 1WU3I 1FG9A 4XNJA 3OG6A 3I4MD 1M4CA 4JREA 4Q65A 1P9MB 2VUMD 4XNIA 3OQ3A 5E4EA 3QWRB 1EMRA 4NI7A 5D22A 4FA8E 3UF5A 4RS1A 4TPGA 1ITIA 4IU9A 3HOXD 4I77Z 4DKFA 2XUTA 2D9QA 3QB1A 1CYLA 3DLQI 1AXIA
chains in the Genus database with same CATH topology
5EQGA 4GBYA 4ZWBA 4TPHA 4U4VA 4U4WA 4U4TA 4OH3A 5D58A 4ZWCA 4ZW9A 4LEPA 4YBQA 4APSA 4GC0A 2Y5YA 1PV6A 5EQIA 4YB9D 5D59A 1PV7A 4GBZA 4IKYA 4D2BA 4UVMA 4IKXA 4TPGA 4IKVA 4W6VA 4IU9A 4ZYRA 4IKWA 4XNJA 5EQHA 3O7QA 4OAAA 4LDSA 4IKZA 5D6KA 3WDOA 2V8NA 4TPJA 4JREA 4QIQA 4Q65A 4JA3A 1PW4A 4D2CA 4D2DA 5C65A 5GXBA 3O7PA 4PYPA 2CFQA 4XNIA 2XUTA 4JR9A 5A2OA 4IU8A 2CFPA 4J05A 5A2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EQG A;  4GBY A;  4ZWB A;  4TPH A;  4U4V A;  4U4W A;  4U4T A;  4OH3 A;  5D58 A;  4ZWC A;  4ZW9 A;  4LEP A;  4YBQ A;  4APS A;  4GC0 A;  2Y5Y A;  1PV6 A;  5EQI A;  4YB9 D;  5D59 A;  1PV7 A;  4GBZ A;  4IKY A;  4D2B A;  4UVM A;  4IKX A;  4TPG A;  4IKV A;  4W6V A;  4IU9 A;  4ZYR A;  4IKW A;  4XNJ A;  5EQH A;  3O7Q A;  4OAA A;  4LDS A;  4IKZ A;  5D6K A;  3WDO A;  2V8N A;  4TPJ A;  4JRE A;  4QIQ A;  4Q65 A;  4JA3 A;  1PW4 A;  4D2C A;  4D2D A;  5C65 A;  5GXB A;  3O7P A;  4PYP A;  2CFQ A;  4XNI A;  2XUT A;  4JR9 A;  5A2O A;  4IU8 A;  2CFP A;  4J05 A;  5A2N A; 
#chains in the Genus database with same CATH topology
 4Z5R D;  3I4N D;  4EXN A;  3SE3 B;  5D28 B;  1PV6 A;  1JLI A;  2ERJ D;  1HWG A;  1N1F A;  4ZYR A;  2PSM A;  5C7X A;  4D2C A;  5C3E D;  1ITL A;  1F45 B;  3EW3 A;  3SE4 B;  4GBY A;  4X51 A;  1RW5 A;  4GC0 A;  4YB9 D;  4A93 D;  1PW6 A;  1V7N V;  3NCF A;  4J4L C;  4W6V A;  1IL6 A;  1HIK A;  5C65 A;  2Q14 A;  1BCN A;  2IL6 A;  2JA7 D;  3BES L;  5C4X D;  3D87 A;  1M48 A;  1HUW A;  2B91 A;  4A3G D;  5FLM D;  3WCY I;  3MZG A;  4IKZ A;  3WDO A;  5LQB A;  1Y1W D;  4EXP A;  4A3I D;  2Z3Q A;  1Y6N L;  5A2O A;  3DI3 A;  1Y6K L;  4U4T A;  4NEJ A;  2B8U A;  2GMF A;  1HGU A;  3HMX B;  1A22 A;  3IRH A;  4GBZ A;  3S9D A;  1M4A A;  4MHL A;  1EKU A;  3L5X A;  3OG4 A;  2OQP A;  1AU1 A;  4BXX D;  1RFB A;  3HOY D;  1IK0 A;  4BY7 D;  2R7Z D;  5GXB A;  3L5W I;  1BUY A;  1M49 A;  5A2N A;  1QVN A;  4YDY I;  1PY2 A;  1CNT 1;  3NCB A;  1KF9 A;  2H24 A;  4IKY A;  2D48 A;  4YQX A;  5IP7 D;  4YUE C;  3O7Q A;  1Z7C A;  1NBP A;  1EER A;  2L3Y A;  1FYH A;  1SCF A;  3H0G D;  3NCE A;  4GS7 A;  2CFP A;  3LB6 B;  4DKC A;  4BBR D;  4CNI C;  5IYC D;  1IAR A;  3QAZ A;  1Y6M L;  3BPO A;  4IKW A;  5EQH A;  4LDS A;  5D72 A;  3LB6 A;  1HIJ A;  2LAG A;  4LRL A;  3H3V E;  5EQG A;  4ZWB A;  3TGX B;  4YBQ A;  1ETE A;  2XQB A;  4D2B A;  1HZI A;  1PVH B;  4NI9 A;  3BPL A;  2L3O A;  3BPN A;  1BP3 A;  1HWH A;  1RHG A;  5D70 A;  4D2D A;  3N0P A;  1CSG A;  3O7P A;  4BY1 D;  4ZF7 A;  2B63 D;  4J05 A;  4DKE A;  2R92 D;  2INT A;  2O26 A;  4A3M D;  1A7M A;  4LEP A;  3QT2 C;  3HHC A;  3EJJ A;  4A3B D;  3HHR A;  3DGC L;  1CD9 A;  3HOW D;  4NN5 A;  4QIQ A;  3Q1S I;  4A3F D;  4PYP A;  5IYB D;  3G9V B;  2JA6 D;  2HYM B;  1M4B A;  2JA5 D;  5L6Y C;  5D58 A;  4ZW9 A;  2B8X A;  3D48 P;  2CYK A;  2Z3R A;  4A3C D;  5D71 A;  4A3D D;  5D6K A;  3AYH A;  5KNH I;  4NN7 A;  2B8Z A;  1BBN A;  3DI2 A;  1ITM A;  1D9C A;  5TS9 A;  4A3E D;  5FHX A;  1HUL A;  3INK C;  4O6K A;  2ILK A;  4NKQ C;  3PIV A;  3PO2 D;  1LQS L;  1PW4 A;  1INR A;  4GRW A;  4IU8 A;  1VLK A;  1Y14 A;  5C44 D;  2O27 A;  1EXZ A;  5EQI A;  3UX9 A;  1D9G A;  4UVM A;  4IKX A;  3NCC A;  4A3K D;  3UEZ E;  4PS4 A;  1V7M V;  4ZS7 A;  4TPJ A;  1GA3 A;  2B90 A;  1AX8 A;  4JA3 A;  1BGC A;  1M4R A;  1B5L A;  3HOV D;  3PO3 D;  4U4V A;  1M47 A;  1ILK A;  3DUH C;  4OH3 A;  3UF2 A;  3FKI D;  1EVS A;  4DOH A;  5IP9 D;  4BBS D;  4IKV A;  1IRL A;  3N06 A;  3D85 C;  4A3J D;  1F6F A;  2Q98 A;  2LMS A;  1Y1V D;  1CN4 C;  1LKI A;  4O9H A;  4NEM A;  3HOZ D;  4U4W A;  1J7V L;  3NPZ A;  4APS A;  1I1R B;  5IYD D;  1IJZ A;  3HOU D;  1GNC A;  1PV7 A;  1RCB A;  1Z92 A;  2E9W C;  4YPG C;  3B5K A;  2C35 A;  1BGD A;  4DKD A;  1ITF A;  3G6D A;  3PIW A;  1LK3 A;  2CFQ A;  2B5I A;  2O6I A;  4JR9 A;  3VA2 A;  1ALU A;  1BGE A;  2R93 D;  2Y5Y A;  5D59 A;  1WCM D;  4WRL B;  2JA8 D;  4OAA A;  2V8N A;  4A3L D;  1YKB A;  1PGR A;  3QB7 A;  4TPH A;  4ZWC A;  2B8Y A;  2KZ1 A;  4NN6 A;  5FUC A;  2Q7N B;  1WU3 I;  1FG9 A;  4XNJ A;  3OG6 A;  3I4M D;  1M4C A;  4JRE A;  4Q65 A;  1P9M B;  2VUM D;  4XNI A;  3OQ3 A;  5E4E A;  3QWR B;  1EMR A;  4NI7 A;  5D22 A;  4FA8 E;  3UF5 A;  4RS1 A;  4TPG A;  1ITI A;  4IU9 A;  3HOX D;  4I77 Z;  4DKF A;  2XUT A;  2D9Q A;  3QB1 A;  1CYL A;  3DLQ I;  1AXI A; 
#chains in the Genus database with same CATH homology
 5EQG A;  4GBY A;  4ZWB A;  4TPH A;  4U4V A;  4U4W A;  4U4T A;  4OH3 A;  5D58 A;  4ZWC A;  4ZW9 A;  4LEP A;  4YBQ A;  4APS A;  4GC0 A;  2Y5Y A;  1PV6 A;  5EQI A;  4YB9 D;  5D59 A;  1PV7 A;  4GBZ A;  4IKY A;  4D2B A;  4UVM A;  4IKX A;  4TPG A;  4IKV A;  4W6V A;  4IU9 A;  4ZYR A;  4IKW A;  4XNJ A;  5EQH A;  3O7Q A;  4OAA A;  4LDS A;  4IKZ A;  5D6K A;  3WDO A;  2V8N A;  4TPJ A;  4JRE A;  4QIQ A;  4Q65 A;  4JA3 A;  1PW4 A;  4D2C A;  4D2D A;  5C65 A;  5GXB A;  3O7P A;  4PYP A;  2CFQ A;  4XNI A;  2XUT A;  4JR9 A;  5A2O A;  4IU8 A;  2CFP A;  4J05 A;  5A2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...