4ZX9A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10b
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Probable M17 family aminopeptidase
total genus 176
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zx9A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zx9A02
1M4LA 4EFDA 4WJBA 4EMEA 2AFCA 1HDQA 1XBUA 3PFOA 4J5RA 2PVVA 4ZY2A 2PJ5A 4GM5A 4A38A 3WC5A 5THWA 2I3CA 1CG2A 3V45A 4UIBA 3GPOA 5K8PA 8CPAA 3Q71A 4X3RA 3KL9A 2RFHA 2WZNA 2PJ1A 2NYQA 3T8WA 4FWUA 2Q43A 1YLOA 2PJ3A 4EWTA 1FNOA 3KHZA 3SI0A 1ZR3A 3LMSA 1BAVA 4UEFA 1VHUA 1AYEA 5CMSA 2ZOFA 3D7DA 2PVWA 4MXUA 3I1UA 1ELMP 2PJ8A 5K8OA 3SI1A 4NJQA 2DX6A 4NGRA 4JVVA 3JZTA 1HJZA 1Y0RA 3NFZA 3SJGA 4K0CA 3MN8A 4MCSA 4PPZA 4FUUA 4PXDA 5I4MA 3CT9A 5D8NA 3S9MA 4MRIA 2JBKA 2PJCA 2ZEOA 3PBBA 3EWOA 1CP6A 3IO1A 4OC0A 2HC9A 3D7GA 2ZEDA 5JH9A 5JM6A 1TKJA 3BHXA 4A94A 3MRUA 2NSMA 4RUHA 4UMLA 1LAPA 4MHPA 1Q7LA 2L8RA 5HVGA 4MCQA 2QJ8A 3ISXA 1BPNA 4ZYQA 1SPVA 1CPXA 5J1QA 3KR5A 3B3VA 3GPGA 1OBRA 3NH5A 2CTBA 2OOTA 2O53A 1PCAA 5CPAA 4IK2A 3EJGA 2AFWA 2O4HA 4D86A 3B3TA 2ZEFA 3FEDA 2GREA 2EK8A 1AMPA 2GLFA 2XEIA 4B6ZA 1NSAA 3FF3A 1VIXA 2V8DA 5FSUA 4TU0A 2FAVA 1Y7EA 1BPMA 1YSJA 1YMEA 4P44A 3SJXA 4PXCA 5AILA 4X8IA 5LRKA 1IY7A 3B7IA 3SIGA 3KHXA 3VATA 4IAVA 2GLJA 1DE4C 4MCRA 4J5QA 2ZOGA 3PB4X 3FVLA 3TX8A 2ZELA 4WWVA 3IIDA 2BFRA 4P4EA 3Q6ZA 4YWYA 3IC1A 3GQEA 2ANPA 4R8FA 3KZWA 3BI0A 4H2KA 3PB7X 2AFZA 2AFSA 1DTDA 2C6CA 1QQ9A 1VHEA 3NH8A 4CPAA 3GPQA 2EEEA 2PIZA 4R6TA 5FSXA 4PQAA 2PJ0A 3IIFA 2OR4A 3L2NA 3PB8X 3RBUA 1TKFA 1KWMA 2CIJA 4ONWA 3SIJA 2PJ9A 5HVFA 4ETJA 2ZEHA 3PEIA 3FECA 2QVPA 3VH9A 3WT4A 4UEZA 3EJFA 3CDXA 4OMEA 1F57A 5HIHA 4A37A 3SIIA 4DJLA 1EE3P 4PXEA 1HDUA 2CF4A 5LYIA 4P4BA 2LGRA 3VARA 4UEEA 4ZI6A 2PJ7A 3IWWA 1NJRA 1Z2LA 5DS0A 3WC6A 4NGPA 2V8HA 3IEHA 4ETKA 3D67A 4OIDA 1XMBA 4GVVA 4P6YA 5JGFA 5F09A 3SI2A 4IHMA 3SIHA 1Z5RA 3B3CA 3K2KA 4OC4A 4P10A 4OP4A 4TWEA 2CTCA 5DUSA 1YW6A 3EW5A 3IJ3A 2V8VA 2POKA 4P4DA 1XJOA 3V2BA 2ABZA 5LRJA 3S9NA 2XD7A 3D66A 3PFEA 4OIWA 5LRGA 4P45A 3BXMA 4A39A 3FX6A 1LAMA 4P4FA 3NA6A 3RAMA 4GUAA 3S9LA 4R7MA 2PJBA 4LQGA 3FMCA 4ABKA 4JZ0A 4J5SA 2F8HA 3ETIA 3ISZA 1LOKA 4X2TA 5FSYA 3B2YA 2QYVA 4KYBA 1F2OA 4FAIA 2PJ4A 3H8FA 4OKOA 4DUKA 2ZEEA 2PJ2A 4ESSA 1LCPA 3EKEA 1TY8A 2C1CA 2BCOA 2HB6A 1TF8A 2BFQA 2G9DA 2WYRA 3DLJA 4NGSA 3GQOA 2EWBA 1R43A 3FEEA 4ZX9A 3EWPA 3V38A 1ZG8A 3VFQA 3PRTA 4JCAA 3LWUA 3SJEA 3NH4A 2ZEPA 3GB0A 3KASA 1XRYA 3WABA 3V7ZA 5FSVA 5HOLA 4ZY0A 2V8GA 1VGYA 1VHOA 1TKHA 3IIBA 1Y0YA 4W9YA 3HUVA 3TC8A 2VL1A 1YD9A 2PJ6A 2XEGA 4OC3A 2Q4ZA 3PB6X 3D68A 5HVHA 3DGVA 1HEEA 1JQGA 2ACFA 2FXKA 1CPSA 3WC7A 4F9UA 2ZENA 1Z8LA 4OC5A 3EWRA 1F2PA 1XFOA 4BD9A 1CBXA 4J4ZA 5LYDA 6CPAA 2X47A 2EK9A 3EWQA 2XEFA 1LANA 3D4UA 5CB5A 3B3SA 3B35A 1ZLHA 4Z65A 4OC2A 1ZLIA 2ZEMA 3B3WA 5IB9A 4AXVA 1ARMA 2AFMA 3PB9X 4NFRA 5ELYA 2Q51A 5K8NA 2J9AA 1TXZA 4F8ZA 3HLPA 4NGQA 4NGMA 3KQZA 4NGNA 1RTQA 3FH4A 4UF4A 4FBEA 4YU9A 3JRUA 7CPAA 4NGTA 5E3BA 1TXRA 2AFXA 1ELLP 4Q7AA 3FJUA 4ZY1A 5CB3A 4JGKA 4NJRA 2IJZA 4MMOA 1LFWA 2RB7A 3N5FA 5D29A 4IQYA 2BOAA 1TF9A 4G1PA 1ARLA 2XEJA 3KQXA 4P4JA 2ZEGA 3IFEA 3GLJA 2IQ6A 3CPXA 3H8EA 2C6PA 4PXBA 4JLLA 1CP7A 2JBJA 3RZAA 2AFOA 1GYTA 4MCPA 1UWYA 2FVGA 1ZR5A 4F9VA 4O23A 5CBMA 1R3NA 1YW4A 2PIYA 4OC1A 2GU2A 3KR4A 4MHNA 2C6GA 4JYWA 1CX8A 2PRQA 1BLLE 4ZX8A 2PJAA 1H8LA 3KI9A 3KGQA 1ZG9A 5LYFA 4MHYA 1QMUA 3H8GA 2BO9A 4UIAA 5FSZA 5LYLA 4TNUA 2V77A 4DYOA 2F7VA 2VRIA 2DEAA 3BI1A 4KSIA 3GUXA 1IGBA 3SJFA 1PYTB 3QNVA 5HXDA 3CPAA 2IMOA 2FG1A 1ZG7A 5K8MA 4MHZA 4P4IA 2PE3A 1FT7A 2AFUA 4GVWA 4K3NA 3PBEA 2JEWA 4ABLA 3D7HA 3D7FA 4R76A 3K9TA 2PCUA
chains in the Genus database with same CATH superfamily
1M4LA 4EFDA 2AJ6A 4WJBA 3T90A 4EMEA 1X12A 2AFCA 1HDQA 1XBUA 3PFOA 3A9LA 4J5RA 4C2XA 3FIXA 4CYNA 2PVVA 4MFZA 4ZY2A 1YX0A 2PJ5A 3D3SA 4GM5A 5DWNA 4U9ZA 5THWA 2YNCA 3WC5A 1K4JA 3R1KA 2I3CA 1CG2A 3V45A 1BO4A 3GPOA 1Q2CA 4NCZA 4UIBA 5K8PA 8CPAA 3Q71A 4X3RA 3KL9A 2RFHA 2WZNA 3DR6A 2PJ1A 2NYQA 3T8WA 4FWUA 2Q43A 1YLOA 4KVOE 1NSLA 2PJ3A 4EWTA 1FNOA 3KHZA 3SI0A 1ZR3A 3LMSA 2DF5A 1BAVA 3NE8A 4UEFA 1VHUA 1AYEA 5CMSA 2QIRA 2ZOFA 1B87A 4CGLA 3D7DA 4AG7A 2PVWA 4C2YA 4CAFA 4II9A 4MXUA 3I1UA 3BLNA 4MY0A 1NMTA 1M4IA 1ELMP 2PJ8A 4MFJA 5K8OA 2ZW6A 1MJ9A 4UFWA 3SI1A 4NJQA 3W91A 2DX6A 4H6UA 4NGRA 4JVVA 3JZTA 2CNTA 2B4BA 1IYLA 1HJZA 1Y0RA 3NFZA 3SJGA 4CYOA 2G3AA 4K0CA 2Z3MA 3MN8A 4MCSA 2YNDA 4PPZA 2JLMA 4FUUA 2GANA 4PXDA 3CT9A 2JZEA 5D8NA 3EO4A 4R9MA 5I4MA 3S9MA 3W6XA 4MRIA 2JBKA 4PK3A 3TOBA 4IF5A 2PJCA 4YFJA 5A28A 2ZEOA 3PBBA 2WSAA 4UWJA 3EWOA 1CP6A 1YR0A 3FNCA 2RNKA 3IO1A 1Z8WA 2B4DA 2BL1A 4OC0A 2BEIA 4CGOA 2R8VA 2BUEA 2CXAA 2HC9A 3D7GA 3FBUA 1I21A 2ZEDA 3G8WA 4CGPA 5AG4A 2VZYA 4FD7A 5JH9A 1TKJA 3BHXA 5JM6A 1M1DA 4A94A 3MRUA 2G0BA 2NSMA 4RUHA 4UMLA 3D8PA 3SXNA 1WWZA 1LAPA 1MJBA 2Z3PA 4MHPA 3FXTA 1Q7LA 1Y9WA 2L8RA 5HVGA 3FRMA 4MCQA 2QJ8A 5GCNA 4H89A 1J4JA 1BPNA 3ISXA 4ZYQA 4C2ZA 1SPVA 4E0AA 5J1QA 3KR5A 4U9YA 4XNHC 3B3VA 3GPGA 1OBRA 3NH5A 1QSMA 2CTBA 2VXKA 2OOTA 2O53A 3JUWA 4MBUA 1PCAA 4UCPA 5CPAA 3S6KA 1NE9A 4IK2A 3EJGA 2AFWA 4KUAA 2O4HA 4D86A 4F0YA 3B3TA 2ZEFA 3FEDA 2FE7A 2GFQA 2GREA 4JLYA 2EK8A 1AMPA 2GLFA 2XEIA 4B6ZA 4CAXA 4YGOA 1NSAA 1FY7A 1VIXA 3FF3A 3IU1A 4FD4A 2V8DA 4ZGYB 2JDCA 5FSUA 1L0CA 2H5MA 4TU0A 1YQEA 2REEA 1XOVA 2FAVA 1P0HA 1Y7EA 4UWIA 1BPMA 1QSNA 1YSJA 1YMEA 3C26A 4LQ6A 4GS4A 4HNWB 4P44A 3SJXA 3IWGA 3TCVA 5G21A 4PXCA 4JXQA 5AILA 2CY2A 3P2FA 4X8IA 5LRKA 4QUSA 1IY7A 4DNCA 3B7IA 3SIGA 3KHXA 1YVKA 4IAVA 2J8MA 3VATA 4RN7A 2GLJA 4HNYB 1M4DA 1DE4C 4MCRA 4J5QA 2ZOGA 3PB4X 4XPKA 2ZW4A 3FVLA 4JXRA 5F46A 2PR8A 3TX8A 2CNSA 2CNMA 2ZELA 1XMTA 4MY3A 1Z8TA 1S7FA 2B58A 3G3SA 4R57A 3SXOA 4WWVA 3IIDA 2BFRA 3GIUA 1OZPA 1GHEA 4P4EA 3Q6ZA 4A32A 4PV6A 3IC1A 4YWYA 3DDDA 4MFPA 1YVOA 4BMHA 4A95A 2Z3NA 5H86A 3GQEA 2ANPA 1Y9KA 3IU2A 4R8FA 3KZWA 4KSAA 3BI0A 3MGDA 4H2KA 3PB7X 2B4DB 2AFZA 2AFSA 1DTDA 2C6CA 2GE3A 1QQ9A 2HQYA 4KOVA 3H4QA 1VHEA 3NH8A 4CPAA 3GPQA 3BJ8A 1X10A 2EEEA 2QMLA 4B11A 2PIZA 5BWAB 4KORA 3I9SA 4R6TA 5FSXA 4PQAA 2PJ0A 3IIFA 2OR4A 2EBJA 2Q44A 3L2NA 3PB8X 3RBUA 5HMNA 1TKFA 1KWMA 2CIJA 2REFA 2VI7A 4ONWA 3SIJA 2B3VA 2JDDA 2PJ9A 2P6FA 5HVFA 4ETJA 2ZEHA 3I3GA 1IU8A 3PEIA 3FECA 2QVPA 3VH9A 2HV2A 3E0KA 3WT4A 1QSOA 4E8OA 2Z10A 3S6GA 2EVNA 2KCWA 4UEZA 1JWQA 2JZFA 3EJFA 1XEBA 3CDXA 4OMEA 3EXNA 2Q4YA 6CPAA 1F57A 1Z9UA 1M4GA 5FVJA 5HIHA 4A37A 3SIIA 2PC1A 4KZTA 1Q2DA 4QB9A 1S7LA 3T9YA 4DJLA 4B5PA 1S7KA 2Q7SA 4PSWA 1EE3P 4PXEA 1RXTA 1HDUA 2X7BA 2CF4A 1Z4RA 5LYIA 4P4BA 2JEVA 2W2GA 2LGRA 3KKWA 3VARA 4UEEA 4ZI6A 4RI1A 2D4PA 2PJ7A 2B3UA 3IWWA 4E2AA 5EC4A 1NJRA 4B12A 1Z2LA 5AG5A 2J8NA 5DS0A 3WC6A 2R1IA 4NGPA 4BINA 2YNEA 2V8HA 3IEHA 4ETKA 1M44A 2OZUA 3D67A 4OIDA 1S60A 3LODA 1U6MA 1UFHA 1XMBA 4GVVA 1B6BA 1QSRA 2G3TA 2ZW7A 4P6YA 1XF8A 4C68A 5JGFA 5F09A 3SI2A 4IHMA 3SHPA 3SIHA 1Z5RA 3B3CA 2QECA 4U5YA 3K2KA 1Z4EA 4OADA 1IIDA 3W6SA 1I12A 2FL4A 4OC4A 4P10A 3RYOA 2P6EA 4OP4A 4CAVA 4MFKA 4TWEA 1KUYA 2CTCA 2C27A 1S5KA 4AVCA 5DUSA 1YW6A 4CS0B 2Q4VA 3EW5A 3IJ3A 5G20A 2V8VA 2POKA 1I1DA 3EY5A 4XNHB 1P4NA 2Z0ZA 4J3GA 4P4DA 1XJOA 3V2BA 2ABZA 2WPXA 3PP9A 5LRJA 2DPSA 3S9NA 2XD7A 3D66A 1Z8XA 3IWEA 3PFEA 4OIWA 1YREA 5LRGA 4F0XA 4P45A 3RO0A 5G22A 2P0WA 3BXMA 4A38A 4A39A 3FX6A 1LAMA 1LRZA 3N7ZA 4P4FA 3NA6A 1S7NA 3QAYA 1QSTA 4KOTA 3RAMA 1AUGA 4GUAA 3S9LA 2R7HA 4M6IA 1CM0A 2VQYA 4R7MA 2FS5A 2PJBA 3DR8A 3FB3A 3FMCA 2R98A 4HKFA 4LQGA 4BBHA 4MFLA 1MJAA 4ABKA 4HPSA 4JZ0A 4NXYA 4J5SA 5JQ4A 2F8HA 3ETIA 3ISZA 1LOKA 4F6AA 4X2TA 5FSYA 3B2YA 2QYVA 4KS9A 4B13A 4KYBA 3VWEA 1F2OA 4CGNA 4FAIA 2PJ4A 3H8FA 4OKOA 4DUKA 1IICA 2ZEEA 4OLLA 2WPWA 2PJ2A 4ESSA 4B5OA 4MHDA 2GIVA 4FD5A 3QAHA 1LCPA 3EKEA 2FIWA 4CRZB 1R57A 1TY8A 3D2MA 4ORFA 2C1CA 2BCOA 3BJ7A 2HB6A 1TF8A 5F47A 2BFQA 2G9DA 2WYRA 3DLJA 4NGSA 3GQOA 2EWBA 4UCNA 1PU9A 2OH1A 2PSWA 1R43A 3FEEA 4ZX9A 3EWPA 2OZHA 4RS2A 3V38A 1ZG8A 3VFQA 2ZPAA 3PRTA 4JCAA 3LWUA 3SJEA 2YGWA 3NH4A 3VWDA 2ZEPA 3GB0A 3KASA 4QVTA 5IV0A 2ZXVA 1XRYA 2DXQA 2OU2A 1KUXA 3WABA 3V7ZA 5FSVA 5HOLA 4AG9A 4ZY0A 2I00A 1VGYA 2D4OA 2V8GA 3CXSA 4M6HA 3R9GA 5EBVA 3TO6A 1VHOA 2Z3LA 1TKHA 2Z3KA 4B5PB 3PGPA 2PCUA 3IIBA 1Y0YA 4W9YA 1A2ZA 3HUVA 3TC8A 2VL1A 1YD9A 2PJ6A 2FSRA 2XEGA 2JZDA 4OC3A 5IX3A 2Q0YA 2Q4ZA 3F8KA 1YLEA 3PB6X 5JPHA 3D68A 5HVHA 2WUUA 1XIXA 3LD2A 3DGVA 4CYPA 5DWMA 1HEEA 1JQGA 2ACFA 2FXKA 1CPSA 3UY5A 3TE4A 4R3LA 3WC7A 3DNSA 2Q04A 4F9UA 4KLVA 2ZENA 1IOIA 1Z8LA 4ONUA 4XPLA 4Q36A 4OC5A 3EWRA 1F2PA 3RNZA 4M3SA 1XFOA 3R9FA 4BD9A 3GKRA 4JD6A 1V0CA 1CBXA 2FCKA 4HNXB 4H6ZA 4J4ZA 2Q7BA 4KOYA 5LYDA 2KQVA 4KVME 2EUIA 2X47A 2EK9A 3EWQA 2NMTA 2PDOA 2XEFA 4R87A 1VHSA 4X5KA 5F49A 1SQHA 5J8CA 3GY9A 5IB0A 2A4NA 1LANA 4KOSA 3D4UA 5CB5A 3B3SA 3B35A 3F5BA 5C82A 1ZLHA 4Z65A 1TIQA 4MI4A 1Q2YA 4OC2A 2Z3OA 1ZLIA 2ZEMA 3B3WA 5IB9A 4AXVA 4C7IA 1ARMA 2AFMA 3PB9X 3NE7A 2B5GB 4K30A 3F0AA 4NFRA 5ELYA 1WK4A 3TO7A 2Q51A 1ZO0A 4AB7A 5CNPA 5K8NA 1YK3A 2J8RA 2J9AA 1TXZA 4KOXA 2FXFA 4OAEA 4F8ZA 4UCMA 4CGMA 3TTHA 5A27A 3HLPA 4NGQA 1MK4A 4NGMA 3KQZA 4NGNA 3JVNA 2FIAA 1RTQA 2Y0MA 4Q38A 4L89A 3FH4A 2WCTA 2EO8A 1BOBA 2BSWA 4GXHA 5C88A 2HUZA 3CXQA 1KZFA 4UF4A 2I79A 4MFQA 4YU9A 4UFVA 4FBEA 3TO9A 3JRUA 7CPAA 4NGTA 4NEXA 3LACA 5E3BA 1RO5A 4A33A 1TXRA 2AFXA 1ELLP 1CJWA 4KVXA 3FJUA 4Q7AA 4Y49B 4ZY1A 5CB3A 3R9EA 2Z11A 3DSBA 3CXPA 4JGKA 3QB8A 4NJRA 2IJZA 4MMOA 3S6FA 2PRBA 1LFWA 2RB7A 2VZZA 3D2PA 3N5FA 5D29A 4IQYA 2BOAA 5E96A 1TF9A 2O28A 4NSQA 4C7HA 4XPDB 3B8GA 4G1PA 1ARLA 2XEJA 3EFAA 4QC6A 3KQXA 4B10A 4P4JA 2ZEGA 3IFEA 4KOUA 3GLJA 2K5TA 2IQ6A 3CPXA 5H84A 3H8EA 2C6PA 3EC4A 3K9UA 4PXBA 4PK2A 4JLLA 1CP7A 2JBJA 4FD6A 3RZAA 3S6HA 5ISVA 2AFOA 1GYTA 2ATRA 1UWYA 2OZGA 4MCPA 5AGEA 4JWPA 4KUBA 4B14A 4AVBA 4AVAA 1XE4A 5I0CA 2FVGA 4PSXA 4CAWA 4UBRA 1ZR5A 3P2HA 4F9VA 4O23A 5CBMA 5HH1A 3JTKA 1R3NA 1ON0A 1YW4A 2PIYA 4QBJA 3GYAA 3PZJA 3TOAA 4OC1A 3R96A 4CRYB 2DPTA 3KR4A 2GU2A 4MHNA 2C6GA 4M85A 1Y7RA 4JYWA 4R3KA 5J8FA 5KTDA 5F48A 1CX8A 2VBQA 2PRQA 4L8AA 3FYNA 1BLLE 4ZX8A 2PJAA 3IGRA 1H8LA 4LX9A 3KI9A 2ODFA 3KGQA 4KSFA 1VKCA 1YGHA 1ZG9A 4LUAA 2P6GA 4MHYA 4MJ8A 4I49A 5LYFA 1QMUA 3H8GA 2BO9A 4UIAA 2AE6A 5AG7A 5G1ZA 1IOFA 5FSZA 1IB1E 2ARHA 5LYLA 4CAEA 4TNUA 2V77A 4DYOA 4YRHA 2PR1A 2F7VA 2VRIA 2DEAA 5AG6A 3BI1A 3V8IA 3ZZIA 4KSIA 3GUXA 4Y49C 3R95A 1IGBA 3TFYA 4A2ZA 3SJFA 1PYTB 2FT0A 2F5IA 3H5ZA 3QNVA 5HXDA 3CPAA 2IL4A 4UA3A 2IMOA 2FG1A 1PUAA 1ZG7A 2RC4A 5K8MA 4UFXA 3ZJ0A 4MHZA 5KTAA 4A30A 1KUVA 3TT2A 3OWCA 4JJXA 4P4IA 3CZXA 1IYKA 2PE3A 4M6GA 3WR7A 1FT7A 4KOWA 2AFUA 2ZW5A 4GVWA 4IUSA 4A31A 4NF1A 4K3NA 4KLWA 4EVYA 4ZBGA 4CYQA 1S3ZA 2YNCC 2JEWA 3PBEA 4ABLA 5KTCA 3D7HA 2VEZA 5EMIA 2OB0A 3D7FA 1N71A 4R76A 3K9TA 2PQ8A 2B5GA 4XPDC 1CPXA
chains in the Genus database with same CATH topology
1M4LA 4EFDA 4WJBA 4EMEA 2AFCA 1HDQA 1XBUA 3PFOA 4J5RA 2PVVA 4ZY2A 2PJ5A 4GM5A 4A38A 3WC5A 5THWA 2I3CA 1CG2A 3V45A 4UIBA 3GPOA 5K8PA 8CPAA 3Q71A 4X3RA 3KL9A 2RFHA 2WZNA 2PJ1A 2NYQA 3T8WA 4FWUA 2Q43A 1YLOA 2PJ3A 4EWTA 1FNOA 3KHZA 3SI0A 1ZR3A 3LMSA 1BAVA 4UEFA 1VHUA 1AYEA 5CMSA 2ZOFA 3D7DA 2PVWA 4MXUA 3I1UA 1ELMP 2PJ8A 5K8OA 3SI1A 4NJQA 2DX6A 4NGRA 4JVVA 3JZTA 1HJZA 1Y0RA 3NFZA 3SJGA 4K0CA 3MN8A 4MCSA 4PPZA 4FUUA 4PXDA 5I4MA 3CT9A 5D8NA 3S9MA 4MRIA 2JBKA 2PJCA 2ZEOA 3PBBA 3EWOA 1CP6A 3IO1A 4OC0A 2HC9A 3D7GA 2ZEDA 5JH9A 5JM6A 1TKJA 3BHXA 4A94A 3MRUA 2NSMA 4RUHA 4UMLA 1LAPA 4MHPA 1Q7LA 2L8RA 5HVGA 4MCQA 2QJ8A 3ISXA 1BPNA 4ZYQA 1SPVA 1CPXA 5J1QA 3KR5A 3B3VA 3GPGA 1OBRA 3NH5A 2CTBA 2OOTA 2O53A 1PCAA 5CPAA 4IK2A 3EJGA 2AFWA 2O4HA 4D86A 3B3TA 2ZEFA 3FEDA 2GREA 2EK8A 1AMPA 2GLFA 2XEIA 4B6ZA 1NSAA 3FF3A 1VIXA 2V8DA 5FSUA 4TU0A 2FAVA 1Y7EA 1BPMA 1YSJA 1YMEA 4P44A 3SJXA 4PXCA 5AILA 4X8IA 5LRKA 1IY7A 3B7IA 3SIGA 3KHXA 3VATA 4IAVA 2GLJA 1DE4C 4MCRA 4J5QA 2ZOGA 3PB4X 3FVLA 3TX8A 2ZELA 4WWVA 3IIDA 2BFRA 4P4EA 3Q6ZA 4YWYA 3IC1A 3GQEA 2ANPA 4R8FA 3KZWA 3BI0A 4H2KA 3PB7X 2AFZA 2AFSA 1DTDA 2C6CA 1QQ9A 1VHEA 3NH8A 4CPAA 3GPQA 2EEEA 2PIZA 4R6TA 5FSXA 4PQAA 2PJ0A 3IIFA 2OR4A 3L2NA 3PB8X 3RBUA 1TKFA 1KWMA 2CIJA 4ONWA 3SIJA 2PJ9A 5HVFA 4ETJA 2ZEHA 3PEIA 3FECA 2QVPA 3VH9A 3WT4A 4UEZA 3EJFA 3CDXA 4OMEA 1F57A 5HIHA 4A37A 3SIIA 4DJLA 1EE3P 4PXEA 1HDUA 2CF4A 5LYIA 4P4BA 2LGRA 3VARA 4UEEA 4ZI6A 2PJ7A 3IWWA 1NJRA 1Z2LA 5DS0A 3WC6A 4NGPA 2V8HA 3IEHA 4ETKA 3D67A 4OIDA 1XMBA 4GVVA 4P6YA 5JGFA 5F09A 3SI2A 4IHMA 3SIHA 1Z5RA 3B3CA 3K2KA 4OC4A 4P10A 4OP4A 4TWEA 2CTCA 5DUSA 1YW6A 3EW5A 3IJ3A 2V8VA 2POKA 4P4DA 1XJOA 3V2BA 2ABZA 5LRJA 3S9NA 2XD7A 3D66A 3PFEA 4OIWA 5LRGA 4P45A 3BXMA 4A39A 3FX6A 1LAMA 4P4FA 3NA6A 3RAMA 4GUAA 3S9LA 4R7MA 2PJBA 4LQGA 3FMCA 4ABKA 4JZ0A 4J5SA 2F8HA 3ETIA 3ISZA 1LOKA 4X2TA 5FSYA 3B2YA 2QYVA 4KYBA 1F2OA 4FAIA 2PJ4A 3H8FA 4OKOA 4DUKA 2ZEEA 2PJ2A 4ESSA 1LCPA 3EKEA 1TY8A 2C1CA 2BCOA 2HB6A 1TF8A 2BFQA 2G9DA 2WYRA 3DLJA 4NGSA 3GQOA 2EWBA 1R43A 3FEEA 4ZX9A 3EWPA 3V38A 1ZG8A 3VFQA 3PRTA 4JCAA 3LWUA 3SJEA 3NH4A 2ZEPA 3GB0A 3KASA 1XRYA 3WABA 3V7ZA 5FSVA 5HOLA 4ZY0A 2V8GA 1VGYA 1VHOA 1TKHA 3IIBA 1Y0YA 4W9YA 3HUVA 3TC8A 2VL1A 1YD9A 2PJ6A 2XEGA 4OC3A 2Q4ZA 3PB6X 3D68A 5HVHA 3DGVA 1HEEA 1JQGA 2ACFA 2FXKA 1CPSA 3WC7A 4F9UA 2ZENA 1Z8LA 4OC5A 3EWRA 1F2PA 1XFOA 4BD9A 1CBXA 4J4ZA 5LYDA 6CPAA 2X47A 2EK9A 3EWQA 2XEFA 1LANA 3D4UA 5CB5A 3B3SA 3B35A 1ZLHA 4Z65A 4OC2A 1ZLIA 2ZEMA 3B3WA 5IB9A 4AXVA 1ARMA 2AFMA 3PB9X 4NFRA 5ELYA 2Q51A 5K8NA 2J9AA 1TXZA 4F8ZA 3HLPA 4NGQA 4NGMA 3KQZA 4NGNA 1RTQA 3FH4A 4UF4A 4FBEA 4YU9A 3JRUA 7CPAA 4NGTA 5E3BA 1TXRA 2AFXA 1ELLP 4Q7AA 3FJUA 4ZY1A 5CB3A 4JGKA 4NJRA 2IJZA 4MMOA 1LFWA 2RB7A 3N5FA 5D29A 4IQYA 2BOAA 1TF9A 4G1PA 1ARLA 2XEJA 3KQXA 4P4JA 2ZEGA 3IFEA 3GLJA 2IQ6A 3CPXA 3H8EA 2C6PA 4PXBA 4JLLA 1CP7A 2JBJA 3RZAA 2AFOA 1GYTA 4MCPA 1UWYA 2FVGA 1ZR5A 4F9VA 4O23A 5CBMA 1R3NA 1YW4A 2PIYA 4OC1A 2GU2A 3KR4A 4MHNA 2C6GA 4JYWA 1CX8A 2PRQA 1BLLE 4ZX8A 2PJAA 1H8LA 3KI9A 3KGQA 1ZG9A 5LYFA 4MHYA 1QMUA 3H8GA 2BO9A 4UIAA 5FSZA 5LYLA 4TNUA 2V77A 4DYOA 2F7VA 2VRIA 2DEAA 3BI1A 4KSIA 3GUXA 1IGBA 3SJFA 1PYTB 3QNVA 5HXDA 3CPAA 2IMOA 2FG1A 1ZG7A 5K8MA 4MHZA 4P4IA 2PE3A 1FT7A 2AFUA 4GVWA 4K3NA 3PBEA 2JEWA 4ABLA 3D7HA 3D7FA 4R76A 3K9TA 2PCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M4L A;  4EFD A;  4WJB A;  4EME A;  2AFC A;  1HDQ A;  1XBU A;  3PFO A;  4J5R A;  2PVV A;  4ZY2 A;  2PJ5 A;  4GM5 A;  4A38 A;  3WC5 A;  5THW A;  2I3C A;  1CG2 A;  3V45 A;  4UIB A;  3GPO A;  5K8P A;  8CPA A;  3Q71 A;  4X3R A;  3KL9 A;  2RFH A;  2WZN A;  2PJ1 A;  2NYQ A;  3T8W A;  4FWU A;  2Q43 A;  1YLO A;  2PJ3 A;  4EWT A;  1FNO A;  3KHZ A;  3SI0 A;  1ZR3 A;  3LMS A;  1BAV A;  4UEF A;  1VHU A;  1AYE A;  5CMS A;  2ZOF A;  3D7D A;  2PVW A;  4MXU A;  3I1U A;  1ELM P;  2PJ8 A;  5K8O A;  3SI1 A;  4NJQ A;  2DX6 A;  4NGR A;  4JVV A;  3JZT A;  1HJZ A;  1Y0R A;  3NFZ A;  3SJG A;  4K0C A;  3MN8 A;  4MCS A;  4PPZ A;  4FUU A;  4PXD A;  5I4M A;  3CT9 A;  5D8N A;  3S9M A;  4MRI A;  2JBK A;  2PJC A;  2ZEO A;  3PBB A;  3EWO A;  1CP6 A;  3IO1 A;  4OC0 A;  2HC9 A;  3D7G A;  2ZED A;  5JH9 A;  5JM6 A;  1TKJ A;  3BHX A;  4A94 A;  3MRU A;  2NSM A;  4RUH A;  4UML A;  1LAP A;  4MHP A;  1Q7L A;  2L8R A;  5HVG A;  4MCQ A;  2QJ8 A;  3ISX A;  1BPN A;  4ZYQ A;  1SPV A;  1CPX A;  5J1Q A;  3KR5 A;  3B3V A;  3GPG A;  1OBR A;  3NH5 A;  2CTB A;  2OOT A;  2O53 A;  1PCA A;  5CPA A;  4IK2 A;  3EJG A;  2AFW A;  2O4H A;  4D86 A;  3B3T A;  2ZEF A;  3FED A;  2GRE A;  2EK8 A;  1AMP A;  2GLF A;  2XEI A;  4B6Z A;  1NSA A;  3FF3 A;  1VIX A;  2V8D A;  5FSU A;  4TU0 A;  2FAV A;  1Y7E A;  1BPM A;  1YSJ A;  1YME A;  4P44 A;  3SJX A;  4PXC A;  5AIL A;  4X8I A;  5LRK A;  1IY7 A;  3B7I A;  3SIG A;  3KHX A;  3VAT A;  4IAV A;  2GLJ A;  1DE4 C;  4MCR A;  4J5Q A;  2ZOG A;  3PB4 X;  3FVL A;  3TX8 A;  2ZEL A;  4WWV A;  3IID A;  2BFR A;  4P4E A;  3Q6Z A;  4YWY A;  3IC1 A;  3GQE A;  2ANP A;  4R8F A;  3KZW A;  3BI0 A;  4H2K A;  3PB7 X;  2AFZ A;  2AFS A;  1DTD A;  2C6C A;  1QQ9 A;  1VHE A;  3NH8 A;  4CPA A;  3GPQ A;  2EEE A;  2PIZ A;  4R6T A;  5FSX A;  4PQA A;  2PJ0 A;  3IIF A;  2OR4 A;  3L2N A;  3PB8 X;  3RBU A;  1TKF A;  1KWM A;  2CIJ A;  4ONW A;  3SIJ A;  2PJ9 A;  5HVF A;  4ETJ A;  2ZEH A;  3PEI A;  3FEC A;  2QVP A;  3VH9 A;  3WT4 A;  4UEZ A;  3EJF A;  3CDX A;  4OME A;  1F57 A;  5HIH A;  4A37 A;  3SII A;  4DJL A;  1EE3 P;  4PXE A;  1HDU A;  2CF4 A;  5LYI A;  4P4B A;  2LGR A;  3VAR A;  4UEE A;  4ZI6 A;  2PJ7 A;  3IWW A;  1NJR A;  1Z2L A;  5DS0 A;  3WC6 A;  4NGP A;  2V8H A;  3IEH A;  4ETK A;  3D67 A;  4OID A;  1XMB A;  4GVV A;  4P6Y A;  5JGF A;  5F09 A;  3SI2 A;  4IHM A;  3SIH A;  1Z5R A;  3B3C A;  3K2K A;  4OC4 A;  4P10 A;  4OP4 A;  4TWE A;  2CTC A;  5DUS A;  1YW6 A;  3EW5 A;  3IJ3 A;  2V8V A;  2POK A;  4P4D A;  1XJO A;  3V2B A;  2ABZ A;  5LRJ A;  3S9N A;  2XD7 A;  3D66 A;  3PFE A;  4OIW A;  5LRG A;  4P45 A;  3BXM A;  4A39 A;  3FX6 A;  1LAM A;  4P4F A;  3NA6 A;  3RAM A;  4GUA A;  3S9L A;  4R7M A;  2PJB A;  4LQG A;  3FMC A;  4ABK A;  4JZ0 A;  4J5S A;  2F8H A;  3ETI A;  3ISZ A;  1LOK A;  4X2T A;  5FSY A;  3B2Y A;  2QYV A;  4KYB A;  1F2O A;  4FAI A;  2PJ4 A;  3H8F A;  4OKO A;  4DUK A;  2ZEE A;  2PJ2 A;  4ESS A;  1LCP A;  3EKE A;  1TY8 A;  2C1C A;  2BCO A;  2HB6 A;  1TF8 A;  2BFQ A;  2G9D A;  2WYR A;  3DLJ A;  4NGS A;  3GQO A;  2EWB A;  1R43 A;  3FEE A;  4ZX9 A;  3EWP A;  3V38 A;  1ZG8 A;  3VFQ A;  3PRT A;  4JCA A;  3LWU A;  3SJE A;  3NH4 A;  2ZEP A;  3GB0 A;  3KAS A;  1XRY A;  3WAB A;  3V7Z A;  5FSV A;  5HOL A;  4ZY0 A;  2V8G A;  1VGY A;  1VHO A;  1TKH A;  3IIB A;  1Y0Y A;  4W9Y A;  3HUV A;  3TC8 A;  2VL1 A;  1YD9 A;  2PJ6 A;  2XEG A;  4OC3 A;  2Q4Z A;  3PB6 X;  3D68 A;  5HVH A;  3DGV A;  1HEE A;  1JQG A;  2ACF A;  2FXK A;  1CPS A;  3WC7 A;  4F9U A;  2ZEN A;  1Z8L A;  4OC5 A;  3EWR A;  1F2P A;  1XFO A;  4BD9 A;  1CBX A;  4J4Z A;  5LYD A;  6CPA A;  2X47 A;  2EK9 A;  3EWQ A;  2XEF A;  1LAN A;  3D4U A;  5CB5 A;  3B3S A;  3B35 A;  1ZLH A;  4Z65 A;  4OC2 A;  1ZLI A;  2ZEM A;  3B3W A;  5IB9 A;  4AXV A;  1ARM A;  2AFM A;  3PB9 X;  4NFR A;  5ELY A;  2Q51 A;  5K8N A;  2J9A A;  1TXZ A;  4F8Z A;  3HLP A;  4NGQ A;  4NGM A;  3KQZ A;  4NGN A;  1RTQ A;  3FH4 A;  4UF4 A;  4FBE A;  4YU9 A;  3JRU A;  7CPA A;  4NGT A;  5E3B A;  1TXR A;  2AFX A;  1ELL P;  4Q7A A;  3FJU A;  4ZY1 A;  5CB3 A;  4JGK A;  4NJR A;  2IJZ A;  4MMO A;  1LFW A;  2RB7 A;  3N5F A;  5D29 A;  4IQY A;  2BOA A;  1TF9 A;  4G1P A;  1ARL A;  2XEJ A;  3KQX A;  4P4J A;  2ZEG A;  3IFE A;  3GLJ A;  2IQ6 A;  3CPX A;  3H8E A;  2C6P A;  4PXB A;  4JLL A;  1CP7 A;  2JBJ A;  3RZA A;  2AFO A;  1GYT A;  4MCP A;  1UWY A;  2FVG A;  1ZR5 A;  4F9V A;  4O23 A;  5CBM A;  1R3N A;  1YW4 A;  2PIY A;  4OC1 A;  2GU2 A;  3KR4 A;  4MHN A;  2C6G A;  4JYW A;  1CX8 A;  2PRQ A;  1BLL E;  4ZX8 A;  2PJA A;  1H8L A;  3KI9 A;  3KGQ A;  1ZG9 A;  5LYF A;  4MHY A;  1QMU A;  3H8G A;  2BO9 A;  4UIA A;  5FSZ A;  5LYL A;  4TNU A;  2V77 A;  4DYO A;  2F7V A;  2VRI A;  2DEA A;  3BI1 A;  4KSI A;  3GUX A;  1IGB A;  3SJF A;  1PYT B;  3QNV A;  5HXD A;  3CPA A;  2IMO A;  2FG1 A;  1ZG7 A;  5K8M A;  4MHZ A;  4P4I A;  2PE3 A;  1FT7 A;  2AFU A;  4GVW A;  4K3N A;  3PBE A;  2JEW A;  4ABL A;  3D7H A;  3D7F A;  4R76 A;  3K9T A;  2PCU A; 
#chains in the Genus database with same CATH topology
 1M4L A;  4EFD A;  2AJ6 A;  4WJB A;  3T90 A;  4EME A;  1X12 A;  2AFC A;  1HDQ A;  1XBU A;  3PFO A;  3A9L A;  4J5R A;  4C2X A;  3FIX A;  4CYN A;  2PVV A;  4MFZ A;  4ZY2 A;  1YX0 A;  2PJ5 A;  3D3S A;  4GM5 A;  5DWN A;  4U9Z A;  5THW A;  2YNC A;  3WC5 A;  1K4J A;  3R1K A;  2I3C A;  1CG2 A;  3V45 A;  1BO4 A;  3GPO A;  1Q2C A;  4NCZ A;  4UIB A;  5K8P A;  8CPA A;  3Q71 A;  4X3R A;  3KL9 A;  2RFH A;  2WZN A;  3DR6 A;  2PJ1 A;  2NYQ A;  3T8W A;  4FWU A;  2Q43 A;  1YLO A;  4KVO E;  1NSL A;  2PJ3 A;  4EWT A;  1FNO A;  3KHZ A;  3SI0 A;  1ZR3 A;  3LMS A;  2DF5 A;  1BAV A;  3NE8 A;  4UEF A;  1VHU A;  1AYE A;  5CMS A;  2QIR A;  2ZOF A;  1B87 A;  4CGL A;  3D7D A;  4AG7 A;  2PVW A;  4C2Y A;  4CAF A;  4II9 A;  4MXU A;  3I1U A;  3BLN A;  4MY0 A;  1NMT A;  1M4I A;  1ELM P;  2PJ8 A;  4MFJ A;  5K8O A;  2ZW6 A;  1MJ9 A;  4UFW A;  3SI1 A;  4NJQ A;  3W91 A;  2DX6 A;  4H6U A;  4NGR A;  4JVV A;  3JZT A;  2CNT A;  2B4B A;  1IYL A;  1HJZ A;  1Y0R A;  3NFZ A;  3SJG A;  4CYO A;  2G3A A;  4K0C A;  2Z3M A;  3MN8 A;  4MCS A;  2YND A;  4PPZ A;  2JLM A;  4FUU A;  2GAN A;  4PXD A;  3CT9 A;  2JZE A;  5D8N A;  3EO4 A;  4R9M A;  5I4M A;  3S9M A;  3W6X A;  4MRI A;  2JBK A;  4PK3 A;  3TOB A;  4IF5 A;  2PJC A;  4YFJ A;  5A28 A;  2ZEO A;  3PBB A;  2WSA A;  4UWJ A;  3EWO A;  1CP6 A;  1YR0 A;  3FNC A;  2RNK A;  3IO1 A;  1Z8W A;  2B4D A;  2BL1 A;  4OC0 A;  2BEI A;  4CGO A;  2R8V A;  2BUE A;  2CXA A;  2HC9 A;  3D7G A;  3FBU A;  1I21 A;  2ZED A;  3G8W A;  4CGP A;  5AG4 A;  2VZY A;  4FD7 A;  5JH9 A;  1TKJ A;  3BHX A;  5JM6 A;  1M1D A;  4A94 A;  3MRU A;  2G0B A;  2NSM A;  4RUH A;  4UML A;  3D8P A;  3SXN A;  1WWZ A;  1LAP A;  1MJB A;  2Z3P A;  4MHP A;  3FXT A;  1Q7L A;  1Y9W A;  2L8R A;  5HVG A;  3FRM A;  4MCQ A;  2QJ8 A;  5GCN A;  4H89 A;  1J4J A;  1BPN A;  3ISX A;  4ZYQ A;  4C2Z A;  1SPV A;  4E0A A;  5J1Q A;  3KR5 A;  4U9Y A;  4XNH C;  3B3V A;  3GPG A;  1OBR A;  3NH5 A;  1QSM A;  2CTB A;  2VXK A;  2OOT A;  2O53 A;  3JUW A;  4MBU A;  1PCA A;  4UCP A;  5CPA A;  3S6K A;  1NE9 A;  4IK2 A;  3EJG A;  2AFW A;  4KUA A;  2O4H A;  4D86 A;  4F0Y A;  3B3T A;  2ZEF A;  3FED A;  2FE7 A;  2GFQ A;  2GRE A;  4JLY A;  2EK8 A;  1AMP A;  2GLF A;  2XEI A;  4B6Z A;  4CAX A;  4YGO A;  1NSA A;  1FY7 A;  1VIX A;  3FF3 A;  3IU1 A;  4FD4 A;  2V8D A;  4ZGY B;  2JDC A;  5FSU A;  1L0C A;  2H5M A;  4TU0 A;  1YQE A;  2REE A;  1XOV A;  2FAV A;  1P0H A;  1Y7E A;  4UWI A;  1BPM A;  1QSN A;  1YSJ A;  1YME A;  3C26 A;  4LQ6 A;  4GS4 A;  4HNW B;  4P44 A;  3SJX A;  3IWG A;  3TCV A;  5G21 A;  4PXC A;  4JXQ A;  5AIL A;  2CY2 A;  3P2F A;  4X8I A;  5LRK A;  4QUS A;  1IY7 A;  4DNC A;  3B7I A;  3SIG A;  3KHX A;  1YVK A;  4IAV A;  2J8M A;  3VAT A;  4RN7 A;  2GLJ A;  4HNY B;  1M4D A;  1DE4 C;  4MCR A;  4J5Q A;  2ZOG A;  3PB4 X;  4XPK A;  2ZW4 A;  3FVL A;  4JXR A;  5F46 A;  2PR8 A;  3TX8 A;  2CNS A;  2CNM A;  2ZEL A;  1XMT A;  4MY3 A;  1Z8T A;  1S7F A;  2B58 A;  3G3S A;  4R57 A;  3SXO A;  4WWV A;  3IID A;  2BFR A;  3GIU A;  1OZP A;  1GHE A;  4P4E A;  3Q6Z A;  4A32 A;  4PV6 A;  3IC1 A;  4YWY A;  3DDD A;  4MFP A;  1YVO A;  4BMH A;  4A95 A;  2Z3N A;  5H86 A;  3GQE A;  2ANP A;  1Y9K A;  3IU2 A;  4R8F A;  3KZW A;  4KSA A;  3BI0 A;  3MGD A;  4H2K A;  3PB7 X;  2B4D B;  2AFZ A;  2AFS A;  1DTD A;  2C6C A;  2GE3 A;  1QQ9 A;  2HQY A;  4KOV A;  3H4Q A;  1VHE A;  3NH8 A;  4CPA A;  3GPQ A;  3BJ8 A;  1X10 A;  2EEE A;  2QML A;  4B11 A;  2PIZ A;  5BWA B;  4KOR A;  3I9S A;  4R6T A;  5FSX A;  4PQA A;  2PJ0 A;  3IIF A;  2OR4 A;  2EBJ A;  2Q44 A;  3L2N A;  3PB8 X;  3RBU A;  5HMN A;  1TKF A;  1KWM A;  2CIJ A;  2REF A;  2VI7 A;  4ONW A;  3SIJ A;  2B3V A;  2JDD A;  2PJ9 A;  2P6F A;  5HVF A;  4ETJ A;  2ZEH A;  3I3G A;  1IU8 A;  3PEI A;  3FEC A;  2QVP A;  3VH9 A;  2HV2 A;  3E0K A;  3WT4 A;  1QSO A;  4E8O A;  2Z10 A;  3S6G A;  2EVN A;  2KCW A;  4UEZ A;  1JWQ A;  2JZF A;  3EJF A;  1XEB A;  3CDX A;  4OME A;  3EXN A;  2Q4Y A;  6CPA A;  1F57 A;  1Z9U A;  1M4G A;  5FVJ A;  5HIH A;  4A37 A;  3SII A;  2PC1 A;  4KZT A;  1Q2D A;  4QB9 A;  1S7L A;  3T9Y A;  4DJL A;  4B5P A;  1S7K A;  2Q7S A;  4PSW A;  1EE3 P;  4PXE A;  1RXT A;  1HDU A;  2X7B A;  2CF4 A;  1Z4R A;  5LYI A;  4P4B A;  2JEV A;  2W2G A;  2LGR A;  3KKW A;  3VAR A;  4UEE A;  4ZI6 A;  4RI1 A;  2D4P A;  2PJ7 A;  2B3U A;  3IWW A;  4E2A A;  5EC4 A;  1NJR A;  4B12 A;  1Z2L A;  5AG5 A;  2J8N A;  5DS0 A;  3WC6 A;  2R1I A;  4NGP A;  4BIN A;  2YNE A;  2V8H A;  3IEH A;  4ETK A;  1M44 A;  2OZU A;  3D67 A;  4OID A;  1S60 A;  3LOD A;  1U6M A;  1UFH A;  1XMB A;  4GVV A;  1B6B A;  1QSR A;  2G3T A;  2ZW7 A;  4P6Y A;  1XF8 A;  4C68 A;  5JGF A;  5F09 A;  3SI2 A;  4IHM A;  3SHP A;  3SIH A;  1Z5R A;  3B3C A;  2QEC A;  4U5Y A;  3K2K A;  1Z4E A;  4OAD A;  1IID A;  3W6S A;  1I12 A;  2FL4 A;  4OC4 A;  4P10 A;  3RYO A;  2P6E A;  4OP4 A;  4CAV A;  4MFK A;  4TWE A;  1KUY A;  2CTC A;  2C27 A;  1S5K A;  4AVC A;  5DUS A;  1YW6 A;  4CS0 B;  2Q4V A;  3EW5 A;  3IJ3 A;  5G20 A;  2V8V A;  2POK A;  1I1D A;  3EY5 A;  4XNH B;  1P4N A;  2Z0Z A;  4J3G A;  4P4D A;  1XJO A;  3V2B A;  2ABZ A;  2WPX A;  3PP9 A;  5LRJ A;  2DPS A;  3S9N A;  2XD7 A;  3D66 A;  1Z8X A;  3IWE A;  3PFE A;  4OIW A;  1YRE A;  5LRG A;  4F0X A;  4P45 A;  3RO0 A;  5G22 A;  2P0W A;  3BXM A;  4A38 A;  4A39 A;  3FX6 A;  1LAM A;  1LRZ A;  3N7Z A;  4P4F A;  3NA6 A;  1S7N A;  3QAY A;  1QST A;  4KOT A;  3RAM A;  1AUG A;  4GUA A;  3S9L A;  2R7H A;  4M6I A;  1CM0 A;  2VQY A;  4R7M A;  2FS5 A;  2PJB A;  3DR8 A;  3FB3 A;  3FMC A;  2R98 A;  4HKF A;  4LQG A;  4BBH A;  4MFL A;  1MJA A;  4ABK A;  4HPS A;  4JZ0 A;  4NXY A;  4J5S A;  5JQ4 A;  2F8H A;  3ETI A;  3ISZ A;  1LOK A;  4F6A A;  4X2T A;  5FSY A;  3B2Y A;  2QYV A;  4KS9 A;  4B13 A;  4KYB A;  3VWE A;  1F2O A;  4CGN A;  4FAI A;  2PJ4 A;  3H8F A;  4OKO A;  4DUK A;  1IIC A;  2ZEE A;  4OLL A;  2WPW A;  2PJ2 A;  4ESS A;  4B5O A;  4MHD A;  2GIV A;  4FD5 A;  3QAH A;  1LCP A;  3EKE A;  2FIW A;  4CRZ B;  1R57 A;  1TY8 A;  3D2M A;  4ORF A;  2C1C A;  2BCO A;  3BJ7 A;  2HB6 A;  1TF8 A;  5F47 A;  2BFQ A;  2G9D A;  2WYR A;  3DLJ A;  4NGS A;  3GQO A;  2EWB A;  4UCN A;  1PU9 A;  2OH1 A;  2PSW A;  1R43 A;  3FEE A;  4ZX9 A;  3EWP A;  2OZH A;  4RS2 A;  3V38 A;  1ZG8 A;  3VFQ A;  2ZPA A;  3PRT A;  4JCA A;  3LWU A;  3SJE A;  2YGW A;  3NH4 A;  3VWD A;  2ZEP A;  3GB0 A;  3KAS A;  4QVT A;  5IV0 A;  2ZXV A;  1XRY A;  2DXQ A;  2OU2 A;  1KUX A;  3WAB A;  3V7Z A;  5FSV A;  5HOL A;  4AG9 A;  4ZY0 A;  2I00 A;  1VGY A;  2D4O A;  2V8G A;  3CXS A;  4M6H A;  3R9G A;  5EBV A;  3TO6 A;  1VHO A;  2Z3L A;  1TKH A;  2Z3K A;  4B5P B;  3PGP A;  2PCU A;  3IIB A;  1Y0Y A;  4W9Y A;  1A2Z A;  3HUV A;  3TC8 A;  2VL1 A;  1YD9 A;  2PJ6 A;  2FSR A;  2XEG A;  2JZD A;  4OC3 A;  5IX3 A;  2Q0Y A;  2Q4Z A;  3F8K A;  1YLE A;  3PB6 X;  5JPH A;  3D68 A;  5HVH A;  2WUU A;  1XIX A;  3LD2 A;  3DGV A;  4CYP A;  5DWM A;  1HEE A;  1JQG A;  2ACF A;  2FXK A;  1CPS A;  3UY5 A;  3TE4 A;  4R3L A;  3WC7 A;  3DNS A;  2Q04 A;  4F9U A;  4KLV A;  2ZEN A;  1IOI A;  1Z8L A;  4ONU A;  4XPL A;  4Q36 A;  4OC5 A;  3EWR A;  1F2P A;  3RNZ A;  4M3S A;  1XFO A;  3R9F A;  4BD9 A;  3GKR A;  4JD6 A;  1V0C A;  1CBX A;  2FCK A;  4HNX B;  4H6Z A;  4J4Z A;  2Q7B A;  4KOY A;  5LYD A;  2KQV A;  4KVM E;  2EUI A;  2X47 A;  2EK9 A;  3EWQ A;  2NMT A;  2PDO A;  2XEF A;  4R87 A;  1VHS A;  4X5K A;  5F49 A;  1SQH A;  5J8C A;  3GY9 A;  5IB0 A;  2A4N A;  1LAN A;  4KOS A;  3D4U A;  5CB5 A;  3B3S A;  3B35 A;  3F5B A;  5C82 A;  1ZLH A;  4Z65 A;  1TIQ A;  4MI4 A;  1Q2Y A;  4OC2 A;  2Z3O A;  1ZLI A;  2ZEM A;  3B3W A;  5IB9 A;  4AXV A;  4C7I A;  1ARM A;  2AFM A;  3PB9 X;  3NE7 A;  2B5G B;  4K30 A;  3F0A A;  4NFR A;  5ELY A;  1WK4 A;  3TO7 A;  2Q51 A;  1ZO0 A;  4AB7 A;  5CNP A;  5K8N A;  1YK3 A;  2J8R A;  2J9A A;  1TXZ A;  4KOX A;  2FXF A;  4OAE A;  4F8Z A;  4UCM A;  4CGM A;  3TTH A;  5A27 A;  3HLP A;  4NGQ A;  1MK4 A;  4NGM A;  3KQZ A;  4NGN A;  3JVN A;  2FIA A;  1RTQ A;  2Y0M A;  4Q38 A;  4L89 A;  3FH4 A;  2WCT A;  2EO8 A;  1BOB A;  2BSW A;  4GXH A;  5C88 A;  2HUZ A;  3CXQ A;  1KZF A;  4UF4 A;  2I79 A;  4MFQ A;  4YU9 A;  4UFV A;  4FBE A;  3TO9 A;  3JRU A;  7CPA A;  4NGT A;  4NEX A;  3LAC A;  5E3B A;  1RO5 A;  4A33 A;  1TXR A;  2AFX A;  1ELL P;  1CJW A;  4KVX A;  3FJU A;  4Q7A A;  4Y49 B;  4ZY1 A;  5CB3 A;  3R9E A;  2Z11 A;  3DSB A;  3CXP A;  4JGK A;  3QB8 A;  4NJR A;  2IJZ A;  4MMO A;  3S6F A;  2PRB A;  1LFW A;  2RB7 A;  2VZZ A;  3D2P A;  3N5F A;  5D29 A;  4IQY A;  2BOA A;  5E96 A;  1TF9 A;  2O28 A;  4NSQ A;  4C7H A;  4XPD B;  3B8G A;  4G1P A;  1ARL A;  2XEJ A;  3EFA A;  4QC6 A;  3KQX A;  4B10 A;  4P4J A;  2ZEG A;  3IFE A;  4KOU A;  3GLJ A;  2K5T A;  2IQ6 A;  3CPX A;  5H84 A;  3H8E A;  2C6P A;  3EC4 A;  3K9U A;  4PXB A;  4PK2 A;  4JLL A;  1CP7 A;  2JBJ A;  4FD6 A;  3RZA A;  3S6H A;  5ISV A;  2AFO A;  1GYT A;  2ATR A;  1UWY A;  2OZG A;  4MCP A;  5AGE A;  4JWP A;  4KUB A;  4B14 A;  4AVB A;  4AVA A;  1XE4 A;  5I0C A;  2FVG A;  4PSX A;  4CAW A;  4UBR A;  1ZR5 A;  3P2H A;  4F9V A;  4O23 A;  5CBM A;  5HH1 A;  3JTK A;  1R3N A;  1ON0 A;  1YW4 A;  2PIY A;  4QBJ A;  3GYA A;  3PZJ A;  3TOA A;  4OC1 A;  3R96 A;  4CRY B;  2DPT A;  3KR4 A;  2GU2 A;  4MHN A;  2C6G A;  4M85 A;  1Y7R A;  4JYW A;  4R3K A;  5J8F A;  5KTD A;  5F48 A;  1CX8 A;  2VBQ A;  2PRQ A;  4L8A A;  3FYN A;  1BLL E;  4ZX8 A;  2PJA A;  3IGR A;  1H8L A;  4LX9 A;  3KI9 A;  2ODF A;  3KGQ A;  4KSF A;  1VKC A;  1YGH A;  1ZG9 A;  4LUA A;  2P6G A;  4MHY A;  4MJ8 A;  4I49 A;  5LYF A;  1QMU A;  3H8G A;  2BO9 A;  4UIA A;  2AE6 A;  5AG7 A;  5G1Z A;  1IOF A;  5FSZ A;  1IB1 E;  2ARH A;  5LYL A;  4CAE A;  4TNU A;  2V77 A;  4DYO A;  4YRH A;  2PR1 A;  2F7V A;  2VRI A;  2DEA A;  5AG6 A;  3BI1 A;  3V8I A;  3ZZI A;  4KSI A;  3GUX A;  4Y49 C;  3R95 A;  1IGB A;  3TFY A;  4A2Z A;  3SJF A;  1PYT B;  2FT0 A;  2F5I A;  3H5Z A;  3QNV A;  5HXD A;  3CPA A;  2IL4 A;  4UA3 A;  2IMO A;  2FG1 A;  1PUA A;  1ZG7 A;  2RC4 A;  5K8M A;  4UFX A;  3ZJ0 A;  4MHZ A;  5KTA A;  4A30 A;  1KUV A;  3TT2 A;  3OWC A;  4JJX A;  4P4I A;  3CZX A;  1IYK A;  2PE3 A;  4M6G A;  3WR7 A;  1FT7 A;  4KOW A;  2AFU A;  2ZW5 A;  4GVW A;  4IUS A;  4A31 A;  4NF1 A;  4K3N A;  4KLW A;  4EVY A;  4ZBG A;  4CYQ A;  1S3Z A;  2YNC C;  2JEW A;  3PBE A;  4ABL A;  5KTC A;  3D7H A;  2VEZ A;  5EMI A;  2OB0 A;  3D7F A;  1N71 A;  4R76 A;  3K9T A;  2PQ8 A;  2B5G A;  4XPD C;  1CPX A; 
#chains in the Genus database with same CATH homology
 1M4L A;  4EFD A;  4WJB A;  4EME A;  2AFC A;  1HDQ A;  1XBU A;  3PFO A;  4J5R A;  2PVV A;  4ZY2 A;  2PJ5 A;  4GM5 A;  4A38 A;  3WC5 A;  5THW A;  2I3C A;  1CG2 A;  3V45 A;  4UIB A;  3GPO A;  5K8P A;  8CPA A;  3Q71 A;  4X3R A;  3KL9 A;  2RFH A;  2WZN A;  2PJ1 A;  2NYQ A;  3T8W A;  4FWU A;  2Q43 A;  1YLO A;  2PJ3 A;  4EWT A;  1FNO A;  3KHZ A;  3SI0 A;  1ZR3 A;  3LMS A;  1BAV A;  4UEF A;  1VHU A;  1AYE A;  5CMS A;  2ZOF A;  3D7D A;  2PVW A;  4MXU A;  3I1U A;  1ELM P;  2PJ8 A;  5K8O A;  3SI1 A;  4NJQ A;  2DX6 A;  4NGR A;  4JVV A;  3JZT A;  1HJZ A;  1Y0R A;  3NFZ A;  3SJG A;  4K0C A;  3MN8 A;  4MCS A;  4PPZ A;  4FUU A;  4PXD A;  5I4M A;  3CT9 A;  5D8N A;  3S9M A;  4MRI A;  2JBK A;  2PJC A;  2ZEO A;  3PBB A;  3EWO A;  1CP6 A;  3IO1 A;  4OC0 A;  2HC9 A;  3D7G A;  2ZED A;  5JH9 A;  5JM6 A;  1TKJ A;  3BHX A;  4A94 A;  3MRU A;  2NSM A;  4RUH A;  4UML A;  1LAP A;  4MHP A;  1Q7L A;  2L8R A;  5HVG A;  4MCQ A;  2QJ8 A;  3ISX A;  1BPN A;  4ZYQ A;  1SPV A;  1CPX A;  5J1Q A;  3KR5 A;  3B3V A;  3GPG A;  1OBR A;  3NH5 A;  2CTB A;  2OOT A;  2O53 A;  1PCA A;  5CPA A;  4IK2 A;  3EJG A;  2AFW A;  2O4H A;  4D86 A;  3B3T A;  2ZEF A;  3FED A;  2GRE A;  2EK8 A;  1AMP A;  2GLF A;  2XEI A;  4B6Z A;  1NSA A;  3FF3 A;  1VIX A;  2V8D A;  5FSU A;  4TU0 A;  2FAV A;  1Y7E A;  1BPM A;  1YSJ A;  1YME A;  4P44 A;  3SJX A;  4PXC A;  5AIL A;  4X8I A;  5LRK A;  1IY7 A;  3B7I A;  3SIG A;  3KHX A;  3VAT A;  4IAV A;  2GLJ A;  1DE4 C;  4MCR A;  4J5Q A;  2ZOG A;  3PB4 X;  3FVL A;  3TX8 A;  2ZEL A;  4WWV A;  3IID A;  2BFR A;  4P4E A;  3Q6Z A;  4YWY A;  3IC1 A;  3GQE A;  2ANP A;  4R8F A;  3KZW A;  3BI0 A;  4H2K A;  3PB7 X;  2AFZ A;  2AFS A;  1DTD A;  2C6C A;  1QQ9 A;  1VHE A;  3NH8 A;  4CPA A;  3GPQ A;  2EEE A;  2PIZ A;  4R6T A;  5FSX A;  4PQA A;  2PJ0 A;  3IIF A;  2OR4 A;  3L2N A;  3PB8 X;  3RBU A;  1TKF A;  1KWM A;  2CIJ A;  4ONW A;  3SIJ A;  2PJ9 A;  5HVF A;  4ETJ A;  2ZEH A;  3PEI A;  3FEC A;  2QVP A;  3VH9 A;  3WT4 A;  4UEZ A;  3EJF A;  3CDX A;  4OME A;  1F57 A;  5HIH A;  4A37 A;  3SII A;  4DJL A;  1EE3 P;  4PXE A;  1HDU A;  2CF4 A;  5LYI A;  4P4B A;  2LGR A;  3VAR A;  4UEE A;  4ZI6 A;  2PJ7 A;  3IWW A;  1NJR A;  1Z2L A;  5DS0 A;  3WC6 A;  4NGP A;  2V8H A;  3IEH A;  4ETK A;  3D67 A;  4OID A;  1XMB A;  4GVV A;  4P6Y A;  5JGF A;  5F09 A;  3SI2 A;  4IHM A;  3SIH A;  1Z5R A;  3B3C A;  3K2K A;  4OC4 A;  4P10 A;  4OP4 A;  4TWE A;  2CTC A;  5DUS A;  1YW6 A;  3EW5 A;  3IJ3 A;  2V8V A;  2POK A;  4P4D A;  1XJO A;  3V2B A;  2ABZ A;  5LRJ A;  3S9N A;  2XD7 A;  3D66 A;  3PFE A;  4OIW A;  5LRG A;  4P45 A;  3BXM A;  4A39 A;  3FX6 A;  1LAM A;  4P4F A;  3NA6 A;  3RAM A;  4GUA A;  3S9L A;  4R7M A;  2PJB A;  4LQG A;  3FMC A;  4ABK A;  4JZ0 A;  4J5S A;  2F8H A;  3ETI A;  3ISZ A;  1LOK A;  4X2T A;  5FSY A;  3B2Y A;  2QYV A;  4KYB A;  1F2O A;  4FAI A;  2PJ4 A;  3H8F A;  4OKO A;  4DUK A;  2ZEE A;  2PJ2 A;  4ESS A;  1LCP A;  3EKE A;  1TY8 A;  2C1C A;  2BCO A;  2HB6 A;  1TF8 A;  2BFQ A;  2G9D A;  2WYR A;  3DLJ A;  4NGS A;  3GQO A;  2EWB A;  1R43 A;  3FEE A;  4ZX9 A;  3EWP A;  3V38 A;  1ZG8 A;  3VFQ A;  3PRT A;  4JCA A;  3LWU A;  3SJE A;  3NH4 A;  2ZEP A;  3GB0 A;  3KAS A;  1XRY A;  3WAB A;  3V7Z A;  5FSV A;  5HOL A;  4ZY0 A;  2V8G A;  1VGY A;  1VHO A;  1TKH A;  3IIB A;  1Y0Y A;  4W9Y A;  3HUV A;  3TC8 A;  2VL1 A;  1YD9 A;  2PJ6 A;  2XEG A;  4OC3 A;  2Q4Z A;  3PB6 X;  3D68 A;  5HVH A;  3DGV A;  1HEE A;  1JQG A;  2ACF A;  2FXK A;  1CPS A;  3WC7 A;  4F9U A;  2ZEN A;  1Z8L A;  4OC5 A;  3EWR A;  1F2P A;  1XFO A;  4BD9 A;  1CBX A;  4J4Z A;  5LYD A;  6CPA A;  2X47 A;  2EK9 A;  3EWQ A;  2XEF A;  1LAN A;  3D4U A;  5CB5 A;  3B3S A;  3B35 A;  1ZLH A;  4Z65 A;  4OC2 A;  1ZLI A;  2ZEM A;  3B3W A;  5IB9 A;  4AXV A;  1ARM A;  2AFM A;  3PB9 X;  4NFR A;  5ELY A;  2Q51 A;  5K8N A;  2J9A A;  1TXZ A;  4F8Z A;  3HLP A;  4NGQ A;  4NGM A;  3KQZ A;  4NGN A;  1RTQ A;  3FH4 A;  4UF4 A;  4FBE A;  4YU9 A;  3JRU A;  7CPA A;  4NGT A;  5E3B A;  1TXR A;  2AFX A;  1ELL P;  4Q7A A;  3FJU A;  4ZY1 A;  5CB3 A;  4JGK A;  4NJR A;  2IJZ A;  4MMO A;  1LFW A;  2RB7 A;  3N5F A;  5D29 A;  4IQY A;  2BOA A;  1TF9 A;  4G1P A;  1ARL A;  2XEJ A;  3KQX A;  4P4J A;  2ZEG A;  3IFE A;  3GLJ A;  2IQ6 A;  3CPX A;  3H8E A;  2C6P A;  4PXB A;  4JLL A;  1CP7 A;  2JBJ A;  3RZA A;  2AFO A;  1GYT A;  4MCP A;  1UWY A;  2FVG A;  1ZR5 A;  4F9V A;  4O23 A;  5CBM A;  1R3N A;  1YW4 A;  2PIY A;  4OC1 A;  2GU2 A;  3KR4 A;  4MHN A;  2C6G A;  4JYW A;  1CX8 A;  2PRQ A;  1BLL E;  4ZX8 A;  2PJA A;  1H8L A;  3KI9 A;  3KGQ A;  1ZG9 A;  5LYF A;  4MHY A;  1QMU A;  3H8G A;  2BO9 A;  4UIA A;  5FSZ A;  5LYL A;  4TNU A;  2V77 A;  4DYO A;  2F7V A;  2VRI A;  2DEA A;  3BI1 A;  4KSI A;  3GUX A;  1IGB A;  3SJF A;  1PYT B;  3QNV A;  5HXD A;  3CPA A;  2IMO A;  2FG1 A;  1ZG7 A;  5K8M A;  4MHZ A;  4P4I A;  2PE3 A;  1FT7 A;  2AFU A;  4GVW A;  4K3N A;  3PBE A;  2JEW A;  4ABL A;  3D7H A;  3D7F A;  4R76 A;  3K9T A;  2PCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...