4ZX9A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10b
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
519
structure length
519
Chain Sequence
b'ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
molecule keywords Probable M17 family aminopeptidase
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
total genus 176
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zx9A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zx9A02
2V8GA 3D68A 3D4UA 4K3NA 2PJ7A 3PBEA 3FECA 2F8HA 5LRGA 4MMOA 3D67A 1JQGA 3EWRA 2QJ8A 5FSXA 2PJ3A 1CG2A 2O53A 2ZEGA 2J9AA 3HUVA 5CPAA 3LMSA 3KZWA 4ETJA 3CPAA 2FG1A 3WT4A 4P4IA 4ZY1A 4IQYA 2HB6A 4TWEA 5CMSA 5HIHA 4G1PA 4UIAA 1HDUA 4J5SA 1ELMP 3IIDA 4IAVA 3BHXA 4X2TA 1BAVA 4GM5A 2EWBA 3B3VA 3EWPA 2JBKA 3IJ3A 2GU2A 2ZEDA 1BPNA 3JRUA 1HDQA 2FVGA 3D7HA 1HEEA 3KQZA 3S9NA 1CPXA 2AFXA 1CX8A 4H2KA 3D7FA 4BD9A 4GUAA 2GREA 1XRYA 1TKJA 4FUUA 3FEDA 6CPAA 2PJ4A 2XEIA 1PCAA 2ZEHA 4W9YA 3NH5A 3D7GA 7CPAA 3B3WA 3NFZA 3IIBA 4LQGA 2DEAA 3RBUA 3TC8A 3V38A 3FJUA 1TKHA 4OC1A 4J5QA 2PVWA 3PFEA 3K9TA 4Z65A 3FVLA 2VL1A 5ELYA 4WJBA 1DE4C 3IO1A 5JH9A 2HC9A 3BXMA 3BI1A 5JM6A 3GQEA 3PB8X 4K0CA 1YD9A 2AFUA 3ETIA 2PJCA 1ZG7A 1UWYA 3SJXA 2CIJA 4P4BA 1VHUA 4UF4A 4ETKA 4GVVA 5E3BA 4OC3A 4MRIA 3GB0A 5K8PA 4AXVA 3FX6A 2PIYA 4OIWA 5HVHA 3KR4A 1F57A 4MHYA 4KSIA 2Q43A 1Y0YA 1NJRA 1ELLP 4Q7AA 1H8LA 1XMBA 4MCSA 4DUKA 1F2PA 2Q4ZA 4MCQA 5D29A 2XEFA 4UEFA 1QMUA 2ZEEA 3GLJA 3VATA 3FMCA 1TXZA 4JCAA 3PB4X 4ZY0A 3Q71A 3RAMA 2CTCA 3EJGA 3WC6A 1BPMA 1PYTB 2AFSA 5K8OA 3IIFA 2PIZA 1TXRA 3KHXA 3EW5A 3H8EA 2NYQA 5K8MA 5K8NA 1HJZA 1R3NA 4MXUA 8CPAA 3VFQA 1CP7A 2ZEFA 3D7DA 4UEZA 3D66A 1Q7LA 4P45A 4MCRA 3BI0A 4P10A 4FWUA 2PJ9A 3SIHA 3KASA 2IJZA 1F2OA 1Y0RA 2QVPA 5THWA 2FAVA 4OC4A 1IGBA 3GPGA 2VRIA 2XEJA 2BO9A 3KGQA 3GUXA 1ZG8A 4P6YA 4JYWA 3TX8A 4P4DA 4F9VA 5D8NA 5HVGA 4PXDA 1Z2LA 1VIXA 2ACFA 2PJBA 2V77A 4NGQA 3N5FA 4KYBA 3B3TA 4NGRA 4RUHA 5CB5A 3KI9A 3L2NA 4MCPA 5CBMA 3PBBA 4A94A 3IWWA 2AFOA 3ISXA 2Q51A 1YMEA 1ZR3A 4OC5A 5FSYA 3B7IA 2BOAA 4GVWA 3SIJA 3NA6A 4UIBA 2PVVA 4PQAA 2AFZA 1R43A 5J1QA 3H8GA 5DUSA 3WC7A 4NFRA 3B35A 4P4FA 4ONWA 1Z8LA 4UMLA 3VH9A 2AFCA 4R76A 2CF4A 3V2BA 1YSJA 5I4MA 5DS0A 3Q6ZA 3RZAA 2IMOA 4NGNA 1CBXA 1KWMA 1XJOA 2PJ0A 2OR4A 1BLLE 3FF3A 3SJGA 2PJ8A 4B6ZA 1XBUA 3CT9A 1LAMA 1ARLA 3B3CA 4YU9A 1YW4A 2ABZA 3K2KA 1VGYA 2PJ2A 1Y7EA 4ABLA 2AFWA 3LWUA 4NJQA 1EE3P 4PXCA 3EKEA 1GYTA 2CTBA 3GPQA 2FXKA 4JGKA 4DYOA 2NSMA 3KL9A 3B3SA 2AFMA 1SPVA 4OC2A 3JZTA 3KQXA 2GLFA 3IFEA 4J5RA 4F8ZA 3PB6X 4NGPA 1M4LA 5JGFA 5F09A 4ABKA 3SIGA 1XFOA 1YW6A 1AYEA 3IC1A 2L8RA 5LYLA 5AILA 4OKOA 2PCUA 2WYRA 1FNOA 2JEWA 4ZY2A 5FSVA 4OP4A 2GLJA 3NH8A 4FAIA 3H8FA 3CPXA 1ZR5A 4ESSA 3VARA 2O4HA 4WWVA 1NSAA 2X47A 3EJFA 4P4EA 3WABA 4R7MA 3DGVA 2C6CA 4NGSA 1Z5RA 4YWYA 3I1UA 3SJFA 1IY7A 3PRTA 4D86A 4EFDA 3PEIA 4PXBA 2C6PA 4R8FA 2V8VA 2ZEPA 4A37A 3T8WA 3MRUA 4DJLA 3GPOA 4X8IA 2OOTA 4EMEA 2PJ6A 2PRQA 3B2YA 3PB7X 1VHEA 4NGMA 4X3RA 3NH4A 1CP6A 2BFRA 1TKFA 2C1CA 3S9MA 1LANA 1ARMA 2ZELA 3S9LA 3EWOA 4IK2A 3SI1A 5LYFA 2EK9A 2PE3A 3CDXA 2POKA 2QYVA 3IEHA 2C6GA 3V45A 3HLPA 1ZG9A 1YLOA 3WC5A 3ISZA 2ZOFA 4JVVA 2PJ1A 2V8HA 3SIIA 3KR5A 1OBRA 2BFQA 3SI2A 2IQ6A 4F9UA 5FSUA 1VHOA 5LRJA 2ZENA 4PPZA 5FSZA 5CB3A 3KHZA 1DTDA 4OC0A 3SI0A 3SJEA 4O23A 3FH4A 4J4ZA 2I3CA 2WZNA 4MHZA 4ZI6A 2EEEA 3PB9X 2ZEOA 2ZEMA 4EWTA 5LYDA 4IHMA 4CPAA 1TF9A 3GQOA 2F7VA 4UEEA 4A39A 2JBJA 4NJRA 4OMEA 2LGRA 4MHPA 4TNUA 3QNVA 2PJAA 2ANPA 1FT7A 2ZOGA 2V8DA 3V7ZA 3EWQA 4P44A 1AMPA 5HXDA 1ZLHA 1LCPA 2RB7A 2XD7A 4ZX8A 1CPSA 2BCOA 2PJ5A 1LOKA 4MHNA 1QQ9A 2EK8A 4FBEA 4ZYQA 4JZ0A 4ZX9A 5IB9A 3MN8A 2RFHA 1ZLIA 5HVFA 4P4JA 4NGTA 1LFWA 4A38A 3PFOA 2DX6A 4R6TA 2G9DA 1TF8A 1TY8A 4TU0A 4JLLA 3FEEA 2XEGA 5LYIA 4PXEA 4OIDA 5LRKA 1RTQA 5HOLA 3DLJA 1LAPA
chains in the Genus database with same CATH superfamily
1NE9A 1YR0A 4B11A 1S5KA 3TOAA 2V8GA 3D68A 3D4UA 3NE8A 4K3NA 2PJ7A 1Z8WA 3PBEA 2GIVA 4MFQA 3FECA 2F8HA 5LRGA 4MMOA 3S6GA 3G8WA 4B5OA 3D67A 4FD5A 3H5ZA 1YREA 1JQGA 3EWRA 2QJ8A 4QC6A 5FSXA 2PJ3A 1CG2A 2O53A 4OADA 5JPHA 2X7BA 4X5KA 2JEVA 2J8MA 4KORA 3S6KA 3EC4A 4KZTA 2WCTA 2ZEGA 2J9AA 4A30A 4LX9A 4C68A 3HUVA 5CPAA 5I0CA 2Z10A 3LMSA 2Z3MA 3KZWA 4KOWA 4ETJA 3CPAA 3ZJ0A 2FG1A 3WT4A 2G3TA 4HNWB 4AG7A 1XF8A 4MFPA 4P4IA 3S6FA 2QMLA 2OH1A 4ZY1A 4IQYA 2HB6A 3KKWA 4TWEA 3RYOA 5CMSA 5HIHA 4G1PA 2R1IA 2AE6A 1FY7A 3FRMA 4UIAA 4KUBA 1HDUA 4J5SA 1ELMP 4JLYA 3IIDA 4UWIA 4IAVA 1ZO0A 3ZZIA 1IOFA 3BHXA 4X2TA 1BAVA 1NMTA 4GXHA 4GM5A 2EWBA 3B3VA 3TT2A 3EWPA 2FIAA 3UY5A 2JBKA 3IJ3A 4M6HA 2GU2A 2ZEDA 1BPNA 3JRUA 2WPWA 1HDQA 3CXSA 4A33A 1NSLA 4CYPA 3B8GA 4C2ZA 2FVGA 4F0YA 3D7HA 1HEEA 2FL4A 2PR1A 3KQZA 1Q2DA 2BEIA 3DR8A 5J8FA 5KTAA 2CY2A 4E2AA 1CPXA 1ON0A 3S9NA 2AFXA 1L0CA 1CX8A 2FCKA 4H2KA 4YGOA 2Z11A 1IICA 3D7FA 4BD9A 4GUAA 2GREA 1XRYA 4JD6A 4MY3A 2PR8A 1TKJA 2FIWA 2JDCA 4FUUA 3FEDA 4CGOA 3SHPA 6CPAA 4ZGYB 2PJ4A 3JVNA 2W2GA 2XEIA 3QB8A 1A2ZA 1PCAA 2ZEHA 4NCZA 2CNTA 4UCMA 2ZPAA 1QSOA 4KVME 2RNKA 4M85A 1WWZA 2EVNA 3NH5A 4W9YA 4CGNA 1R57A 3D7GA 7CPAA 2CNMA 3B3WA 2JZFA 3NFZA 4QUSA 3IIBA 2PDOA 4LQGA 2DEAA 4PV6A 4ZBGA 2P6EA 2YNCC 3RBUA 1Q2CA 2Z3LA 3EY5A 3T90A 3TC8A 4AB7A 2I79A 4B5PB 3V38A 1M4DA 1TKHA 3FJUA 4OC1A 3TO6A 4CAVA 4CAEA 4J5QA 1QSMA 2PVWA 3QAYA 3PFEA 3K9TA 1AUGA 4E8OA 4Z65A 5F48A 3FVLA 2VL1A 2Q04A 4WJBA 1DE4C 3IO1A 5ELYA 5JH9A 2HC9A 3FNCA 2JZEA 3GKRA 4KOUA 4CAWA 3BXMA 5HMNA 3BI1A 4KOVA 5JM6A 3GQEA 2FS5A 3PB8X 4K0CA 4CRZB 1YD9A 3ETIA 2AFUA 4M3SA 2J8RA 4MHDA 2PJCA 1ZG7A 4A95A 1UWYA 2Z0ZA 3SJXA 3PGPA 5CNPA 2CIJA 4P4BA 1VHUA 4UF4A 4ETKA 4GVVA 1XMTA 5IV0A 1YLEA 2VBQA 2EBJA 4CGLA 1GHEA 5E3BA 4KVOE 3V8IA 4CAXA 4OC3A 4MRIA 3G3SA 3GB0A 5K8PA 4AXVA 5C82A 3FX6A 2PIYA 4OIWA 3A9LA 5HVHA 3WR7A 1Z4EA 2FT0A 2KCWA 3KR4A 1F57A 3I9SA 4MHYA 5HH1A 4KSIA 4RN7A 2Q43A 1Y0YA 2ZW5A 3FYNA 4KSFA 4CYQA 5EBVA 4A31A 1NJRA 1ELLP 4Q7AA 1I12A 2JZDA 4KSAA 1H8LA 1XMBA 4MJ8A 4MCSA 1F2PA 2Q4ZA 3SXOA 4DUKA 4QBJA 4MCQA 1MJBA 5D29A 4AG9A 2XEFA 4UEFA 1QMUA 1CM0A 2ZEEA 3D8PA 3DDDA 3GLJA 3VATA 3FMCA 1TXZA 4JCAA 3IU1A 3PB4X 4ZY0A 5AG7A 3Q71A 3RAMA 1YX0A 2CTCA 3EJGA 3WC6A 3R1KA 3LODA 1QSRA 4PK2A 1BPMA 1PYTB 1Q2YA 4UBRA 2AFSA 2FXFA 5K8OA 4FD4A 2YNCA 2IL4A 3IIFA 3FIXA 4JXQA 2PIZA 2R8VA 1TXRA 3KHXA 3EW5A 1CJWA 4H6ZA 3H8EA 1M4IA 2NYQA 4KUAA 4XNHB 5K8MA 3JTKA 5K8NA 1HJZA 1R3NA 4MXUA 8CPAA 3VFQA 1CP7A 3D2PA 3TOBA 1VKCA 2ZEFA 1PUAA 3BJ7A 3D7DA 4UEZA 3D66A 4KLVA 1Q7LA 4JWPA 2BUEA 2YNEA 1RXTA 3FBUA 3IU2A 4M6GA 4P45A 4MCRA 3BI0A 1B87A 2WUUA 4P10A 4FWUA 2PJ9A 3SIHA 2NMTA 3TFYA 3KASA 2IJZA 1F2OA 1M44A 1Y0RA 2QVPA 2H5MA 5THWA 3W6SA 2FAVA 3R9GA 3D3SA 4MBUA 4PSXA 4OC4A 1IGBA 1J4JA 2DF5A 3GPGA 2VRIA 2XEJA 2BO9A 3KGQA 1S7FA 3GUXA 1ZG8A 2OZHA 1YK3A 3W6XA 4P6YA 4JYWA 1S7NA 5DWNA 1IU8A 4P4DA 3FXTA 3TX8A 5D8NA 2VQYA 4F9VA 5HVGA 4MI4A 5KTCA 4PXDA 1Z2LA 1VIXA 2ACFA 2PJBA 2V77A 3CXPA 3MGDA 4NGQA 3N5FA 2GANA 4KYBA 1P4NA 4UCPA 3B3TA 4NGRA 3QAHA 4RUHA 4NF1A 3P2FA 5CB5A 3KI9A 3L2NA 2DPTA 4MCPA 2BL1A 5CBMA 3PBBA 4JJXA 4A94A 1SQHA 1QSNA 3I3GA 3IWWA 4C2XA 4DNCA 5KTDA 2AFOA 3ISXA 2Q51A 3TTHA 1YMEA 2ZW4A 1ZR3A 3CZXA 3GY9A 4OC5A 2ATRA 5FSYA 3LACA 2QIRA 2EO8A 2FE7A 3B7IA 2BOAA 2ODFA 4M6IA 4GVWA 3SIJA 3NA6A 1MJ9A 1YGHA 4B5PA 4UIBA 2PVVA 2B3UA 4KOTA 4PQAA 2AFZA 4XPKA 1R43A 4KOXA 1YVOA 5J1QA 2D4OA 5EMIA 2J8NA 4B13A 2P6GA 3D2MA 3H8GA 2HV2A 1S3ZA 4H6UA 1IYLA 4II9A 5DUSA 3WC7A 4NFRA 2C27A 4UFXA 1Y7RA 3B35A 2K5TA 2Z3KA 3F5BA 1XE4A 4P4FA 4ONWA 1Z8LA 4UMLA 4KOSA 3R96A 2AFCA 4R76A 4ONUA 2CF4A 5F49A 3VH9A 1Z8XA 5A27A 5GCNA 1P0HA 5AG5A 4AVCA 4R3LA 3V2BA 1LRZA 1YSJA 5I4MA 1XEBA 5DS0A 2I00A 4YRHA 3Q6ZA 4CGMA 3RZAA 2IMOA 2Z3PA 2Q7BA 2ZW6A 4NGNA 2HUZA 1CBXA 2Z3OA 1KWMA 1XJOA 2PJ0A 3R95A 2OR4A 5H84A 1BLLE 3FF3A 4BBHA 3DR6A 4LQ6A 3SJGA 2PJ8A 3PP9A 2EUIA 4B6ZA 1XBUA 1S7LA 3CT9A 2RC4A 1LAMA 3TE4A 1ARLA 3B3CA 5G20A 4PK3A 1S7KA 4YU9A 1YW4A 4OLLA 5J8CA 2R98A 2Q44A 2ABZA 3K2KA 1YQEA 1VGYA 2PJ2A 1Y7EA 3OWCA 4ABLA 2Q7SA 2AFWA 3LWUA 4NJQA 4KLWA 1EE3P 4PXCA 1X12A 5F47A 1IIDA 2YNDA 4UFVA 3EKEA 1GYTA 4XNHC 4MY0A 2CTBA 2VEZA 1YVKA 3GPQA 2FXKA 4IUSA 2OZGA 3CXQA 1Y9WA 2CXAA 3H4QA 4JGKA 1JWQA 3RO0A 4DYOA 1Z4RA 1Y9KA 2NSMA 2PC1A 3KL9A 2B4DB 4AVAA 3B3SA 2QECA 2AFMA 1SPVA 2OZUA 4OC2A 3JZTA 2REFA 3KQXA 2GLFA 1X10A 5A28A 4KOYA 3IFEA 4J5RA 4F8ZA 2B5GB 4CGPA 3PB6X 3F8KA 4UWJA 1IOIA 3R9FA 4NGPA 1KUXA 2Y0MA 1M4LA 1MK4A 1S60A 4H89A 4HNYB 5E96A 5JGFA 2PQ8A 3C26A 5F09A 4ABKA 3VWEA 2GE3A 3SIGA 1XFOA 1YW6A 1AYEA 4PSWA 3IC1A 2L8RA 1N71A 2VZZA 5AILA 4OKOA 5LYLA 3EXNA 2PCUA 2WYRA 1FNOA 3JUWA 2JEWA 4ZY2A 5FSVA 4OP4A 2GLJA 3NH8A 4FAIA 3H8FA 3CPXA 1ZR5A 4ESSA 1V0CA 1I1DA 3GIUA 1M4GA 2O4HA 4WWVA 4UFWA 3VARA 2A4NA 2JDDA 4Q36A 1NSAA 3DNSA 2X47A 3EJFA 4P4EA 3WABA 4R7MA 2PSWA 2OB0A 1TIQA 2C6CA 3DGVA 4AVBA 4NGSA 2YGWA 1OZPA 2DPSA 4HNXB 1Z5RA 4YWYA 1KZFA 3I1UA 1XIXA 4R9MA 3SJFA 4MFLA 1IY7A 3PRTA 5G22A 3TO9A 4D86A 4R3KA 4EFDA 4RI1A 3PEIA 4PXBA 1Z8TA 4JXRA 2C6PA 4ORFA 4R8FA 2V8VA 4B12A 4C2YA 2ZEPA 4CS0B 2WSAA 4U9ZA 4A37A 4MFJA 4GS4A 4HKFA 4LUAA 4Y49B 3T8WA 1K4JA 2WPXA 3MRUA 4NEXA 3GPOA 4X8IA 3W91A 4DJLA 2OOTA 1RO5A 4EMEA 2Q4VA 2PJ6A 2PRQA 3B2YA 3PB7X 1VHEA 4NGMA 1UFHA 2D4PA 3NH4A 4X3RA 1CP6A 2BFRA 3FB3A 4BINA 2FSRA 1TKFA 2C1CA 3S9MA 1LANA 3EFAA 3NE7A 1ARMA 4K30A 2ZELA 3S9LA 3EWOA 4BMHA 4IK2A 3SI1A 1XOVA 5LYFA 2EK9A 2P6FA 2PE3A 2HQYA 3CDXA 3PZJA 4L8AA 4MFZA 2GFQA 2POKA 3TCVA 5DWMA 3TO7A 1IYKA 4MFKA 4QB9A 2QYVA 3IEHA 2C6GA 3V45A 4A32A 3HLPA 1QSTA 4U9YA 1ZG9A 1YLOA 3IWGA 2ARHA 4J3GA 3WC5A 3ISZA 1U6MA 2ZOFA 3BLNA 2G0BA 4JVVA 2PJ1A 3P2HA 4U5YA 3S6HA 2V8HA 4C7HA 3SIIA 2G3AA 2P0WA 3KR5A 1OBRA 2BFQA 3SI2A 2IQ6A 4F9UA 2REEA 5FSUA 1VHOA 4NSQA 5LRJA 1WK4A 2ZENA 4PPZA 3RNZA 4A2ZA 4B10A 4CAFA 3IWEA 3DSBA 2B4BA 5FSZA 5CB3A 3BJ8A 3E0KA 3KHZA 1DTDA 2VXKA 4OC0A 5IX3A 3SI0A 3SJEA 2ZW7A 3LD2A 4O23A 3FH4A 5ISVA 4J4ZA 3N7ZA 1Z9UA 2I3CA 4Q38A 2WZNA 5AG4A 2AJ6A 4MHZA 4R87A 4ZI6A 2EEEA 3K9UA 4F0XA 2B3VA 3PB9X 2ZEOA 4EVYA 1PU9A 2OU2A 2ZEMA 4QVTA 5C88A 1BO4A 4CRYB 4EWTA 5LYDA 1BOBA 2DXQA 2PRBA 4IHMA 4XPLA 2BSWA 1I21A 3F0AA 4CPAA 1M1DA 4YFJA 1TF9A 3GQOA 2F7VA 4UEEA 4A39A 2KQVA 2Z3NA 2JBJA 4NJRA 4HPSA 4OMEA 4FD7A 2LGRA 1MJAA 5H86A 4NXYA 2JLMA 4F6AA 2B4DA 4MHPA 4TNUA 3QNVA 2F5IA 4L89A 2PJAA 5AGEA 5AG6A 3EO4A 2ANPA 1KUYA 4C7IA 1FT7A 2ZOGA 4XPDC 5BWAB 2V8DA 3V7ZA 5F46A 3EWQA 2VZYA 4FD6A 4P44A 4E0AA 2B5GA 1AMPA 5HXDA 1ZLHA 4R57A 4CYNA 1LCPA 2O28A 2RB7A 5FVJA 2XD7A 4ZX8A 5G21A 1CPSA 3VWDA 2BCOA 2PJ5A 3SXNA 1LOKA 4MHNA 1QQ9A 2EK8A 4B14A 4FBEA 4ZYQA 4JZ0A 2ZXVA 4ZX9A 5IB9A 1B6BA 3MN8A 2RFHA 2Q0YA 5G1ZA 1ZLIA 4IF5A 5HVFA 4CYOA 4RS2A 4P4JA 3R9EA 1VHSA 5EC4A 3GYAA 2Q4YA 1LFWA 4NGTA 4OAEA 4A38A 3PFOA 2DX6A 2R7HA 4KVXA 4R6TA 4UCNA 2G9DA 1TF8A 1TY8A 4TU0A 4JLLA 3FEEA 2VI7A 2XEGA 4XPDB 5LYIA 4PXEA 3T9YA 5JQ4A 4OIDA 5LRKA 4KS9A 1RTQA 4UA3A 3IGRA 2B58A 1IB1E 4Y49C 5HOLA 1KUVA 3DLJA 2CNSA 1LAPA 5IB0A 4I49A
chains in the Genus database with same CATH topology
2V8GA 3D68A 3D4UA 4K3NA 2PJ7A 3PBEA 3FECA 2F8HA 5LRGA 4MMOA 3D67A 1JQGA 3EWRA 2QJ8A 5FSXA 2PJ3A 1CG2A 2O53A 2ZEGA 2J9AA 3HUVA 5CPAA 3LMSA 3KZWA 4ETJA 3CPAA 2FG1A 3WT4A 4P4IA 4ZY1A 4IQYA 2HB6A 4TWEA 5CMSA 5HIHA 4G1PA 4UIAA 1HDUA 4J5SA 1ELMP 3IIDA 4IAVA 3BHXA 4X2TA 1BAVA 4GM5A 2EWBA 3B3VA 3EWPA 2JBKA 3IJ3A 2GU2A 2ZEDA 1BPNA 3JRUA 1HDQA 2FVGA 3D7HA 1HEEA 3KQZA 3S9NA 1CPXA 2AFXA 1CX8A 4H2KA 3D7FA 4BD9A 4GUAA 2GREA 1XRYA 1TKJA 4FUUA 3FEDA 6CPAA 2PJ4A 2XEIA 1PCAA 2ZEHA 4W9YA 3NH5A 3D7GA 7CPAA 3B3WA 3NFZA 3IIBA 4LQGA 2DEAA 3RBUA 3TC8A 3V38A 3FJUA 1TKHA 4OC1A 4J5QA 2PVWA 3PFEA 3K9TA 4Z65A 3FVLA 2VL1A 5ELYA 4WJBA 1DE4C 3IO1A 5JH9A 2HC9A 3BXMA 3BI1A 5JM6A 3GQEA 3PB8X 4K0CA 1YD9A 2AFUA 3ETIA 2PJCA 1ZG7A 1UWYA 3SJXA 2CIJA 4P4BA 1VHUA 4UF4A 4ETKA 4GVVA 5E3BA 4OC3A 4MRIA 3GB0A 5K8PA 4AXVA 3FX6A 2PIYA 4OIWA 5HVHA 3KR4A 1F57A 4MHYA 4KSIA 2Q43A 1Y0YA 1NJRA 1ELLP 4Q7AA 1H8LA 1XMBA 4MCSA 4DUKA 1F2PA 2Q4ZA 4MCQA 5D29A 2XEFA 4UEFA 1QMUA 2ZEEA 3GLJA 3VATA 3FMCA 1TXZA 4JCAA 3PB4X 4ZY0A 3Q71A 3RAMA 2CTCA 3EJGA 3WC6A 1BPMA 1PYTB 2AFSA 5K8OA 3IIFA 2PIZA 1TXRA 3KHXA 3EW5A 3H8EA 2NYQA 5K8MA 5K8NA 1HJZA 1R3NA 4MXUA 8CPAA 3VFQA 1CP7A 2ZEFA 3D7DA 4UEZA 3D66A 1Q7LA 4P45A 4MCRA 3BI0A 4P10A 4FWUA 2PJ9A 3SIHA 3KASA 2IJZA 1F2OA 1Y0RA 2QVPA 5THWA 2FAVA 4OC4A 1IGBA 3GPGA 2VRIA 2XEJA 2BO9A 3KGQA 3GUXA 1ZG8A 4P6YA 4JYWA 3TX8A 4P4DA 4F9VA 5D8NA 5HVGA 4PXDA 1Z2LA 1VIXA 2ACFA 2PJBA 2V77A 4NGQA 3N5FA 4KYBA 3B3TA 4NGRA 4RUHA 5CB5A 3KI9A 3L2NA 4MCPA 5CBMA 3PBBA 4A94A 3IWWA 2AFOA 3ISXA 2Q51A 1YMEA 1ZR3A 4OC5A 5FSYA 3B7IA 2BOAA 4GVWA 3SIJA 3NA6A 4UIBA 2PVVA 4PQAA 2AFZA 1R43A 5J1QA 3H8GA 5DUSA 3WC7A 4NFRA 3B35A 4P4FA 4ONWA 1Z8LA 4UMLA 3VH9A 2AFCA 4R76A 2CF4A 3V2BA 1YSJA 5I4MA 5DS0A 3Q6ZA 3RZAA 2IMOA 4NGNA 1CBXA 1KWMA 1XJOA 2PJ0A 2OR4A 1BLLE 3FF3A 3SJGA 2PJ8A 4B6ZA 1XBUA 3CT9A 1LAMA 1ARLA 3B3CA 4YU9A 1YW4A 2ABZA 3K2KA 1VGYA 2PJ2A 1Y7EA 4ABLA 2AFWA 3LWUA 4NJQA 1EE3P 4PXCA 3EKEA 1GYTA 2CTBA 3GPQA 2FXKA 4JGKA 4DYOA 2NSMA 3KL9A 3B3SA 2AFMA 1SPVA 4OC2A 3JZTA 3KQXA 2GLFA 3IFEA 4J5RA 4F8ZA 3PB6X 4NGPA 1M4LA 5JGFA 5F09A 4ABKA 3SIGA 1XFOA 1YW6A 1AYEA 3IC1A 2L8RA 5LYLA 5AILA 4OKOA 2PCUA 2WYRA 1FNOA 2JEWA 4ZY2A 5FSVA 4OP4A 2GLJA 3NH8A 4FAIA 3H8FA 3CPXA 1ZR5A 4ESSA 3VARA 2O4HA 4WWVA 1NSAA 2X47A 3EJFA 4P4EA 3WABA 4R7MA 3DGVA 2C6CA 4NGSA 1Z5RA 4YWYA 3I1UA 3SJFA 1IY7A 3PRTA 4D86A 4EFDA 3PEIA 4PXBA 2C6PA 4R8FA 2V8VA 2ZEPA 4A37A 3T8WA 3MRUA 4DJLA 3GPOA 4X8IA 2OOTA 4EMEA 2PJ6A 2PRQA 3B2YA 3PB7X 1VHEA 4NGMA 4X3RA 3NH4A 1CP6A 2BFRA 1TKFA 2C1CA 3S9MA 1LANA 1ARMA 2ZELA 3S9LA 3EWOA 4IK2A 3SI1A 5LYFA 2EK9A 2PE3A 3CDXA 2POKA 2QYVA 3IEHA 2C6GA 3V45A 3HLPA 1ZG9A 1YLOA 3WC5A 3ISZA 2ZOFA 4JVVA 2PJ1A 2V8HA 3SIIA 3KR5A 1OBRA 2BFQA 3SI2A 2IQ6A 4F9UA 5FSUA 1VHOA 5LRJA 2ZENA 4PPZA 5FSZA 5CB3A 3KHZA 1DTDA 4OC0A 3SI0A 3SJEA 4O23A 3FH4A 4J4ZA 2I3CA 2WZNA 4MHZA 4ZI6A 2EEEA 3PB9X 2ZEOA 2ZEMA 4EWTA 5LYDA 4IHMA 4CPAA 1TF9A 3GQOA 2F7VA 4UEEA 4A39A 2JBJA 4NJRA 4OMEA 2LGRA 4MHPA 4TNUA 3QNVA 2PJAA 2ANPA 1FT7A 2ZOGA 2V8DA 3V7ZA 3EWQA 4P44A 1AMPA 5HXDA 1ZLHA 1LCPA 2RB7A 2XD7A 4ZX8A 1CPSA 2BCOA 2PJ5A 1LOKA 4MHNA 1QQ9A 2EK8A 4FBEA 4ZYQA 4JZ0A 4ZX9A 5IB9A 3MN8A 2RFHA 1ZLIA 5HVFA 4P4JA 4NGTA 1LFWA 4A38A 3PFOA 2DX6A 4R6TA 2G9DA 1TF8A 1TY8A 4TU0A 4JLLA 3FEEA 2XEGA 5LYIA 4PXEA 4OIDA 5LRKA 1RTQA 5HOLA 3DLJA 1LAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8G A;  3D68 A;  3D4U A;  4K3N A;  2PJ7 A;  3PBE A;  3FEC A;  2F8H A;  5LRG A;  4MMO A;  3D67 A;  1JQG A;  3EWR A;  2QJ8 A;  5FSX A;  2PJ3 A;  1CG2 A;  2O53 A;  2ZEG A;  2J9A A;  3HUV A;  5CPA A;  3LMS A;  3KZW A;  4ETJ A;  3CPA A;  2FG1 A;  3WT4 A;  4P4I A;  4ZY1 A;  4IQY A;  2HB6 A;  4TWE A;  5CMS A;  5HIH A;  4G1P A;  4UIA A;  1HDU A;  4J5S A;  1ELM P;  3IID A;  4IAV A;  3BHX A;  4X2T A;  1BAV A;  4GM5 A;  2EWB A;  3B3V A;  3EWP A;  2JBK A;  3IJ3 A;  2GU2 A;  2ZED A;  1BPN A;  3JRU A;  1HDQ A;  2FVG A;  3D7H A;  1HEE A;  3KQZ A;  3S9N A;  1CPX A;  2AFX A;  1CX8 A;  4H2K A;  3D7F A;  4BD9 A;  4GUA A;  2GRE A;  1XRY A;  1TKJ A;  4FUU A;  3FED A;  6CPA A;  2PJ4 A;  2XEI A;  1PCA A;  2ZEH A;  4W9Y A;  3NH5 A;  3D7G A;  7CPA A;  3B3W A;  3NFZ A;  3IIB A;  4LQG A;  2DEA A;  3RBU A;  3TC8 A;  3V38 A;  3FJU A;  1TKH A;  4OC1 A;  4J5Q A;  2PVW A;  3PFE A;  3K9T A;  4Z65 A;  3FVL A;  2VL1 A;  5ELY A;  4WJB A;  1DE4 C;  3IO1 A;  5JH9 A;  2HC9 A;  3BXM A;  3BI1 A;  5JM6 A;  3GQE A;  3PB8 X;  4K0C A;  1YD9 A;  2AFU A;  3ETI A;  2PJC A;  1ZG7 A;  1UWY A;  3SJX A;  2CIJ A;  4P4B A;  1VHU A;  4UF4 A;  4ETK A;  4GVV A;  5E3B A;  4OC3 A;  4MRI A;  3GB0 A;  5K8P A;  4AXV A;  3FX6 A;  2PIY A;  4OIW A;  5HVH A;  3KR4 A;  1F57 A;  4MHY A;  4KSI A;  2Q43 A;  1Y0Y A;  1NJR A;  1ELL P;  4Q7A A;  1H8L A;  1XMB A;  4MCS A;  4DUK A;  1F2P A;  2Q4Z A;  4MCQ A;  5D29 A;  2XEF A;  4UEF A;  1QMU A;  2ZEE A;  3GLJ A;  3VAT A;  3FMC A;  1TXZ A;  4JCA A;  3PB4 X;  4ZY0 A;  3Q71 A;  3RAM A;  2CTC A;  3EJG A;  3WC6 A;  1BPM A;  1PYT B;  2AFS A;  5K8O A;  3IIF A;  2PIZ A;  1TXR A;  3KHX A;  3EW5 A;  3H8E A;  2NYQ A;  5K8M A;  5K8N A;  1HJZ A;  1R3N A;  4MXU A;  8CPA A;  3VFQ A;  1CP7 A;  2ZEF A;  3D7D A;  4UEZ A;  3D66 A;  1Q7L A;  4P45 A;  4MCR A;  3BI0 A;  4P10 A;  4FWU A;  2PJ9 A;  3SIH A;  3KAS A;  2IJZ A;  1F2O A;  1Y0R A;  2QVP A;  5THW A;  2FAV A;  4OC4 A;  1IGB A;  3GPG A;  2VRI A;  2XEJ A;  2BO9 A;  3KGQ A;  3GUX A;  1ZG8 A;  4P6Y A;  4JYW A;  3TX8 A;  4P4D A;  4F9V A;  5D8N A;  5HVG A;  4PXD A;  1Z2L A;  1VIX A;  2ACF A;  2PJB A;  2V77 A;  4NGQ A;  3N5F A;  4KYB A;  3B3T A;  4NGR A;  4RUH A;  5CB5 A;  3KI9 A;  3L2N A;  4MCP A;  5CBM A;  3PBB A;  4A94 A;  3IWW A;  2AFO A;  3ISX A;  2Q51 A;  1YME A;  1ZR3 A;  4OC5 A;  5FSY A;  3B7I A;  2BOA A;  4GVW A;  3SIJ A;  3NA6 A;  4UIB A;  2PVV A;  4PQA A;  2AFZ A;  1R43 A;  5J1Q A;  3H8G A;  5DUS A;  3WC7 A;  4NFR A;  3B35 A;  4P4F A;  4ONW A;  1Z8L A;  4UML A;  3VH9 A;  2AFC A;  4R76 A;  2CF4 A;  3V2B A;  1YSJ A;  5I4M A;  5DS0 A;  3Q6Z A;  3RZA A;  2IMO A;  4NGN A;  1CBX A;  1KWM A;  1XJO A;  2PJ0 A;  2OR4 A;  1BLL E;  3FF3 A;  3SJG A;  2PJ8 A;  4B6Z A;  1XBU A;  3CT9 A;  1LAM A;  1ARL A;  3B3C A;  4YU9 A;  1YW4 A;  2ABZ A;  3K2K A;  1VGY A;  2PJ2 A;  1Y7E A;  4ABL A;  2AFW A;  3LWU A;  4NJQ A;  1EE3 P;  4PXC A;  3EKE A;  1GYT A;  2CTB A;  3GPQ A;  2FXK A;  4JGK A;  4DYO A;  2NSM A;  3KL9 A;  3B3S A;  2AFM A;  1SPV A;  4OC2 A;  3JZT A;  3KQX A;  2GLF A;  3IFE A;  4J5R A;  4F8Z A;  3PB6 X;  4NGP A;  1M4L A;  5JGF A;  5F09 A;  4ABK A;  3SIG A;  1XFO A;  1YW6 A;  1AYE A;  3IC1 A;  2L8R A;  5LYL A;  5AIL A;  4OKO A;  2PCU A;  2WYR A;  1FNO A;  2JEW A;  4ZY2 A;  5FSV A;  4OP4 A;  2GLJ A;  3NH8 A;  4FAI A;  3H8F A;  3CPX A;  1ZR5 A;  4ESS A;  3VAR A;  2O4H A;  4WWV A;  1NSA A;  2X47 A;  3EJF A;  4P4E A;  3WAB A;  4R7M A;  3DGV A;  2C6C A;  4NGS A;  1Z5R A;  4YWY A;  3I1U A;  3SJF A;  1IY7 A;  3PRT A;  4D86 A;  4EFD A;  3PEI A;  4PXB A;  2C6P A;  4R8F A;  2V8V A;  2ZEP A;  4A37 A;  3T8W A;  3MRU A;  4DJL A;  3GPO A;  4X8I A;  2OOT A;  4EME A;  2PJ6 A;  2PRQ A;  3B2Y A;  3PB7 X;  1VHE A;  4NGM A;  4X3R A;  3NH4 A;  1CP6 A;  2BFR A;  1TKF A;  2C1C A;  3S9M A;  1LAN A;  1ARM A;  2ZEL A;  3S9L A;  3EWO A;  4IK2 A;  3SI1 A;  5LYF A;  2EK9 A;  2PE3 A;  3CDX A;  2POK A;  2QYV A;  3IEH A;  2C6G A;  3V45 A;  3HLP A;  1ZG9 A;  1YLO A;  3WC5 A;  3ISZ A;  2ZOF A;  4JVV A;  2PJ1 A;  2V8H A;  3SII A;  3KR5 A;  1OBR A;  2BFQ A;  3SI2 A;  2IQ6 A;  4F9U A;  5FSU A;  1VHO A;  5LRJ A;  2ZEN A;  4PPZ A;  5FSZ A;  5CB3 A;  3KHZ A;  1DTD A;  4OC0 A;  3SI0 A;  3SJE A;  4O23 A;  3FH4 A;  4J4Z A;  2I3C A;  2WZN A;  4MHZ A;  4ZI6 A;  2EEE A;  3PB9 X;  2ZEO A;  2ZEM A;  4EWT A;  5LYD A;  4IHM A;  4CPA A;  1TF9 A;  3GQO A;  2F7V A;  4UEE A;  4A39 A;  2JBJ A;  4NJR A;  4OME A;  2LGR A;  4MHP A;  4TNU A;  3QNV A;  2PJA A;  2ANP A;  1FT7 A;  2ZOG A;  2V8D A;  3V7Z A;  3EWQ A;  4P44 A;  1AMP A;  5HXD A;  1ZLH A;  1LCP A;  2RB7 A;  2XD7 A;  4ZX8 A;  1CPS A;  2BCO A;  2PJ5 A;  1LOK A;  4MHN A;  1QQ9 A;  2EK8 A;  4FBE A;  4ZYQ A;  4JZ0 A;  4ZX9 A;  5IB9 A;  3MN8 A;  2RFH A;  1ZLI A;  5HVF A;  4P4J A;  4NGT A;  1LFW A;  4A38 A;  3PFO A;  2DX6 A;  4R6T A;  2G9D A;  1TF8 A;  1TY8 A;  4TU0 A;  4JLL A;  3FEE A;  2XEG A;  5LYI A;  4PXE A;  4OID A;  5LRK A;  1RTQ A;  5HOL A;  3DLJ A;  1LAP A; 
#chains in the Genus database with same CATH topology
 1NE9 A;  1YR0 A;  4B11 A;  1S5K A;  3TOA A;  2V8G A;  3D68 A;  3D4U A;  3NE8 A;  4K3N A;  2PJ7 A;  1Z8W A;  3PBE A;  2GIV A;  4MFQ A;  3FEC A;  2F8H A;  5LRG A;  4MMO A;  3S6G A;  3G8W A;  4B5O A;  3D67 A;  4FD5 A;  3H5Z A;  1YRE A;  1JQG A;  3EWR A;  2QJ8 A;  4QC6 A;  5FSX A;  2PJ3 A;  1CG2 A;  2O53 A;  4OAD A;  5JPH A;  2X7B A;  4X5K A;  2JEV A;  2J8M A;  4KOR A;  3S6K A;  3EC4 A;  4KZT A;  2WCT A;  2ZEG A;  2J9A A;  4A30 A;  4LX9 A;  4C68 A;  3HUV A;  5CPA A;  5I0C A;  2Z10 A;  3LMS A;  2Z3M A;  3KZW A;  4KOW A;  4ETJ A;  3CPA A;  3ZJ0 A;  2FG1 A;  3WT4 A;  2G3T A;  4HNW B;  4AG7 A;  1XF8 A;  4MFP A;  4P4I A;  3S6F A;  2QML A;  2OH1 A;  4ZY1 A;  4IQY A;  2HB6 A;  3KKW A;  4TWE A;  3RYO A;  5CMS A;  5HIH A;  4G1P A;  2R1I A;  2AE6 A;  1FY7 A;  3FRM A;  4UIA A;  4KUB A;  1HDU A;  4J5S A;  1ELM P;  4JLY A;  3IID A;  4UWI A;  4IAV A;  1ZO0 A;  3ZZI A;  1IOF A;  3BHX A;  4X2T A;  1BAV A;  1NMT A;  4GXH A;  4GM5 A;  2EWB A;  3B3V A;  3TT2 A;  3EWP A;  2FIA A;  3UY5 A;  2JBK A;  3IJ3 A;  4M6H A;  2GU2 A;  2ZED A;  1BPN A;  3JRU A;  2WPW A;  1HDQ A;  3CXS A;  4A33 A;  1NSL A;  4CYP A;  3B8G A;  4C2Z A;  2FVG A;  4F0Y A;  3D7H A;  1HEE A;  2FL4 A;  2PR1 A;  3KQZ A;  1Q2D A;  2BEI A;  3DR8 A;  5J8F A;  5KTA A;  2CY2 A;  4E2A A;  1CPX A;  1ON0 A;  3S9N A;  2AFX A;  1L0C A;  1CX8 A;  2FCK A;  4H2K A;  4YGO A;  2Z11 A;  1IIC A;  3D7F A;  4BD9 A;  4GUA A;  2GRE A;  1XRY A;  4JD6 A;  4MY3 A;  2PR8 A;  1TKJ A;  2FIW A;  2JDC A;  4FUU A;  3FED A;  4CGO A;  3SHP A;  6CPA A;  4ZGY B;  2PJ4 A;  3JVN A;  2W2G A;  2XEI A;  3QB8 A;  1A2Z A;  1PCA A;  2ZEH A;  4NCZ A;  2CNT A;  4UCM A;  2ZPA A;  1QSO A;  4KVM E;  2RNK A;  4M85 A;  1WWZ A;  2EVN A;  3NH5 A;  4W9Y A;  4CGN A;  1R57 A;  3D7G A;  7CPA A;  2CNM A;  3B3W A;  2JZF A;  3NFZ A;  4QUS A;  3IIB A;  2PDO A;  4LQG A;  2DEA A;  4PV6 A;  4ZBG A;  2P6E A;  2YNC C;  3RBU A;  1Q2C A;  2Z3L A;  3EY5 A;  3T90 A;  3TC8 A;  4AB7 A;  2I79 A;  4B5P B;  3V38 A;  1M4D A;  1TKH A;  3FJU A;  4OC1 A;  3TO6 A;  4CAV A;  4CAE A;  4J5Q A;  1QSM A;  2PVW A;  3QAY A;  3PFE A;  3K9T A;  1AUG A;  4E8O A;  4Z65 A;  5F48 A;  3FVL A;  2VL1 A;  2Q04 A;  4WJB A;  1DE4 C;  3IO1 A;  5ELY A;  5JH9 A;  2HC9 A;  3FNC A;  2JZE A;  3GKR A;  4KOU A;  4CAW A;  3BXM A;  5HMN A;  3BI1 A;  4KOV A;  5JM6 A;  3GQE A;  2FS5 A;  3PB8 X;  4K0C A;  4CRZ B;  1YD9 A;  3ETI A;  2AFU A;  4M3S A;  2J8R A;  4MHD A;  2PJC A;  1ZG7 A;  4A95 A;  1UWY A;  2Z0Z A;  3SJX A;  3PGP A;  5CNP A;  2CIJ A;  4P4B A;  1VHU A;  4UF4 A;  4ETK A;  4GVV A;  1XMT A;  5IV0 A;  1YLE A;  2VBQ A;  2EBJ A;  4CGL A;  1GHE A;  5E3B A;  4KVO E;  3V8I A;  4CAX A;  4OC3 A;  4MRI A;  3G3S A;  3GB0 A;  5K8P A;  4AXV A;  5C82 A;  3FX6 A;  2PIY A;  4OIW A;  3A9L A;  5HVH A;  3WR7 A;  1Z4E A;  2FT0 A;  2KCW A;  3KR4 A;  1F57 A;  3I9S A;  4MHY A;  5HH1 A;  4KSI A;  4RN7 A;  2Q43 A;  1Y0Y A;  2ZW5 A;  3FYN A;  4KSF A;  4CYQ A;  5EBV A;  4A31 A;  1NJR A;  1ELL P;  4Q7A A;  1I12 A;  2JZD A;  4KSA A;  1H8L A;  1XMB A;  4MJ8 A;  4MCS A;  1F2P A;  2Q4Z A;  3SXO A;  4DUK A;  4QBJ A;  4MCQ A;  1MJB A;  5D29 A;  4AG9 A;  2XEF A;  4UEF A;  1QMU A;  1CM0 A;  2ZEE A;  3D8P A;  3DDD A;  3GLJ A;  3VAT A;  3FMC A;  1TXZ A;  4JCA A;  3IU1 A;  3PB4 X;  4ZY0 A;  5AG7 A;  3Q71 A;  3RAM A;  1YX0 A;  2CTC A;  3EJG A;  3WC6 A;  3R1K A;  3LOD A;  1QSR A;  4PK2 A;  1BPM A;  1PYT B;  1Q2Y A;  4UBR A;  2AFS A;  2FXF A;  5K8O A;  4FD4 A;  2YNC A;  2IL4 A;  3IIF A;  3FIX A;  4JXQ A;  2PIZ A;  2R8V A;  1TXR A;  3KHX A;  3EW5 A;  1CJW A;  4H6Z A;  3H8E A;  1M4I A;  2NYQ A;  4KUA A;  4XNH B;  5K8M A;  3JTK A;  5K8N A;  1HJZ A;  1R3N A;  4MXU A;  8CPA A;  3VFQ A;  1CP7 A;  3D2P A;  3TOB A;  1VKC A;  2ZEF A;  1PUA A;  3BJ7 A;  3D7D A;  4UEZ A;  3D66 A;  4KLV A;  1Q7L A;  4JWP A;  2BUE A;  2YNE A;  1RXT A;  3FBU A;  3IU2 A;  4M6G A;  4P45 A;  4MCR A;  3BI0 A;  1B87 A;  2WUU A;  4P10 A;  4FWU A;  2PJ9 A;  3SIH A;  2NMT A;  3TFY A;  3KAS A;  2IJZ A;  1F2O A;  1M44 A;  1Y0R A;  2QVP A;  2H5M A;  5THW A;  3W6S A;  2FAV A;  3R9G A;  3D3S A;  4MBU A;  4PSX A;  4OC4 A;  1IGB A;  1J4J A;  2DF5 A;  3GPG A;  2VRI A;  2XEJ A;  2BO9 A;  3KGQ A;  1S7F A;  3GUX A;  1ZG8 A;  2OZH A;  1YK3 A;  3W6X A;  4P6Y A;  4JYW A;  1S7N A;  5DWN A;  1IU8 A;  4P4D A;  3FXT A;  3TX8 A;  5D8N A;  2VQY A;  4F9V A;  5HVG A;  4MI4 A;  5KTC A;  4PXD A;  1Z2L A;  1VIX A;  2ACF A;  2PJB A;  2V77 A;  3CXP A;  3MGD A;  4NGQ A;  3N5F A;  2GAN A;  4KYB A;  1P4N A;  4UCP A;  3B3T A;  4NGR A;  3QAH A;  4RUH A;  4NF1 A;  3P2F A;  5CB5 A;  3KI9 A;  3L2N A;  2DPT A;  4MCP A;  2BL1 A;  5CBM A;  3PBB A;  4JJX A;  4A94 A;  1SQH A;  1QSN A;  3I3G A;  3IWW A;  4C2X A;  4DNC A;  5KTD A;  2AFO A;  3ISX A;  2Q51 A;  3TTH A;  1YME A;  2ZW4 A;  1ZR3 A;  3CZX A;  3GY9 A;  4OC5 A;  2ATR A;  5FSY A;  3LAC A;  2QIR A;  2EO8 A;  2FE7 A;  3B7I A;  2BOA A;  2ODF A;  4M6I A;  4GVW A;  3SIJ A;  3NA6 A;  1MJ9 A;  1YGH A;  4B5P A;  4UIB A;  2PVV A;  2B3U A;  4KOT A;  4PQA A;  2AFZ A;  4XPK A;  1R43 A;  4KOX A;  1YVO A;  5J1Q A;  2D4O A;  5EMI A;  2J8N A;  4B13 A;  2P6G A;  3D2M A;  3H8G A;  2HV2 A;  1S3Z A;  4H6U A;  1IYL A;  4II9 A;  5DUS A;  3WC7 A;  4NFR A;  2C27 A;  4UFX A;  1Y7R A;  3B35 A;  2K5T A;  2Z3K A;  3F5B A;  1XE4 A;  4P4F A;  4ONW A;  1Z8L A;  4UML A;  4KOS A;  3R96 A;  2AFC A;  4R76 A;  4ONU A;  2CF4 A;  5F49 A;  3VH9 A;  1Z8X A;  5A27 A;  5GCN A;  1P0H A;  5AG5 A;  4AVC A;  4R3L A;  3V2B A;  1LRZ A;  1YSJ A;  5I4M A;  1XEB A;  5DS0 A;  2I00 A;  4YRH A;  3Q6Z A;  4CGM A;  3RZA A;  2IMO A;  2Z3P A;  2Q7B A;  2ZW6 A;  4NGN A;  2HUZ A;  1CBX A;  2Z3O A;  1KWM A;  1XJO A;  2PJ0 A;  3R95 A;  2OR4 A;  5H84 A;  1BLL E;  3FF3 A;  4BBH A;  3DR6 A;  4LQ6 A;  3SJG A;  2PJ8 A;  3PP9 A;  2EUI A;  4B6Z A;  1XBU A;  1S7L A;  3CT9 A;  2RC4 A;  1LAM A;  3TE4 A;  1ARL A;  3B3C A;  5G20 A;  4PK3 A;  1S7K A;  4YU9 A;  1YW4 A;  4OLL A;  5J8C A;  2R98 A;  2Q44 A;  2ABZ A;  3K2K A;  1YQE A;  1VGY A;  2PJ2 A;  1Y7E A;  3OWC A;  4ABL A;  2Q7S A;  2AFW A;  3LWU A;  4NJQ A;  4KLW A;  1EE3 P;  4PXC A;  1X12 A;  5F47 A;  1IID A;  2YND A;  4UFV A;  3EKE A;  1GYT A;  4XNH C;  4MY0 A;  2CTB A;  2VEZ A;  1YVK A;  3GPQ A;  2FXK A;  4IUS A;  2OZG A;  3CXQ A;  1Y9W A;  2CXA A;  3H4Q A;  4JGK A;  1JWQ A;  3RO0 A;  4DYO A;  1Z4R A;  1Y9K A;  2NSM A;  2PC1 A;  3KL9 A;  2B4D B;  4AVA A;  3B3S A;  2QEC A;  2AFM A;  1SPV A;  2OZU A;  4OC2 A;  3JZT A;  2REF A;  3KQX A;  2GLF A;  1X10 A;  5A28 A;  4KOY A;  3IFE A;  4J5R A;  4F8Z A;  2B5G B;  4CGP A;  3PB6 X;  3F8K A;  4UWJ A;  1IOI A;  3R9F A;  4NGP A;  1KUX A;  2Y0M A;  1M4L A;  1MK4 A;  1S60 A;  4H89 A;  4HNY B;  5E96 A;  5JGF A;  2PQ8 A;  3C26 A;  5F09 A;  4ABK A;  3VWE A;  2GE3 A;  3SIG A;  1XFO A;  1YW6 A;  1AYE A;  4PSW A;  3IC1 A;  2L8R A;  1N71 A;  2VZZ A;  5AIL A;  4OKO A;  5LYL A;  3EXN A;  2PCU A;  2WYR A;  1FNO A;  3JUW A;  2JEW A;  4ZY2 A;  5FSV A;  4OP4 A;  2GLJ A;  3NH8 A;  4FAI A;  3H8F A;  3CPX A;  1ZR5 A;  4ESS A;  1V0C A;  1I1D A;  3GIU A;  1M4G A;  2O4H A;  4WWV A;  4UFW A;  3VAR A;  2A4N A;  2JDD A;  4Q36 A;  1NSA A;  3DNS A;  2X47 A;  3EJF A;  4P4E A;  3WAB A;  4R7M A;  2PSW A;  2OB0 A;  1TIQ A;  2C6C A;  3DGV A;  4AVB A;  4NGS A;  2YGW A;  1OZP A;  2DPS A;  4HNX B;  1Z5R A;  4YWY A;  1KZF A;  3I1U A;  1XIX A;  4R9M A;  3SJF A;  4MFL A;  1IY7 A;  3PRT A;  5G22 A;  3TO9 A;  4D86 A;  4R3K A;  4EFD A;  4RI1 A;  3PEI A;  4PXB A;  1Z8T A;  4JXR A;  2C6P A;  4ORF A;  4R8F A;  2V8V A;  4B12 A;  4C2Y A;  2ZEP A;  4CS0 B;  2WSA A;  4U9Z A;  4A37 A;  4MFJ A;  4GS4 A;  4HKF A;  4LUA A;  4Y49 B;  3T8W A;  1K4J A;  2WPX A;  3MRU A;  4NEX A;  3GPO A;  4X8I A;  3W91 A;  4DJL A;  2OOT A;  1RO5 A;  4EME A;  2Q4V A;  2PJ6 A;  2PRQ A;  3B2Y A;  3PB7 X;  1VHE A;  4NGM A;  1UFH A;  2D4P A;  3NH4 A;  4X3R A;  1CP6 A;  2BFR A;  3FB3 A;  4BIN A;  2FSR A;  1TKF A;  2C1C A;  3S9M A;  1LAN A;  3EFA A;  3NE7 A;  1ARM A;  4K30 A;  2ZEL A;  3S9L A;  3EWO A;  4BMH A;  4IK2 A;  3SI1 A;  1XOV A;  5LYF A;  2EK9 A;  2P6F A;  2PE3 A;  2HQY A;  3CDX A;  3PZJ A;  4L8A A;  4MFZ A;  2GFQ A;  2POK A;  3TCV A;  5DWM A;  3TO7 A;  1IYK A;  4MFK A;  4QB9 A;  2QYV A;  3IEH A;  2C6G A;  3V45 A;  4A32 A;  3HLP A;  1QST A;  4U9Y A;  1ZG9 A;  1YLO A;  3IWG A;  2ARH A;  4J3G A;  3WC5 A;  3ISZ A;  1U6M A;  2ZOF A;  3BLN A;  2G0B A;  4JVV A;  2PJ1 A;  3P2H A;  4U5Y A;  3S6H A;  2V8H A;  4C7H A;  3SII A;  2G3A A;  2P0W A;  3KR5 A;  1OBR A;  2BFQ A;  3SI2 A;  2IQ6 A;  4F9U A;  2REE A;  5FSU A;  1VHO A;  4NSQ A;  5LRJ A;  1WK4 A;  2ZEN A;  4PPZ A;  3RNZ A;  4A2Z A;  4B10 A;  4CAF A;  3IWE A;  3DSB A;  2B4B A;  5FSZ A;  5CB3 A;  3BJ8 A;  3E0K A;  3KHZ A;  1DTD A;  2VXK A;  4OC0 A;  5IX3 A;  3SI0 A;  3SJE A;  2ZW7 A;  3LD2 A;  4O23 A;  3FH4 A;  5ISV A;  4J4Z A;  3N7Z A;  1Z9U A;  2I3C A;  4Q38 A;  2WZN A;  5AG4 A;  2AJ6 A;  4MHZ A;  4R87 A;  4ZI6 A;  2EEE A;  3K9U A;  4F0X A;  2B3V A;  3PB9 X;  2ZEO A;  4EVY A;  1PU9 A;  2OU2 A;  2ZEM A;  4QVT A;  5C88 A;  1BO4 A;  4CRY B;  4EWT A;  5LYD A;  1BOB A;  2DXQ A;  2PRB A;  4IHM A;  4XPL A;  2BSW A;  1I21 A;  3F0A A;  4CPA A;  1M1D A;  4YFJ A;  1TF9 A;  3GQO A;  2F7V A;  4UEE A;  4A39 A;  2KQV A;  2Z3N A;  2JBJ A;  4NJR A;  4HPS A;  4OME A;  4FD7 A;  2LGR A;  1MJA A;  5H86 A;  4NXY A;  2JLM A;  4F6A A;  2B4D A;  4MHP A;  4TNU A;  3QNV A;  2F5I A;  4L89 A;  2PJA A;  5AGE A;  5AG6 A;  3EO4 A;  2ANP A;  1KUY A;  4C7I A;  1FT7 A;  2ZOG A;  4XPD C;  5BWA B;  2V8D A;  3V7Z A;  5F46 A;  3EWQ A;  2VZY A;  4FD6 A;  4P44 A;  4E0A A;  2B5G A;  1AMP A;  5HXD A;  1ZLH A;  4R57 A;  4CYN A;  1LCP A;  2O28 A;  2RB7 A;  5FVJ A;  2XD7 A;  4ZX8 A;  5G21 A;  1CPS A;  3VWD A;  2BCO A;  2PJ5 A;  3SXN A;  1LOK A;  4MHN A;  1QQ9 A;  2EK8 A;  4B14 A;  4FBE A;  4ZYQ A;  4JZ0 A;  2ZXV A;  4ZX9 A;  5IB9 A;  1B6B A;  3MN8 A;  2RFH A;  2Q0Y A;  5G1Z A;  1ZLI A;  4IF5 A;  5HVF A;  4CYO A;  4RS2 A;  4P4J A;  3R9E A;  1VHS A;  5EC4 A;  3GYA A;  2Q4Y A;  1LFW A;  4NGT A;  4OAE A;  4A38 A;  3PFO A;  2DX6 A;  2R7H A;  4KVX A;  4R6T A;  4UCN A;  2G9D A;  1TF8 A;  1TY8 A;  4TU0 A;  4JLL A;  3FEE A;  2VI7 A;  2XEG A;  4XPD B;  5LYI A;  4PXE A;  3T9Y A;  5JQ4 A;  4OID A;  5LRK A;  4KS9 A;  1RTQ A;  4UA3 A;  3IGR A;  2B58 A;  1IB1 E;  4Y49 C;  5HOL A;  1KUV A;  3DLJ A;  2CNS A;  1LAP A;  5IB0 A;  4I49 A; 
#chains in the Genus database with same CATH homology
 2V8G A;  3D68 A;  3D4U A;  4K3N A;  2PJ7 A;  3PBE A;  3FEC A;  2F8H A;  5LRG A;  4MMO A;  3D67 A;  1JQG A;  3EWR A;  2QJ8 A;  5FSX A;  2PJ3 A;  1CG2 A;  2O53 A;  2ZEG A;  2J9A A;  3HUV A;  5CPA A;  3LMS A;  3KZW A;  4ETJ A;  3CPA A;  2FG1 A;  3WT4 A;  4P4I A;  4ZY1 A;  4IQY A;  2HB6 A;  4TWE A;  5CMS A;  5HIH A;  4G1P A;  4UIA A;  1HDU A;  4J5S A;  1ELM P;  3IID A;  4IAV A;  3BHX A;  4X2T A;  1BAV A;  4GM5 A;  2EWB A;  3B3V A;  3EWP A;  2JBK A;  3IJ3 A;  2GU2 A;  2ZED A;  1BPN A;  3JRU A;  1HDQ A;  2FVG A;  3D7H A;  1HEE A;  3KQZ A;  3S9N A;  1CPX A;  2AFX A;  1CX8 A;  4H2K A;  3D7F A;  4BD9 A;  4GUA A;  2GRE A;  1XRY A;  1TKJ A;  4FUU A;  3FED A;  6CPA A;  2PJ4 A;  2XEI A;  1PCA A;  2ZEH A;  4W9Y A;  3NH5 A;  3D7G A;  7CPA A;  3B3W A;  3NFZ A;  3IIB A;  4LQG A;  2DEA A;  3RBU A;  3TC8 A;  3V38 A;  3FJU A;  1TKH A;  4OC1 A;  4J5Q A;  2PVW A;  3PFE A;  3K9T A;  4Z65 A;  3FVL A;  2VL1 A;  5ELY A;  4WJB A;  1DE4 C;  3IO1 A;  5JH9 A;  2HC9 A;  3BXM A;  3BI1 A;  5JM6 A;  3GQE A;  3PB8 X;  4K0C A;  1YD9 A;  2AFU A;  3ETI A;  2PJC A;  1ZG7 A;  1UWY A;  3SJX A;  2CIJ A;  4P4B A;  1VHU A;  4UF4 A;  4ETK A;  4GVV A;  5E3B A;  4OC3 A;  4MRI A;  3GB0 A;  5K8P A;  4AXV A;  3FX6 A;  2PIY A;  4OIW A;  5HVH A;  3KR4 A;  1F57 A;  4MHY A;  4KSI A;  2Q43 A;  1Y0Y A;  1NJR A;  1ELL P;  4Q7A A;  1H8L A;  1XMB A;  4MCS A;  4DUK A;  1F2P A;  2Q4Z A;  4MCQ A;  5D29 A;  2XEF A;  4UEF A;  1QMU A;  2ZEE A;  3GLJ A;  3VAT A;  3FMC A;  1TXZ A;  4JCA A;  3PB4 X;  4ZY0 A;  3Q71 A;  3RAM A;  2CTC A;  3EJG A;  3WC6 A;  1BPM A;  1PYT B;  2AFS A;  5K8O A;  3IIF A;  2PIZ A;  1TXR A;  3KHX A;  3EW5 A;  3H8E A;  2NYQ A;  5K8M A;  5K8N A;  1HJZ A;  1R3N A;  4MXU A;  8CPA A;  3VFQ A;  1CP7 A;  2ZEF A;  3D7D A;  4UEZ A;  3D66 A;  1Q7L A;  4P45 A;  4MCR A;  3BI0 A;  4P10 A;  4FWU A;  2PJ9 A;  3SIH A;  3KAS A;  2IJZ A;  1F2O A;  1Y0R A;  2QVP A;  5THW A;  2FAV A;  4OC4 A;  1IGB A;  3GPG A;  2VRI A;  2XEJ A;  2BO9 A;  3KGQ A;  3GUX A;  1ZG8 A;  4P6Y A;  4JYW A;  3TX8 A;  4P4D A;  4F9V A;  5D8N A;  5HVG A;  4PXD A;  1Z2L A;  1VIX A;  2ACF A;  2PJB A;  2V77 A;  4NGQ A;  3N5F A;  4KYB A;  3B3T A;  4NGR A;  4RUH A;  5CB5 A;  3KI9 A;  3L2N A;  4MCP A;  5CBM A;  3PBB A;  4A94 A;  3IWW A;  2AFO A;  3ISX A;  2Q51 A;  1YME A;  1ZR3 A;  4OC5 A;  5FSY A;  3B7I A;  2BOA A;  4GVW A;  3SIJ A;  3NA6 A;  4UIB A;  2PVV A;  4PQA A;  2AFZ A;  1R43 A;  5J1Q A;  3H8G A;  5DUS A;  3WC7 A;  4NFR A;  3B35 A;  4P4F A;  4ONW A;  1Z8L A;  4UML A;  3VH9 A;  2AFC A;  4R76 A;  2CF4 A;  3V2B A;  1YSJ A;  5I4M A;  5DS0 A;  3Q6Z A;  3RZA A;  2IMO A;  4NGN A;  1CBX A;  1KWM A;  1XJO A;  2PJ0 A;  2OR4 A;  1BLL E;  3FF3 A;  3SJG A;  2PJ8 A;  4B6Z A;  1XBU A;  3CT9 A;  1LAM A;  1ARL A;  3B3C A;  4YU9 A;  1YW4 A;  2ABZ A;  3K2K A;  1VGY A;  2PJ2 A;  1Y7E A;  4ABL A;  2AFW A;  3LWU A;  4NJQ A;  1EE3 P;  4PXC A;  3EKE A;  1GYT A;  2CTB A;  3GPQ A;  2FXK A;  4JGK A;  4DYO A;  2NSM A;  3KL9 A;  3B3S A;  2AFM A;  1SPV A;  4OC2 A;  3JZT A;  3KQX A;  2GLF A;  3IFE A;  4J5R A;  4F8Z A;  3PB6 X;  4NGP A;  1M4L A;  5JGF A;  5F09 A;  4ABK A;  3SIG A;  1XFO A;  1YW6 A;  1AYE A;  3IC1 A;  2L8R A;  5LYL A;  5AIL A;  4OKO A;  2PCU A;  2WYR A;  1FNO A;  2JEW A;  4ZY2 A;  5FSV A;  4OP4 A;  2GLJ A;  3NH8 A;  4FAI A;  3H8F A;  3CPX A;  1ZR5 A;  4ESS A;  3VAR A;  2O4H A;  4WWV A;  1NSA A;  2X47 A;  3EJF A;  4P4E A;  3WAB A;  4R7M A;  3DGV A;  2C6C A;  4NGS A;  1Z5R A;  4YWY A;  3I1U A;  3SJF A;  1IY7 A;  3PRT A;  4D86 A;  4EFD A;  3PEI A;  4PXB A;  2C6P A;  4R8F A;  2V8V A;  2ZEP A;  4A37 A;  3T8W A;  3MRU A;  4DJL A;  3GPO A;  4X8I A;  2OOT A;  4EME A;  2PJ6 A;  2PRQ A;  3B2Y A;  3PB7 X;  1VHE A;  4NGM A;  4X3R A;  3NH4 A;  1CP6 A;  2BFR A;  1TKF A;  2C1C A;  3S9M A;  1LAN A;  1ARM A;  2ZEL A;  3S9L A;  3EWO A;  4IK2 A;  3SI1 A;  5LYF A;  2EK9 A;  2PE3 A;  3CDX A;  2POK A;  2QYV A;  3IEH A;  2C6G A;  3V45 A;  3HLP A;  1ZG9 A;  1YLO A;  3WC5 A;  3ISZ A;  2ZOF A;  4JVV A;  2PJ1 A;  2V8H A;  3SII A;  3KR5 A;  1OBR A;  2BFQ A;  3SI2 A;  2IQ6 A;  4F9U A;  5FSU A;  1VHO A;  5LRJ A;  2ZEN A;  4PPZ A;  5FSZ A;  5CB3 A;  3KHZ A;  1DTD A;  4OC0 A;  3SI0 A;  3SJE A;  4O23 A;  3FH4 A;  4J4Z A;  2I3C A;  2WZN A;  4MHZ A;  4ZI6 A;  2EEE A;  3PB9 X;  2ZEO A;  2ZEM A;  4EWT A;  5LYD A;  4IHM A;  4CPA A;  1TF9 A;  3GQO A;  2F7V A;  4UEE A;  4A39 A;  2JBJ A;  4NJR A;  4OME A;  2LGR A;  4MHP A;  4TNU A;  3QNV A;  2PJA A;  2ANP A;  1FT7 A;  2ZOG A;  2V8D A;  3V7Z A;  3EWQ A;  4P44 A;  1AMP A;  5HXD A;  1ZLH A;  1LCP A;  2RB7 A;  2XD7 A;  4ZX8 A;  1CPS A;  2BCO A;  2PJ5 A;  1LOK A;  4MHN A;  1QQ9 A;  2EK8 A;  4FBE A;  4ZYQ A;  4JZ0 A;  4ZX9 A;  5IB9 A;  3MN8 A;  2RFH A;  1ZLI A;  5HVF A;  4P4J A;  4NGT A;  1LFW A;  4A38 A;  3PFO A;  2DX6 A;  4R6T A;  2G9D A;  1TF8 A;  1TY8 A;  4TU0 A;  4JLL A;  3FEE A;  2XEG A;  5LYI A;  4PXE A;  4OID A;  5LRK A;  1RTQ A;  5HOL A;  3DLJ A;  1LAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...