4ZX9A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10b
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable M17 family aminopeptidase
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
total genus 176
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zx9A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zx9A02
4MCPA 4P4JA 2NYQA 4MHZA 6CPAA 1XBUA 1AYEA 4ETKA 4MHPA 5HVGA 4UIBA 4K3NA 4NGQA 2XEIA 3D68A 5DUSA 2V8DA 1HJZA 1XJOA 4MCSA 4DJLA 3B3TA 4MRIA 4D86A 3ISZA 3CT9A 4P44A 3KL9A 3FH4A 2IJZA 2PJ3A 3ISXA 5K8OA 3N5FA 1NSAA 4NJRA 2IQ6A 3V2BA 1CP7A 4A37A 4PPZA 3D7HA 4PXEA 2FVGA 2POKA 2BFQA 3Q6ZA 3FECA 4CPAA 4UMLA 3RZAA 3FX6A 3GPQA 2V8HA 4MMOA 3SIGA 3IO1A 3H8GA 4P4EA 4MXUA 3EWQA 2PVVA 2GLFA 1TKFA 2PIZA 2XEFA 4P4FA 4OC2A 1YMEA 3FVLA 3B35A 4RUHA 4DUKA 4F8ZA 4F9UA 1Q7LA 4BD9A 4MHYA 4MHNA 2ZOGA 2DEAA 1YW4A 1LANA 2PJ5A 5LRGA 3K2KA 2V8VA 4UEEA 2XEGA 2EEEA 2CTCA 1QQ9A 1DTDA 4OMEA 2PJ6A 1TKHA 3HUVA 5AILA 2GLJA 4O23A 3SIJA 4AXVA 3KI9A 4NGPA 2ABZA 3WABA 2PJBA 2C1CA 1ZG8A 3GPGA 5LYDA 4IAVA 2DX6A 1CP6A 4OC0A 7CPAA 1FNOA 3GQEA 1CPSA 4OC4A 4ONWA 4R6TA 3GUXA 2JBKA 2AFOA 2PVWA 3L2NA 1TXZA 2EWBA 3QNVA 1XRYA 2QJ8A 3IWWA 5LYFA 1Y0YA 5HIHA 2JBJA 3FEEA 3IEHA 2FAVA 1F2PA 4ZYQA 4NGRA 4NFRA 1BPNA 5HVHA 2EK8A 5FSVA 2AFCA 1F57A 4LQGA 5JH9A 4GVVA 1LFWA 3IIDA 3SJGA 3PEIA 2XD7A 1CX8A 2PJ4A 4Z65A 4X2TA 5THWA 1VGYA 3FF3A 5E3BA 3RAMA 4OC3A 3V38A 1FT7A 3VARA 1ZLIA 3V45A 5CBMA 3EWRA 2Q43A 1ZG9A 4F9VA 2BFRA 3GQOA 3D7FA 1NJRA 1Z5RA 4W9YA 1VHEA 2C6CA 2VL1A 4OIWA 4J5SA 2CTBA 3NH8A 2NSMA 4NJQA 1XMBA 2PE3A 3WT4A 2PJ9A 3B3CA 4FUUA 4P4DA 1ELLP 3RBUA 4OP4A 3JRUA 4EWTA 2ANPA 1YLOA 4P4IA 1CG2A 4MCRA 2ZEEA 4KSIA 5HVFA 3SJFA 1QMUA 2Q51A 5J1QA 5JGFA 2PJAA 2V8GA 2ZEHA 3SJEA 2RB7A 5K8NA 3D7DA 1TKJA 5D29A 5FSYA 2EK9A 4YWYA 2ZEOA 3JZTA 3B2YA 4NGSA 1F2OA 3H8EA 3TX8A 4GM5A 5LYLA 1BAVA 1AMPA 3SI0A 3SIIA 2ZEMA 1HDUA 2O53A 4X8IA 4JVVA 4TNUA 2WZNA 4GVWA 2AFZA 3B3WA 8CPAA 3KR5A 5CB5A 2AFWA 4NGNA 4OKOA 3IC1A 4TWEA 4R76A 4UEZA 4UIAA 3T8WA 5FSUA 3KR4A 2FXKA 3NA6A 2L8RA 4EFDA 4YU9A 4X3RA 2XEJA 3I1UA 4B6ZA 1R3NA 3HLPA 2PJ8A 4H2KA 3VH9A 5DS0A 3IIBA 4WJBA 3PFEA 5LRKA 3FJUA 1RTQA 4JYWA 2ZEGA 2I3CA 3DGVA 3SIHA 1YD9A 4MCQA 2F8HA 3GPOA 3V7ZA 2PJCA 3KQXA 2BOAA 2OR4A 4PXBA 2G9DA 4TU0A 2C6PA 3KHZA 3SI1A 4WWVA 3NH4A 3DLJA 4P10A 4JZ0A 1Y7EA 3NH5A 1H8LA 2ZELA 3BHXA 3Q71A 4ETJA 5LYIA 3BI0A 1EE3P 1ZR5A 3S9LA 1LCPA 4NGMA 3NFZA 4UF4A 3GLJA 1IY7A 2BO9A 4KYBA 4A94A 3SJXA 4IQYA 1ZR3A 1M4LA 4ZX8A 2RFHA 1JQGA 3TC8A 1BPMA 3CPAA 2GREA 4PXDA 4A39A 4K0CA 1LAMA 2PJ0A 3WC7A 2IMOA 3IFEA 3PBBA 2CIJA 1Z2LA 4NGTA 3KZWA 1Z8LA 3PB8X 2PRQA 5D8NA 1R43A 4G1PA 2VRIA 2CF4A 5CPAA 4Q7AA 1BLLE 4ZI6A 3PB9X 3KASA 4P6YA 1SPVA 4ZX9A 4P4BA 3FEDA 2ZEFA 4FAIA 5FSZA 3EJGA 1ZLHA 5CB3A 3KGQA 2PJ2A 2WYRA 1VHOA 4ZY2A 4FWUA 4OIDA 1VIXA 1OBRA 1LAPA 2GU2A 3S9NA 3PBEA 2F7VA 1HEEA 5FSXA 4R8FA 1IGBA 1KWMA 3KHXA 5IB9A 1YSJA 1Y0RA 3S9MA 2ZEPA 3KQZA 3D67A 2C6GA 4PXCA 3PB4X 3EKEA 2AFXA 3D4UA 4P45A 3WC5A 1TF8A 4GUAA 2QYVA 3PB6X 3PRTA 2QVPA 2ZEDA 4J4ZA 2PJ7A 3GB0A 1UWYA 1ARLA 1TXRA 2HB6A 5I4MA 2JEWA 3BI1A 4IK2A 2O4HA 3ETIA 4ABLA 3EW5A 2Q4ZA 4FBEA 3SI2A 3IIFA 5K8PA 1PYTB 3LWUA 2AFSA 2X47A 1YW6A 3EWPA 5CMSA 4ESSA 1ELMP 4ABKA 3B7IA 5K8MA 2FG1A 3H8FA 5HXDA 2V77A 1CPXA 5ELYA 1ARMA 4OC5A 3B3VA 4OC1A 1DE4C 2PIYA 4A38A 2ACFA 3VATA 1VHUA 3CPXA 3EJFA 1LOKA 1ZG7A 2ZOFA 4JGKA 3MN8A 1TY8A 3PFOA 4PQAA 4UEFA 5HOLA 5F09A 3VFQA 3FMCA 3MRUA 3CDXA 3EWOA 4R7MA 4ZY1A 4JCAA 1TF9A 4ZY0A 2PCUA 4JLLA 3D7GA 4IHMA 2OOTA 4EMEA 3D66A 1HDQA 2LGRA 3PB7X 4J5QA 3LMSA 3K9TA 2J9AA 2ZENA 5LRJA 1GYTA 2HC9A 1CBXA 2BCOA 1PCAA 2PJ1A 4DYOA 4J5RA 3BXMA 3WC6A 3IJ3A 2AFUA 5JM6A 3B3SA 1XFOA 2AFMA
chains in the Genus database with same CATH superfamily
4JWPA 4MCPA 4P4JA 2FL4A 2WUUA 2C27A 2NYQA 4MY0A 4MHZA 4X5KA 1XBUA 6CPAA 1AYEA 4ETKA 4MHPA 4B14A 5HVGA 3I3GA 4UIBA 4K3NA 4NGQA 2XEIA 3D68A 4CYOA 5DUSA 4Q36A 5IB0A 4F0YA 1ZO0A 2V8DA 4A31A 2JLMA 4NEXA 4M6GA 2Z3LA 4XPDC 4EMEA 3R9GA 5HH1A 3VWDA 4UA3A 1HJZA 1XJOA 4MCSA 4OADA 3BJ8A 3R9EA 3B3TA 4MRIA 4D86A 4DJLA 3ISZA 2FT0A 4A30A 2IL4A 1YVOA 3CT9A 4P44A 3DSBA 3KL9A 3FH4A 5KTDA 2IJZA 2PJ3A 3ISXA 5K8OA 3N5FA 1NSAA 4NJRA 3NE8A 2IQ6A 4JJXA 5DWMA 3JVNA 3V2BA 1CP7A 2B58A 4Q38A 4UFXA 4XNHB 5A27A 4A37A 1I1DA 4PPZA 4B5PB 4H6UA 3D7HA 4B5OA 2KCWA 4PXEA 3TCVA 1VKCA 2FVGA 2BFQA 3Q6ZA 2POKA 3FECA 3W6SA 4CPAA 4UMLA 3RZAA 3FX6A 1SQHA 1XOVA 4B12A 3GPQA 1BO4A 1JWQA 2V8HA 2HV2A 4MMOA 1KUYA 4I49A 3SIGA 3IO1A 3H8GA 3G3SA 4P4EA 3FB3A 1U6MA 3EWQA 2FE7A 2GLFA 2PVVA 4MXUA 3T9YA 4CYQA 2PR8A 4H89A 2Z11A 1TKFA 2PIZA 1Z8XA 2XEFA 2OZHA 3QAHA 4OC2A 3F5BA 4P4FA 1YMEA 2ARHA 2PQ8A 2VZYA 3EC4A 3FVLA 4C7HA 3B35A 5AG7A 2PC1A 4RUHA 2QIRA 4DUKA 4F8ZA 4F9UA 4CAFA 2DXQA 1YGHA 1Q7LA 1MK4A 4BD9A 4MHYA 4MHNA 1LRZA 2ZOGA 2DPTA 2D4OA 2DEAA 3QAYA 1YW4A 5ISVA 2QECA 1LANA 2WSAA 2R8VA 2PJ5A 4U9ZA 5AGEA 5LRGA 3K2KA 1MJ9A 3SXOA 2V8VA 4UEEA 2XEGA 2EEEA 2CTCA 1QQ9A 1DTDA 4OMEA 4Y49C 2QMLA 3SXNA 5J8FA 2P6EA 2PJ6A 5KTCA 1TKHA 3HUVA 5AILA 1YR0A 2GLJA 1KUXA 4HNXB 4CYNA 3T90A 5J8CA 2B3VA 4O23A 2WCTA 4PV6A 1IICA 3SIJA 1I21A 3ZZIA 4AXVA 3KI9A 4F0XA 2PSWA 5F49A 2P6GA 3CXSA 4NGPA 2ABZA 1AUGA 3WABA 3H5ZA 2PJBA 2WPWA 1FY7A 4L8AA 2C1CA 3RYOA 1ZG8A 2W2GA 3GPGA 5LYDA 4IAVA 2OU2A 2GFQA 2DX6A 1CP6A 2OB0A 1NSLA 4LX9A 4OC0A 1PUAA 2Q4YA 4MFQA 2Q7BA 4UCMA 7CPAA 1FNOA 3IWEA 3GQEA 1GHEA 4KS9A 4BINA 1CPSA 4OC4A 5G22A 4FD4A 4ONWA 4R6TA 2FIAA 3GUXA 4HNYB 2JBKA 2AFOA 2PVWA 3L2NA 1TXZA 2Z3MA 3MGDA 4HKFA 4KORA 1V0CA 5A28A 1S60A 2EWBA 3QNVA 4E2AA 2YGWA 3TO9A 1XRYA 1VHSA 2G0BA 2PR1A 2Q4VA 2QJ8A 3IWWA 4M85A 4CGPA 4UWIA 1Y0YA 5LYFA 5HIHA 1QSOA 2JBJA 4A33A 4KOYA 2P0WA 3FEEA 3IEHA 5EMIA 4FD6A 4U5YA 2FAVA 5JPHA 1F2PA 4ZYQA 4NGRA 4NFRA 1BPNA 3NE7A 3WR7A 2RNKA 5HVHA 2EK8A 1YVKA 5FSVA 5CNPA 4L89A 2AFCA 3R95A 1F57A 4LQGA 3VWEA 5JH9A 4KOWA 4GVVA 4KVXA 1LFWA 2FIWA 4XPKA 3IIDA 1IOFA 1I12A 3SJGA 1Z4EA 3PEIA 5HMNA 1XIXA 2XD7A 2VBQA 1CX8A 1KZFA 2PJ4A 4Z65A 1N71A 3TE4A 4X2TA 1IIDA 4KOSA 1B87A 2CNTA 5THWA 1VGYA 2RC4A 5E3BA 3FF3A 2FXFA 4OC3A 3RAMA 1FT7A 2FCKA 4NCZA 3TO6A 3V38A 3VARA 1ZLIA 3V45A 2ZW7A 5CBMA 5G21A 4R57A 2GE3A 4CGNA 5KTAA 2JZEA 3EWRA 2Q43A 4MHDA 1ZG9A 1X12A 4F9VA 2BFRA 1XE4A 3DR8A 3GQOA 1S7FA 3D7FA 1QSNA 1NJRA 1Z5RA 4W9YA 4MFPA 4MBUA 1VHEA 2A4NA 2C6CA 2CY2A 2VL1A 4OIWA 1IOIA 4J5SA 3DNSA 4M6HA 2CTBA 3NH8A 2NSMA 4NJQA 4KOXA 1XMBA 2PE3A 3WT4A 4QB9A 2AJ6A 2PJ9A 4A95A 2JEVA 2R1IA 3B3CA 1XMTA 4HNWB 3R9FA 2REFA 4FUUA 3TTHA 4B11A 4P4DA 1ELLP 1Y9WA 2J8NA 3RBUA 4MFZA 4OP4A 3JRUA 4EWTA 2ANPA 2I79A 1YLOA 4P4IA 1CG2A 4ZGYB 5F48A 5AG5A 4MCRA 2ZEEA 4KSIA 2K5TA 5HVFA 3SJFA 1QMUA 2Q51A 3EXNA 3CXQA 4XPDB 4UCPA 4JD6A 5J1QA 5I0CA 2PJAA 5H84A 5JGFA 1Q2CA 2V8GA 2ZEHA 3SJEA 2RB7A 1OZPA 3D7DA 3SHPA 1TKJA 2D4PA 5D29A 5FSYA 2EK9A 3RO0A 4KLWA 4E0AA 4B5PA 4YWYA 2ZEOA 4R9MA 4PSXA 4GXHA 3JZTA 4LQ6A 4BMHA 3B2YA 4NGSA 1F2OA 3P2HA 5F47A 3H8EA 3TX8A 3TT2A 2VXKA 4GM5A 1XF8A 2J8MA 4MFJA 3FBUA 5LYLA 1BAVA 3ZJ0A 1AMPA 3C26A 3SIIA 2ZEMA 3SI0A 1Y7RA 4CGMA 4ORFA 1HDUA 4QBJA 4KUBA 1Q2DA 2O53A 2KQVA 4X8IA 2O28A 4JVVA 4TNUA 4PK2A 2WZNA 4R3LA 3S6GA 4RS2A 4GVWA 2AFZA 3B3WA 8CPAA 3KR5A 1J4JA 5CB5A 2CNSA 2AFWA 3QB8A 4NGNA 4OKOA 5EC4A 4EVYA 2VQYA 3IC1A 2ZPAA 2Q04A 2FS5A 4CS0B 2ZXVA 2BSWA 2PRBA 3D8PA 2B4DA 3R1KA 2Q0YA 1L0CA 2VEZA 3DDDA 4NXYA 1Z8TA 4R76A 4UEZA 2EUIA 3T8WA 4TWEA 2Y0MA 4UIAA 5FSUA 3KR4A 2FXKA 3NA6A 4UCNA 2L8RA 3E0KA 4EFDA 4YU9A 4X3RA 2XEJA 3I1UA 4B6ZA 1R3NA 4CGOA 2HQYA 3HLPA 4C2YA 3LD2A 4AVCA 2PJ8A 4H2KA 3VH9A 5DS0A 5JQ4A 3IIBA 4WJBA 5GCNA 4A32A 1Z9UA 2B3UA 3PFEA 5LRKA 3FJUA 5F09A 4MJ8A 1RTQA 4KUAA 4JYWA 2ZEGA 2ODFA 1Z8WA 2I3CA 3EO4A 3DGVA 3SIHA 1YD9A 4MCQA 3DR6A 2VI7A 2FSRA 1PU9A 2F8HA 1MJBA 4CGLA 3P2FA 3PGPA 3GPOA 3EFAA 1M4DA 3IGRA 1QSRA 4F6AA 2B4BA 2B4DB 3V7ZA 2PJCA 3KQXA 2YNEA 2BOAA 2OR4A 4PXBA 3UY5A 2G9DA 4KZTA 4BBHA 5IV0A 4TU0A 2C6PA 4RN7A 3KHZA 3PP9A 4OAEA 4A2ZA 4C7IA 3GYAA 3K9UA 3SI1A 1Z4RA 4WWVA 1NMTA 2OH1A 3NH4A 5H86A 2ZW4A 3DLJA 1XEBA 2R98A 2YNCA 1RO5A 4P10A 3TO7A 4JZ0A 1S7LA 1Y7EA 3D2MA 4JLYA 4QUSA 3NH5A 1H8LA 2ZELA 3BHXA 4K30A 3Q71A 4ETJA 4KOUA 3BI0A 1EE3P 5LYIA 1ZR5A 3S6FA 3S9LA 1LCPA 1X10A 4UBRA 4NGMA 3BLNA 3D2PA 3NFZA 4UF4A 3N7ZA 1BOBA 1YQEA 3GLJA 5G1ZA 3GY9A 1IY7A 4YFJA 2BO9A 4KLVA 4KYBA 1A2ZA 4A94A 1IYKA 2G3TA 1ON0A 3SJXA 4CRZB 1S7NA 4IQYA 1ZR3A 1M4LA 4ZX8A 5EBVA 5E96A 2RFHA 3IU1A 2ATRA 2H5MA 1B6BA 1JQGA 4XPLA 3TC8A 1BPMA 5AG4A 3CPAA 2GREA 4CAVA 4PXDA 2Z10A 3F8KA 4A39A 2JZDA 2DPSA 4K0CA 1LAMA 2PJ0A 3A9LA 2IMOA 4J3GA 3IFEA 4XNHC 4ZBGA 3WC7A 3PBBA 2CIJA 3IU2A 2JZFA 2NMTA 1Z2LA 1IYLA 4IF5A 1S5KA 4NGTA 3JTKA 3KZWA 1Z8LA 3PB8X 2PRQA 3JUWA 3G8WA 5D8NA 1R43A 2WPXA 2DF5A 4AVAA 1YLEA 2EO8A 4G1PA 2VRIA 2CF4A 4UFVA 5CPAA 4CAEA 2F5IA 2CXAA 4Q7AA 4UWJA 3V8IA 1BLLE 2BL1A 3GIUA 4H6ZA 4ZI6A 3OWCA 3D3SA 2OZUA 3KASA 3PB9X 4P6YA 4C68A 3CXPA 3FYNA 1SPVA 4ZX9A 4PK3A 2R7HA 4P4BA 3FEDA 2ZEFA 4FAIA 3KKWA 3LODA 4KSFA 4IUSA 1S7KA 1R57A 4NF1A 4CAXA 5FSZA 3EJGA 1ZLHA 2B5GA 4FD7A 5CB3A 3KGQA 1KUVA 1UFHA 2PJ2A 2WYRA 5F46A 1VHOA 4ZY2A 3FIXA 4FWUA 4AG9A 4OIDA 1VIXA 1OBRA 1LAPA 2GU2A 2JDCA 3PZJA 3W91A 4OLLA 3S9NA 3PBEA 4U9YA 2F7VA 1HEEA 2BUEA 4FD5A 5FSXA 4R8FA 2OZGA 4KOTA 1IGBA 1KWMA 3S6HA 3KHXA 5IB9A 1YSJA 5IX3A 1Y0RA 5C88A 3S9MA 2G3AA 2ZEPA 3TOAA 3KQZA 1WK4A 4YGOA 4KOVA 3D67A 2C6GA 4MFLA 4CYPA 2REEA 4QC6A 2ZW6A 2AE6A 4PXCA 3PB4X 3EKEA 1CM0A 3B8GA 2J8RA 2B5GB 2AFXA 4JXQA 4LUAA 1YX0A 2Z3NA 1M44A 3D4UA 4P45A 2Q44A 3WC5A 4AVBA 4AG7A 1TF8A 4GUAA 2QYVA 1S3ZA 2Z3KA 3PB6X 3PRTA 1Q2YA 2QVPA 2ZEDA 3H4QA 4KVME 4C2XA 1QSMA 4J4ZA 2PJ7A 4HPSA 3GB0A 4AB7A 1M4IA 3TFYA 2BEIA 1UWYA 2VZZA 4KSAA 4JXRA 1ARLA 1TXRA 2HB6A 2Z3PA 5G20A 1YREA 2JEWA 5I4MA 3BI1A 4IK2A 2O4HA 4M3SA 3ETIA 4ABLA 4II9A 2GANA 3EW5A 2Q4ZA 5K8NA 4NSQA 1K4JA 4FBEA 3S6KA 3SI2A 3IIFA 5DWNA 5K8PA 1PYTB 3LWUA 2AFSA 1QSTA 2X47A 1YW6A 2I00A 3R96A 3EWPA 5CMSA 4ESSA 1ELMP 3BJ7A 4ABKA 4Y49B 3F0AA 3B7IA 4M6IA 2Q7SA 4YRHA 2FG1A 5K8MA 3H8FA 3I9SA 5HXDA 1Y9KA 5FVJA 2V77A 4MFKA 1CPXA 5ELYA 1ARMA 4OC5A 1NE9A 3IWGA 3B3VA 4OC1A 1DE4C 2PIYA 4A38A 3CZXA 2ACFA 3VATA 3FRMA 4R87A 1VHUA 3CPXA 3EJFA 1CJWA 1LOKA 1ZG7A 2X7BA 2ZOFA 4MY3A 4JGKA 1TIQA 4B13A 2GIVA 1TY8A 1IU8A 3EY5A 1M1DA 1M4GA 3MN8A 2EVNA 3PFOA 4PQAA 5HOLA 4RI1A 4UEFA 3VFQA 3FMCA 3LACA 5AG6A 3MRUA 3CDXA 5C82A 3EWOA 4R7MA 3W6XA 4MI4A 4DNCA 4GS4A 4ZY1A 4JCAA 1TF9A 4ZY0A 2PCUA 4C2ZA 4JLLA 3D7GA 4IHMA 4QVTA 2OOTA 4B10A 2Z0ZA 3D66A 1HDQA 1MJAA 4R3KA 2YNCC 2LGRA 3GKRA 5BWAB 2HUZA 3PB7X 4J5QA 3LMSA 1P4NA 3K9TA 3FNCA 4UFWA 2JDDA 4CAWA 2ZW5A 1P0HA 2YNDA 2J9AA 2CNMA 1WWZA 2PDOA 2ZENA 4PSWA 3TOBA 5LRJA 1GYTA 2HC9A 1CBXA 1RXTA 2Z3OA 1YK3A 1IB1E 2BCOA 4CRYB 1PCAA 2PJ1A 4DYOA 4J5RA 4E8OA 3BXMA 3FXTA 2EBJA 3WC6A 3RNZA 3IJ3A 2AFUA 5JM6A 4ONUA 3B3SA 1XFOA 4KVOE 2AFMA 2P6FA
chains in the Genus database with same CATH topology
4MCPA 4P4JA 2NYQA 4MHZA 6CPAA 1XBUA 1AYEA 4ETKA 4MHPA 5HVGA 4UIBA 4K3NA 4NGQA 2XEIA 3D68A 5DUSA 2V8DA 1HJZA 1XJOA 4MCSA 4DJLA 3B3TA 4MRIA 4D86A 3ISZA 3CT9A 4P44A 3KL9A 3FH4A 2IJZA 2PJ3A 3ISXA 5K8OA 3N5FA 1NSAA 4NJRA 2IQ6A 3V2BA 1CP7A 4A37A 4PPZA 3D7HA 4PXEA 2FVGA 2POKA 2BFQA 3Q6ZA 3FECA 4CPAA 4UMLA 3RZAA 3FX6A 3GPQA 2V8HA 4MMOA 3SIGA 3IO1A 3H8GA 4P4EA 4MXUA 3EWQA 2PVVA 2GLFA 1TKFA 2PIZA 2XEFA 4P4FA 4OC2A 1YMEA 3FVLA 3B35A 4RUHA 4DUKA 4F8ZA 4F9UA 1Q7LA 4BD9A 4MHYA 4MHNA 2ZOGA 2DEAA 1YW4A 1LANA 2PJ5A 5LRGA 3K2KA 2V8VA 4UEEA 2XEGA 2EEEA 2CTCA 1QQ9A 1DTDA 4OMEA 2PJ6A 1TKHA 3HUVA 5AILA 2GLJA 4O23A 3SIJA 4AXVA 3KI9A 4NGPA 2ABZA 3WABA 2PJBA 2C1CA 1ZG8A 3GPGA 5LYDA 4IAVA 2DX6A 1CP6A 4OC0A 7CPAA 1FNOA 3GQEA 1CPSA 4OC4A 4ONWA 4R6TA 3GUXA 2JBKA 2AFOA 2PVWA 3L2NA 1TXZA 2EWBA 3QNVA 1XRYA 2QJ8A 3IWWA 5LYFA 1Y0YA 5HIHA 2JBJA 3FEEA 3IEHA 2FAVA 1F2PA 4ZYQA 4NGRA 4NFRA 1BPNA 5HVHA 2EK8A 5FSVA 2AFCA 1F57A 4LQGA 5JH9A 4GVVA 1LFWA 3IIDA 3SJGA 3PEIA 2XD7A 1CX8A 2PJ4A 4Z65A 4X2TA 5THWA 1VGYA 3FF3A 5E3BA 3RAMA 4OC3A 3V38A 1FT7A 3VARA 1ZLIA 3V45A 5CBMA 3EWRA 2Q43A 1ZG9A 4F9VA 2BFRA 3GQOA 3D7FA 1NJRA 1Z5RA 4W9YA 1VHEA 2C6CA 2VL1A 4OIWA 4J5SA 2CTBA 3NH8A 2NSMA 4NJQA 1XMBA 2PE3A 3WT4A 2PJ9A 3B3CA 4FUUA 4P4DA 1ELLP 3RBUA 4OP4A 3JRUA 4EWTA 2ANPA 1YLOA 4P4IA 1CG2A 4MCRA 2ZEEA 4KSIA 5HVFA 3SJFA 1QMUA 2Q51A 5J1QA 5JGFA 2PJAA 2V8GA 2ZEHA 3SJEA 2RB7A 5K8NA 3D7DA 1TKJA 5D29A 5FSYA 2EK9A 4YWYA 2ZEOA 3JZTA 3B2YA 4NGSA 1F2OA 3H8EA 3TX8A 4GM5A 5LYLA 1BAVA 1AMPA 3SI0A 3SIIA 2ZEMA 1HDUA 2O53A 4X8IA 4JVVA 4TNUA 2WZNA 4GVWA 2AFZA 3B3WA 8CPAA 3KR5A 5CB5A 2AFWA 4NGNA 4OKOA 3IC1A 4TWEA 4R76A 4UEZA 4UIAA 3T8WA 5FSUA 3KR4A 2FXKA 3NA6A 2L8RA 4EFDA 4YU9A 4X3RA 2XEJA 3I1UA 4B6ZA 1R3NA 3HLPA 2PJ8A 4H2KA 3VH9A 5DS0A 3IIBA 4WJBA 3PFEA 5LRKA 3FJUA 1RTQA 4JYWA 2ZEGA 2I3CA 3DGVA 3SIHA 1YD9A 4MCQA 2F8HA 3GPOA 3V7ZA 2PJCA 3KQXA 2BOAA 2OR4A 4PXBA 2G9DA 4TU0A 2C6PA 3KHZA 3SI1A 4WWVA 3NH4A 3DLJA 4P10A 4JZ0A 1Y7EA 3NH5A 1H8LA 2ZELA 3BHXA 3Q71A 4ETJA 5LYIA 3BI0A 1EE3P 1ZR5A 3S9LA 1LCPA 4NGMA 3NFZA 4UF4A 3GLJA 1IY7A 2BO9A 4KYBA 4A94A 3SJXA 4IQYA 1ZR3A 1M4LA 4ZX8A 2RFHA 1JQGA 3TC8A 1BPMA 3CPAA 2GREA 4PXDA 4A39A 4K0CA 1LAMA 2PJ0A 3WC7A 2IMOA 3IFEA 3PBBA 2CIJA 1Z2LA 4NGTA 3KZWA 1Z8LA 3PB8X 2PRQA 5D8NA 1R43A 4G1PA 2VRIA 2CF4A 5CPAA 4Q7AA 1BLLE 4ZI6A 3PB9X 3KASA 4P6YA 1SPVA 4ZX9A 4P4BA 3FEDA 2ZEFA 4FAIA 5FSZA 3EJGA 1ZLHA 5CB3A 3KGQA 2PJ2A 2WYRA 1VHOA 4ZY2A 4FWUA 4OIDA 1VIXA 1OBRA 1LAPA 2GU2A 3S9NA 3PBEA 2F7VA 1HEEA 5FSXA 4R8FA 1IGBA 1KWMA 3KHXA 5IB9A 1YSJA 1Y0RA 3S9MA 2ZEPA 3KQZA 3D67A 2C6GA 4PXCA 3PB4X 3EKEA 2AFXA 3D4UA 4P45A 3WC5A 1TF8A 4GUAA 2QYVA 3PB6X 3PRTA 2QVPA 2ZEDA 4J4ZA 2PJ7A 3GB0A 1UWYA 1ARLA 1TXRA 2HB6A 5I4MA 2JEWA 3BI1A 4IK2A 2O4HA 3ETIA 4ABLA 3EW5A 2Q4ZA 4FBEA 3SI2A 3IIFA 5K8PA 1PYTB 3LWUA 2AFSA 2X47A 1YW6A 3EWPA 5CMSA 4ESSA 1ELMP 4ABKA 3B7IA 5K8MA 2FG1A 3H8FA 5HXDA 2V77A 1CPXA 5ELYA 1ARMA 4OC5A 3B3VA 4OC1A 1DE4C 2PIYA 4A38A 2ACFA 3VATA 1VHUA 3CPXA 3EJFA 1LOKA 1ZG7A 2ZOFA 4JGKA 3MN8A 1TY8A 3PFOA 4PQAA 4UEFA 5HOLA 5F09A 3VFQA 3FMCA 3MRUA 3CDXA 3EWOA 4R7MA 4ZY1A 4JCAA 1TF9A 4ZY0A 2PCUA 4JLLA 3D7GA 4IHMA 2OOTA 4EMEA 3D66A 1HDQA 2LGRA 3PB7X 4J5QA 3LMSA 3K9TA 2J9AA 2ZENA 5LRJA 1GYTA 2HC9A 1CBXA 2BCOA 1PCAA 2PJ1A 4DYOA 4J5RA 3BXMA 3WC6A 3IJ3A 2AFUA 5JM6A 3B3SA 1XFOA 2AFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MCP A;  4P4J A;  2NYQ A;  4MHZ A;  6CPA A;  1XBU A;  1AYE A;  4ETK A;  4MHP A;  5HVG A;  4UIB A;  4K3N A;  4NGQ A;  2XEI A;  3D68 A;  5DUS A;  2V8D A;  1HJZ A;  1XJO A;  4MCS A;  4DJL A;  3B3T A;  4MRI A;  4D86 A;  3ISZ A;  3CT9 A;  4P44 A;  3KL9 A;  3FH4 A;  2IJZ A;  2PJ3 A;  3ISX A;  5K8O A;  3N5F A;  1NSA A;  4NJR A;  2IQ6 A;  3V2B A;  1CP7 A;  4A37 A;  4PPZ A;  3D7H A;  4PXE A;  2FVG A;  2POK A;  2BFQ A;  3Q6Z A;  3FEC A;  4CPA A;  4UML A;  3RZA A;  3FX6 A;  3GPQ A;  2V8H A;  4MMO A;  3SIG A;  3IO1 A;  3H8G A;  4P4E A;  4MXU A;  3EWQ A;  2PVV A;  2GLF A;  1TKF A;  2PIZ A;  2XEF A;  4P4F A;  4OC2 A;  1YME A;  3FVL A;  3B35 A;  4RUH A;  4DUK A;  4F8Z A;  4F9U A;  1Q7L A;  4BD9 A;  4MHY A;  4MHN A;  2ZOG A;  2DEA A;  1YW4 A;  1LAN A;  2PJ5 A;  5LRG A;  3K2K A;  2V8V A;  4UEE A;  2XEG A;  2EEE A;  2CTC A;  1QQ9 A;  1DTD A;  4OME A;  2PJ6 A;  1TKH A;  3HUV A;  5AIL A;  2GLJ A;  4O23 A;  3SIJ A;  4AXV A;  3KI9 A;  4NGP A;  2ABZ A;  3WAB A;  2PJB A;  2C1C A;  1ZG8 A;  3GPG A;  5LYD A;  4IAV A;  2DX6 A;  1CP6 A;  4OC0 A;  7CPA A;  1FNO A;  3GQE A;  1CPS A;  4OC4 A;  4ONW A;  4R6T A;  3GUX A;  2JBK A;  2AFO A;  2PVW A;  3L2N A;  1TXZ A;  2EWB A;  3QNV A;  1XRY A;  2QJ8 A;  3IWW A;  5LYF A;  1Y0Y A;  5HIH A;  2JBJ A;  3FEE A;  3IEH A;  2FAV A;  1F2P A;  4ZYQ A;  4NGR A;  4NFR A;  1BPN A;  5HVH A;  2EK8 A;  5FSV A;  2AFC A;  1F57 A;  4LQG A;  5JH9 A;  4GVV A;  1LFW A;  3IID A;  3SJG A;  3PEI A;  2XD7 A;  1CX8 A;  2PJ4 A;  4Z65 A;  4X2T A;  5THW A;  1VGY A;  3FF3 A;  5E3B A;  3RAM A;  4OC3 A;  3V38 A;  1FT7 A;  3VAR A;  1ZLI A;  3V45 A;  5CBM A;  3EWR A;  2Q43 A;  1ZG9 A;  4F9V A;  2BFR A;  3GQO A;  3D7F A;  1NJR A;  1Z5R A;  4W9Y A;  1VHE A;  2C6C A;  2VL1 A;  4OIW A;  4J5S A;  2CTB A;  3NH8 A;  2NSM A;  4NJQ A;  1XMB A;  2PE3 A;  3WT4 A;  2PJ9 A;  3B3C A;  4FUU A;  4P4D A;  1ELL P;  3RBU A;  4OP4 A;  3JRU A;  4EWT A;  2ANP A;  1YLO A;  4P4I A;  1CG2 A;  4MCR A;  2ZEE A;  4KSI A;  5HVF A;  3SJF A;  1QMU A;  2Q51 A;  5J1Q A;  5JGF A;  2PJA A;  2V8G A;  2ZEH A;  3SJE A;  2RB7 A;  5K8N A;  3D7D A;  1TKJ A;  5D29 A;  5FSY A;  2EK9 A;  4YWY A;  2ZEO A;  3JZT A;  3B2Y A;  4NGS A;  1F2O A;  3H8E A;  3TX8 A;  4GM5 A;  5LYL A;  1BAV A;  1AMP A;  3SI0 A;  3SII A;  2ZEM A;  1HDU A;  2O53 A;  4X8I A;  4JVV A;  4TNU A;  2WZN A;  4GVW A;  2AFZ A;  3B3W A;  8CPA A;  3KR5 A;  5CB5 A;  2AFW A;  4NGN A;  4OKO A;  3IC1 A;  4TWE A;  4R76 A;  4UEZ A;  4UIA A;  3T8W A;  5FSU A;  3KR4 A;  2FXK A;  3NA6 A;  2L8R A;  4EFD A;  4YU9 A;  4X3R A;  2XEJ A;  3I1U A;  4B6Z A;  1R3N A;  3HLP A;  2PJ8 A;  4H2K A;  3VH9 A;  5DS0 A;  3IIB A;  4WJB A;  3PFE A;  5LRK A;  3FJU A;  1RTQ A;  4JYW A;  2ZEG A;  2I3C A;  3DGV A;  3SIH A;  1YD9 A;  4MCQ A;  2F8H A;  3GPO A;  3V7Z A;  2PJC A;  3KQX A;  2BOA A;  2OR4 A;  4PXB A;  2G9D A;  4TU0 A;  2C6P A;  3KHZ A;  3SI1 A;  4WWV A;  3NH4 A;  3DLJ A;  4P10 A;  4JZ0 A;  1Y7E A;  3NH5 A;  1H8L A;  2ZEL A;  3BHX A;  3Q71 A;  4ETJ A;  5LYI A;  3BI0 A;  1EE3 P;  1ZR5 A;  3S9L A;  1LCP A;  4NGM A;  3NFZ A;  4UF4 A;  3GLJ A;  1IY7 A;  2BO9 A;  4KYB A;  4A94 A;  3SJX A;  4IQY A;  1ZR3 A;  1M4L A;  4ZX8 A;  2RFH A;  1JQG A;  3TC8 A;  1BPM A;  3CPA A;  2GRE A;  4PXD A;  4A39 A;  4K0C A;  1LAM A;  2PJ0 A;  3WC7 A;  2IMO A;  3IFE A;  3PBB A;  2CIJ A;  1Z2L A;  4NGT A;  3KZW A;  1Z8L A;  3PB8 X;  2PRQ A;  5D8N A;  1R43 A;  4G1P A;  2VRI A;  2CF4 A;  5CPA A;  4Q7A A;  1BLL E;  4ZI6 A;  3PB9 X;  3KAS A;  4P6Y A;  1SPV A;  4ZX9 A;  4P4B A;  3FED A;  2ZEF A;  4FAI A;  5FSZ A;  3EJG A;  1ZLH A;  5CB3 A;  3KGQ A;  2PJ2 A;  2WYR A;  1VHO A;  4ZY2 A;  4FWU A;  4OID A;  1VIX A;  1OBR A;  1LAP A;  2GU2 A;  3S9N A;  3PBE A;  2F7V A;  1HEE A;  5FSX A;  4R8F A;  1IGB A;  1KWM A;  3KHX A;  5IB9 A;  1YSJ A;  1Y0R A;  3S9M A;  2ZEP A;  3KQZ A;  3D67 A;  2C6G A;  4PXC A;  3PB4 X;  3EKE A;  2AFX A;  3D4U A;  4P45 A;  3WC5 A;  1TF8 A;  4GUA A;  2QYV A;  3PB6 X;  3PRT A;  2QVP A;  2ZED A;  4J4Z A;  2PJ7 A;  3GB0 A;  1UWY A;  1ARL A;  1TXR A;  2HB6 A;  5I4M A;  2JEW A;  3BI1 A;  4IK2 A;  2O4H A;  3ETI A;  4ABL A;  3EW5 A;  2Q4Z A;  4FBE A;  3SI2 A;  3IIF A;  5K8P A;  1PYT B;  3LWU A;  2AFS A;  2X47 A;  1YW6 A;  3EWP A;  5CMS A;  4ESS A;  1ELM P;  4ABK A;  3B7I A;  5K8M A;  2FG1 A;  3H8F A;  5HXD A;  2V77 A;  1CPX A;  5ELY A;  1ARM A;  4OC5 A;  3B3V A;  4OC1 A;  1DE4 C;  2PIY A;  4A38 A;  2ACF A;  3VAT A;  1VHU A;  3CPX A;  3EJF A;  1LOK A;  1ZG7 A;  2ZOF A;  4JGK A;  3MN8 A;  1TY8 A;  3PFO A;  4PQA A;  4UEF A;  5HOL A;  5F09 A;  3VFQ A;  3FMC A;  3MRU A;  3CDX A;  3EWO A;  4R7M A;  4ZY1 A;  4JCA A;  1TF9 A;  4ZY0 A;  2PCU A;  4JLL A;  3D7G A;  4IHM A;  2OOT A;  4EME A;  3D66 A;  1HDQ A;  2LGR A;  3PB7 X;  4J5Q A;  3LMS A;  3K9T A;  2J9A A;  2ZEN A;  5LRJ A;  1GYT A;  2HC9 A;  1CBX A;  2BCO A;  1PCA A;  2PJ1 A;  4DYO A;  4J5R A;  3BXM A;  3WC6 A;  3IJ3 A;  2AFU A;  5JM6 A;  3B3S A;  1XFO A;  2AFM A; 
#chains in the Genus database with same CATH topology
 4JWP A;  4MCP A;  4P4J A;  2FL4 A;  2WUU A;  2C27 A;  2NYQ A;  4MY0 A;  4MHZ A;  4X5K A;  1XBU A;  6CPA A;  1AYE A;  4ETK A;  4MHP A;  4B14 A;  5HVG A;  3I3G A;  4UIB A;  4K3N A;  4NGQ A;  2XEI A;  3D68 A;  4CYO A;  5DUS A;  4Q36 A;  5IB0 A;  4F0Y A;  1ZO0 A;  2V8D A;  4A31 A;  2JLM A;  4NEX A;  4M6G A;  2Z3L A;  4XPD C;  4EME A;  3R9G A;  5HH1 A;  3VWD A;  4UA3 A;  1HJZ A;  1XJO A;  4MCS A;  4OAD A;  3BJ8 A;  3R9E A;  3B3T A;  4MRI A;  4D86 A;  4DJL A;  3ISZ A;  2FT0 A;  4A30 A;  2IL4 A;  1YVO A;  3CT9 A;  4P44 A;  3DSB A;  3KL9 A;  3FH4 A;  5KTD A;  2IJZ A;  2PJ3 A;  3ISX A;  5K8O A;  3N5F A;  1NSA A;  4NJR A;  3NE8 A;  2IQ6 A;  4JJX A;  5DWM A;  3JVN A;  3V2B A;  1CP7 A;  2B58 A;  4Q38 A;  4UFX A;  4XNH B;  5A27 A;  4A37 A;  1I1D A;  4PPZ A;  4B5P B;  4H6U A;  3D7H A;  4B5O A;  2KCW A;  4PXE A;  3TCV A;  1VKC A;  2FVG A;  2BFQ A;  3Q6Z A;  2POK A;  3FEC A;  3W6S A;  4CPA A;  4UML A;  3RZA A;  3FX6 A;  1SQH A;  1XOV A;  4B12 A;  3GPQ A;  1BO4 A;  1JWQ A;  2V8H A;  2HV2 A;  4MMO A;  1KUY A;  4I49 A;  3SIG A;  3IO1 A;  3H8G A;  3G3S A;  4P4E A;  3FB3 A;  1U6M A;  3EWQ A;  2FE7 A;  2GLF A;  2PVV A;  4MXU A;  3T9Y A;  4CYQ A;  2PR8 A;  4H89 A;  2Z11 A;  1TKF A;  2PIZ A;  1Z8X A;  2XEF A;  2OZH A;  3QAH A;  4OC2 A;  3F5B A;  4P4F A;  1YME A;  2ARH A;  2PQ8 A;  2VZY A;  3EC4 A;  3FVL A;  4C7H A;  3B35 A;  5AG7 A;  2PC1 A;  4RUH A;  2QIR A;  4DUK A;  4F8Z A;  4F9U A;  4CAF A;  2DXQ A;  1YGH A;  1Q7L A;  1MK4 A;  4BD9 A;  4MHY A;  4MHN A;  1LRZ A;  2ZOG A;  2DPT A;  2D4O A;  2DEA A;  3QAY A;  1YW4 A;  5ISV A;  2QEC A;  1LAN A;  2WSA A;  2R8V A;  2PJ5 A;  4U9Z A;  5AGE A;  5LRG A;  3K2K A;  1MJ9 A;  3SXO A;  2V8V A;  4UEE A;  2XEG A;  2EEE A;  2CTC A;  1QQ9 A;  1DTD A;  4OME A;  4Y49 C;  2QML A;  3SXN A;  5J8F A;  2P6E A;  2PJ6 A;  5KTC A;  1TKH A;  3HUV A;  5AIL A;  1YR0 A;  2GLJ A;  1KUX A;  4HNX B;  4CYN A;  3T90 A;  5J8C A;  2B3V A;  4O23 A;  2WCT A;  4PV6 A;  1IIC A;  3SIJ A;  1I21 A;  3ZZI A;  4AXV A;  3KI9 A;  4F0X A;  2PSW A;  5F49 A;  2P6G A;  3CXS A;  4NGP A;  2ABZ A;  1AUG A;  3WAB A;  3H5Z A;  2PJB A;  2WPW A;  1FY7 A;  4L8A A;  2C1C A;  3RYO A;  1ZG8 A;  2W2G A;  3GPG A;  5LYD A;  4IAV A;  2OU2 A;  2GFQ A;  2DX6 A;  1CP6 A;  2OB0 A;  1NSL A;  4LX9 A;  4OC0 A;  1PUA A;  2Q4Y A;  4MFQ A;  2Q7B A;  4UCM A;  7CPA A;  1FNO A;  3IWE A;  3GQE A;  1GHE A;  4KS9 A;  4BIN A;  1CPS A;  4OC4 A;  5G22 A;  4FD4 A;  4ONW A;  4R6T A;  2FIA A;  3GUX A;  4HNY B;  2JBK A;  2AFO A;  2PVW A;  3L2N A;  1TXZ A;  2Z3M A;  3MGD A;  4HKF A;  4KOR A;  1V0C A;  5A28 A;  1S60 A;  2EWB A;  3QNV A;  4E2A A;  2YGW A;  3TO9 A;  1XRY A;  1VHS A;  2G0B A;  2PR1 A;  2Q4V A;  2QJ8 A;  3IWW A;  4M85 A;  4CGP A;  4UWI A;  1Y0Y A;  5LYF A;  5HIH A;  1QSO A;  2JBJ A;  4A33 A;  4KOY A;  2P0W A;  3FEE A;  3IEH A;  5EMI A;  4FD6 A;  4U5Y A;  2FAV A;  5JPH A;  1F2P A;  4ZYQ A;  4NGR A;  4NFR A;  1BPN A;  3NE7 A;  3WR7 A;  2RNK A;  5HVH A;  2EK8 A;  1YVK A;  5FSV A;  5CNP A;  4L89 A;  2AFC A;  3R95 A;  1F57 A;  4LQG A;  3VWE A;  5JH9 A;  4KOW A;  4GVV A;  4KVX A;  1LFW A;  2FIW A;  4XPK A;  3IID A;  1IOF A;  1I12 A;  3SJG A;  1Z4E A;  3PEI A;  5HMN A;  1XIX A;  2XD7 A;  2VBQ A;  1CX8 A;  1KZF A;  2PJ4 A;  4Z65 A;  1N71 A;  3TE4 A;  4X2T A;  1IID A;  4KOS A;  1B87 A;  2CNT A;  5THW A;  1VGY A;  2RC4 A;  5E3B A;  3FF3 A;  2FXF A;  4OC3 A;  3RAM A;  1FT7 A;  2FCK A;  4NCZ A;  3TO6 A;  3V38 A;  3VAR A;  1ZLI A;  3V45 A;  2ZW7 A;  5CBM A;  5G21 A;  4R57 A;  2GE3 A;  4CGN A;  5KTA A;  2JZE A;  3EWR A;  2Q43 A;  4MHD A;  1ZG9 A;  1X12 A;  4F9V A;  2BFR A;  1XE4 A;  3DR8 A;  3GQO A;  1S7F A;  3D7F A;  1QSN A;  1NJR A;  1Z5R A;  4W9Y A;  4MFP A;  4MBU A;  1VHE A;  2A4N A;  2C6C A;  2CY2 A;  2VL1 A;  4OIW A;  1IOI A;  4J5S A;  3DNS A;  4M6H A;  2CTB A;  3NH8 A;  2NSM A;  4NJQ A;  4KOX A;  1XMB A;  2PE3 A;  3WT4 A;  4QB9 A;  2AJ6 A;  2PJ9 A;  4A95 A;  2JEV A;  2R1I A;  3B3C A;  1XMT A;  4HNW B;  3R9F A;  2REF A;  4FUU A;  3TTH A;  4B11 A;  4P4D A;  1ELL P;  1Y9W A;  2J8N A;  3RBU A;  4MFZ A;  4OP4 A;  3JRU A;  4EWT A;  2ANP A;  2I79 A;  1YLO A;  4P4I A;  1CG2 A;  4ZGY B;  5F48 A;  5AG5 A;  4MCR A;  2ZEE A;  4KSI A;  2K5T A;  5HVF A;  3SJF A;  1QMU A;  2Q51 A;  3EXN A;  3CXQ A;  4XPD B;  4UCP A;  4JD6 A;  5J1Q A;  5I0C A;  2PJA A;  5H84 A;  5JGF A;  1Q2C A;  2V8G A;  2ZEH A;  3SJE A;  2RB7 A;  1OZP A;  3D7D A;  3SHP A;  1TKJ A;  2D4P A;  5D29 A;  5FSY A;  2EK9 A;  3RO0 A;  4KLW A;  4E0A A;  4B5P A;  4YWY A;  2ZEO A;  4R9M A;  4PSX A;  4GXH A;  3JZT A;  4LQ6 A;  4BMH A;  3B2Y A;  4NGS A;  1F2O A;  3P2H A;  5F47 A;  3H8E A;  3TX8 A;  3TT2 A;  2VXK A;  4GM5 A;  1XF8 A;  2J8M A;  4MFJ A;  3FBU A;  5LYL A;  1BAV A;  3ZJ0 A;  1AMP A;  3C26 A;  3SII A;  2ZEM A;  3SI0 A;  1Y7R A;  4CGM A;  4ORF A;  1HDU A;  4QBJ A;  4KUB A;  1Q2D A;  2O53 A;  2KQV A;  4X8I A;  2O28 A;  4JVV A;  4TNU A;  4PK2 A;  2WZN A;  4R3L A;  3S6G A;  4RS2 A;  4GVW A;  2AFZ A;  3B3W A;  8CPA A;  3KR5 A;  1J4J A;  5CB5 A;  2CNS A;  2AFW A;  3QB8 A;  4NGN A;  4OKO A;  5EC4 A;  4EVY A;  2VQY A;  3IC1 A;  2ZPA A;  2Q04 A;  2FS5 A;  4CS0 B;  2ZXV A;  2BSW A;  2PRB A;  3D8P A;  2B4D A;  3R1K A;  2Q0Y A;  1L0C A;  2VEZ A;  3DDD A;  4NXY A;  1Z8T A;  4R76 A;  4UEZ A;  2EUI A;  3T8W A;  4TWE A;  2Y0M A;  4UIA A;  5FSU A;  3KR4 A;  2FXK A;  3NA6 A;  4UCN A;  2L8R A;  3E0K A;  4EFD A;  4YU9 A;  4X3R A;  2XEJ A;  3I1U A;  4B6Z A;  1R3N A;  4CGO A;  2HQY A;  3HLP A;  4C2Y A;  3LD2 A;  4AVC A;  2PJ8 A;  4H2K A;  3VH9 A;  5DS0 A;  5JQ4 A;  3IIB A;  4WJB A;  5GCN A;  4A32 A;  1Z9U A;  2B3U A;  3PFE A;  5LRK A;  3FJU A;  5F09 A;  4MJ8 A;  1RTQ A;  4KUA A;  4JYW A;  2ZEG A;  2ODF A;  1Z8W A;  2I3C A;  3EO4 A;  3DGV A;  3SIH A;  1YD9 A;  4MCQ A;  3DR6 A;  2VI7 A;  2FSR A;  1PU9 A;  2F8H A;  1MJB A;  4CGL A;  3P2F A;  3PGP A;  3GPO A;  3EFA A;  1M4D A;  3IGR A;  1QSR A;  4F6A A;  2B4B A;  2B4D B;  3V7Z A;  2PJC A;  3KQX A;  2YNE A;  2BOA A;  2OR4 A;  4PXB A;  3UY5 A;  2G9D A;  4KZT A;  4BBH A;  5IV0 A;  4TU0 A;  2C6P A;  4RN7 A;  3KHZ A;  3PP9 A;  4OAE A;  4A2Z A;  4C7I A;  3GYA A;  3K9U A;  3SI1 A;  1Z4R A;  4WWV A;  1NMT A;  2OH1 A;  3NH4 A;  5H86 A;  2ZW4 A;  3DLJ A;  1XEB A;  2R98 A;  2YNC A;  1RO5 A;  4P10 A;  3TO7 A;  4JZ0 A;  1S7L A;  1Y7E A;  3D2M A;  4JLY A;  4QUS A;  3NH5 A;  1H8L A;  2ZEL A;  3BHX A;  4K30 A;  3Q71 A;  4ETJ A;  4KOU A;  3BI0 A;  1EE3 P;  5LYI A;  1ZR5 A;  3S6F A;  3S9L A;  1LCP A;  1X10 A;  4UBR A;  4NGM A;  3BLN A;  3D2P A;  3NFZ A;  4UF4 A;  3N7Z A;  1BOB A;  1YQE A;  3GLJ A;  5G1Z A;  3GY9 A;  1IY7 A;  4YFJ A;  2BO9 A;  4KLV A;  4KYB A;  1A2Z A;  4A94 A;  1IYK A;  2G3T A;  1ON0 A;  3SJX A;  4CRZ B;  1S7N A;  4IQY A;  1ZR3 A;  1M4L A;  4ZX8 A;  5EBV A;  5E96 A;  2RFH A;  3IU1 A;  2ATR A;  2H5M A;  1B6B A;  1JQG A;  4XPL A;  3TC8 A;  1BPM A;  5AG4 A;  3CPA A;  2GRE A;  4CAV A;  4PXD A;  2Z10 A;  3F8K A;  4A39 A;  2JZD A;  2DPS A;  4K0C A;  1LAM A;  2PJ0 A;  3A9L A;  2IMO A;  4J3G A;  3IFE A;  4XNH C;  4ZBG A;  3WC7 A;  3PBB A;  2CIJ A;  3IU2 A;  2JZF A;  2NMT A;  1Z2L A;  1IYL A;  4IF5 A;  1S5K A;  4NGT A;  3JTK A;  3KZW A;  1Z8L A;  3PB8 X;  2PRQ A;  3JUW A;  3G8W A;  5D8N A;  1R43 A;  2WPX A;  2DF5 A;  4AVA A;  1YLE A;  2EO8 A;  4G1P A;  2VRI A;  2CF4 A;  4UFV A;  5CPA A;  4CAE A;  2F5I A;  2CXA A;  4Q7A A;  4UWJ A;  3V8I A;  1BLL E;  2BL1 A;  3GIU A;  4H6Z A;  4ZI6 A;  3OWC A;  3D3S A;  2OZU A;  3KAS A;  3PB9 X;  4P6Y A;  4C68 A;  3CXP A;  3FYN A;  1SPV A;  4ZX9 A;  4PK3 A;  2R7H A;  4P4B A;  3FED A;  2ZEF A;  4FAI A;  3KKW A;  3LOD A;  4KSF A;  4IUS A;  1S7K A;  1R57 A;  4NF1 A;  4CAX A;  5FSZ A;  3EJG A;  1ZLH A;  2B5G A;  4FD7 A;  5CB3 A;  3KGQ A;  1KUV A;  1UFH A;  2PJ2 A;  2WYR A;  5F46 A;  1VHO A;  4ZY2 A;  3FIX A;  4FWU A;  4AG9 A;  4OID A;  1VIX A;  1OBR A;  1LAP A;  2GU2 A;  2JDC A;  3PZJ A;  3W91 A;  4OLL A;  3S9N A;  3PBE A;  4U9Y A;  2F7V A;  1HEE A;  2BUE A;  4FD5 A;  5FSX A;  4R8F A;  2OZG A;  4KOT A;  1IGB A;  1KWM A;  3S6H A;  3KHX A;  5IB9 A;  1YSJ A;  5IX3 A;  1Y0R A;  5C88 A;  3S9M A;  2G3A A;  2ZEP A;  3TOA A;  3KQZ A;  1WK4 A;  4YGO A;  4KOV A;  3D67 A;  2C6G A;  4MFL A;  4CYP A;  2REE A;  4QC6 A;  2ZW6 A;  2AE6 A;  4PXC A;  3PB4 X;  3EKE A;  1CM0 A;  3B8G A;  2J8R A;  2B5G B;  2AFX A;  4JXQ A;  4LUA A;  1YX0 A;  2Z3N A;  1M44 A;  3D4U A;  4P45 A;  2Q44 A;  3WC5 A;  4AVB A;  4AG7 A;  1TF8 A;  4GUA A;  2QYV A;  1S3Z A;  2Z3K A;  3PB6 X;  3PRT A;  1Q2Y A;  2QVP A;  2ZED A;  3H4Q A;  4KVM E;  4C2X A;  1QSM A;  4J4Z A;  2PJ7 A;  4HPS A;  3GB0 A;  4AB7 A;  1M4I A;  3TFY A;  2BEI A;  1UWY A;  2VZZ A;  4KSA A;  4JXR A;  1ARL A;  1TXR A;  2HB6 A;  2Z3P A;  5G20 A;  1YRE A;  2JEW A;  5I4M A;  3BI1 A;  4IK2 A;  2O4H A;  4M3S A;  3ETI A;  4ABL A;  4II9 A;  2GAN A;  3EW5 A;  2Q4Z A;  5K8N A;  4NSQ A;  1K4J A;  4FBE A;  3S6K A;  3SI2 A;  3IIF A;  5DWN A;  5K8P A;  1PYT B;  3LWU A;  2AFS A;  1QST A;  2X47 A;  1YW6 A;  2I00 A;  3R96 A;  3EWP A;  5CMS A;  4ESS A;  1ELM P;  3BJ7 A;  4ABK A;  4Y49 B;  3F0A A;  3B7I A;  4M6I A;  2Q7S A;  4YRH A;  2FG1 A;  5K8M A;  3H8F A;  3I9S A;  5HXD A;  1Y9K A;  5FVJ A;  2V77 A;  4MFK A;  1CPX A;  5ELY A;  1ARM A;  4OC5 A;  1NE9 A;  3IWG A;  3B3V A;  4OC1 A;  1DE4 C;  2PIY A;  4A38 A;  3CZX A;  2ACF A;  3VAT A;  3FRM A;  4R87 A;  1VHU A;  3CPX A;  3EJF A;  1CJW A;  1LOK A;  1ZG7 A;  2X7B A;  2ZOF A;  4MY3 A;  4JGK A;  1TIQ A;  4B13 A;  2GIV A;  1TY8 A;  1IU8 A;  3EY5 A;  1M1D A;  1M4G A;  3MN8 A;  2EVN A;  3PFO A;  4PQA A;  5HOL A;  4RI1 A;  4UEF A;  3VFQ A;  3FMC A;  3LAC A;  5AG6 A;  3MRU A;  3CDX A;  5C82 A;  3EWO A;  4R7M A;  3W6X A;  4MI4 A;  4DNC A;  4GS4 A;  4ZY1 A;  4JCA A;  1TF9 A;  4ZY0 A;  2PCU A;  4C2Z A;  4JLL A;  3D7G A;  4IHM A;  4QVT A;  2OOT A;  4B10 A;  2Z0Z A;  3D66 A;  1HDQ A;  1MJA A;  4R3K A;  2YNC C;  2LGR A;  3GKR A;  5BWA B;  2HUZ A;  3PB7 X;  4J5Q A;  3LMS A;  1P4N A;  3K9T A;  3FNC A;  4UFW A;  2JDD A;  4CAW A;  2ZW5 A;  1P0H A;  2YND A;  2J9A A;  2CNM A;  1WWZ A;  2PDO A;  2ZEN A;  4PSW A;  3TOB A;  5LRJ A;  1GYT A;  2HC9 A;  1CBX A;  1RXT A;  2Z3O A;  1YK3 A;  1IB1 E;  2BCO A;  4CRY B;  1PCA A;  2PJ1 A;  4DYO A;  4J5R A;  4E8O A;  3BXM A;  3FXT A;  2EBJ A;  3WC6 A;  3RNZ A;  3IJ3 A;  2AFU A;  5JM6 A;  4ONU A;  3B3S A;  1XFO A;  4KVO E;  2AFM A;  2P6F A; 
#chains in the Genus database with same CATH homology
 4MCP A;  4P4J A;  2NYQ A;  4MHZ A;  6CPA A;  1XBU A;  1AYE A;  4ETK A;  4MHP A;  5HVG A;  4UIB A;  4K3N A;  4NGQ A;  2XEI A;  3D68 A;  5DUS A;  2V8D A;  1HJZ A;  1XJO A;  4MCS A;  4DJL A;  3B3T A;  4MRI A;  4D86 A;  3ISZ A;  3CT9 A;  4P44 A;  3KL9 A;  3FH4 A;  2IJZ A;  2PJ3 A;  3ISX A;  5K8O A;  3N5F A;  1NSA A;  4NJR A;  2IQ6 A;  3V2B A;  1CP7 A;  4A37 A;  4PPZ A;  3D7H A;  4PXE A;  2FVG A;  2POK A;  2BFQ A;  3Q6Z A;  3FEC A;  4CPA A;  4UML A;  3RZA A;  3FX6 A;  3GPQ A;  2V8H A;  4MMO A;  3SIG A;  3IO1 A;  3H8G A;  4P4E A;  4MXU A;  3EWQ A;  2PVV A;  2GLF A;  1TKF A;  2PIZ A;  2XEF A;  4P4F A;  4OC2 A;  1YME A;  3FVL A;  3B35 A;  4RUH A;  4DUK A;  4F8Z A;  4F9U A;  1Q7L A;  4BD9 A;  4MHY A;  4MHN A;  2ZOG A;  2DEA A;  1YW4 A;  1LAN A;  2PJ5 A;  5LRG A;  3K2K A;  2V8V A;  4UEE A;  2XEG A;  2EEE A;  2CTC A;  1QQ9 A;  1DTD A;  4OME A;  2PJ6 A;  1TKH A;  3HUV A;  5AIL A;  2GLJ A;  4O23 A;  3SIJ A;  4AXV A;  3KI9 A;  4NGP A;  2ABZ A;  3WAB A;  2PJB A;  2C1C A;  1ZG8 A;  3GPG A;  5LYD A;  4IAV A;  2DX6 A;  1CP6 A;  4OC0 A;  7CPA A;  1FNO A;  3GQE A;  1CPS A;  4OC4 A;  4ONW A;  4R6T A;  3GUX A;  2JBK A;  2AFO A;  2PVW A;  3L2N A;  1TXZ A;  2EWB A;  3QNV A;  1XRY A;  2QJ8 A;  3IWW A;  5LYF A;  1Y0Y A;  5HIH A;  2JBJ A;  3FEE A;  3IEH A;  2FAV A;  1F2P A;  4ZYQ A;  4NGR A;  4NFR A;  1BPN A;  5HVH A;  2EK8 A;  5FSV A;  2AFC A;  1F57 A;  4LQG A;  5JH9 A;  4GVV A;  1LFW A;  3IID A;  3SJG A;  3PEI A;  2XD7 A;  1CX8 A;  2PJ4 A;  4Z65 A;  4X2T A;  5THW A;  1VGY A;  3FF3 A;  5E3B A;  3RAM A;  4OC3 A;  3V38 A;  1FT7 A;  3VAR A;  1ZLI A;  3V45 A;  5CBM A;  3EWR A;  2Q43 A;  1ZG9 A;  4F9V A;  2BFR A;  3GQO A;  3D7F A;  1NJR A;  1Z5R A;  4W9Y A;  1VHE A;  2C6C A;  2VL1 A;  4OIW A;  4J5S A;  2CTB A;  3NH8 A;  2NSM A;  4NJQ A;  1XMB A;  2PE3 A;  3WT4 A;  2PJ9 A;  3B3C A;  4FUU A;  4P4D A;  1ELL P;  3RBU A;  4OP4 A;  3JRU A;  4EWT A;  2ANP A;  1YLO A;  4P4I A;  1CG2 A;  4MCR A;  2ZEE A;  4KSI A;  5HVF A;  3SJF A;  1QMU A;  2Q51 A;  5J1Q A;  5JGF A;  2PJA A;  2V8G A;  2ZEH A;  3SJE A;  2RB7 A;  5K8N A;  3D7D A;  1TKJ A;  5D29 A;  5FSY A;  2EK9 A;  4YWY A;  2ZEO A;  3JZT A;  3B2Y A;  4NGS A;  1F2O A;  3H8E A;  3TX8 A;  4GM5 A;  5LYL A;  1BAV A;  1AMP A;  3SI0 A;  3SII A;  2ZEM A;  1HDU A;  2O53 A;  4X8I A;  4JVV A;  4TNU A;  2WZN A;  4GVW A;  2AFZ A;  3B3W A;  8CPA A;  3KR5 A;  5CB5 A;  2AFW A;  4NGN A;  4OKO A;  3IC1 A;  4TWE A;  4R76 A;  4UEZ A;  4UIA A;  3T8W A;  5FSU A;  3KR4 A;  2FXK A;  3NA6 A;  2L8R A;  4EFD A;  4YU9 A;  4X3R A;  2XEJ A;  3I1U A;  4B6Z A;  1R3N A;  3HLP A;  2PJ8 A;  4H2K A;  3VH9 A;  5DS0 A;  3IIB A;  4WJB A;  3PFE A;  5LRK A;  3FJU A;  1RTQ A;  4JYW A;  2ZEG A;  2I3C A;  3DGV A;  3SIH A;  1YD9 A;  4MCQ A;  2F8H A;  3GPO A;  3V7Z A;  2PJC A;  3KQX A;  2BOA A;  2OR4 A;  4PXB A;  2G9D A;  4TU0 A;  2C6P A;  3KHZ A;  3SI1 A;  4WWV A;  3NH4 A;  3DLJ A;  4P10 A;  4JZ0 A;  1Y7E A;  3NH5 A;  1H8L A;  2ZEL A;  3BHX A;  3Q71 A;  4ETJ A;  5LYI A;  3BI0 A;  1EE3 P;  1ZR5 A;  3S9L A;  1LCP A;  4NGM A;  3NFZ A;  4UF4 A;  3GLJ A;  1IY7 A;  2BO9 A;  4KYB A;  4A94 A;  3SJX A;  4IQY A;  1ZR3 A;  1M4L A;  4ZX8 A;  2RFH A;  1JQG A;  3TC8 A;  1BPM A;  3CPA A;  2GRE A;  4PXD A;  4A39 A;  4K0C A;  1LAM A;  2PJ0 A;  3WC7 A;  2IMO A;  3IFE A;  3PBB A;  2CIJ A;  1Z2L A;  4NGT A;  3KZW A;  1Z8L A;  3PB8 X;  2PRQ A;  5D8N A;  1R43 A;  4G1P A;  2VRI A;  2CF4 A;  5CPA A;  4Q7A A;  1BLL E;  4ZI6 A;  3PB9 X;  3KAS A;  4P6Y A;  1SPV A;  4ZX9 A;  4P4B A;  3FED A;  2ZEF A;  4FAI A;  5FSZ A;  3EJG A;  1ZLH A;  5CB3 A;  3KGQ A;  2PJ2 A;  2WYR A;  1VHO A;  4ZY2 A;  4FWU A;  4OID A;  1VIX A;  1OBR A;  1LAP A;  2GU2 A;  3S9N A;  3PBE A;  2F7V A;  1HEE A;  5FSX A;  4R8F A;  1IGB A;  1KWM A;  3KHX A;  5IB9 A;  1YSJ A;  1Y0R A;  3S9M A;  2ZEP A;  3KQZ A;  3D67 A;  2C6G A;  4PXC A;  3PB4 X;  3EKE A;  2AFX A;  3D4U A;  4P45 A;  3WC5 A;  1TF8 A;  4GUA A;  2QYV A;  3PB6 X;  3PRT A;  2QVP A;  2ZED A;  4J4Z A;  2PJ7 A;  3GB0 A;  1UWY A;  1ARL A;  1TXR A;  2HB6 A;  5I4M A;  2JEW A;  3BI1 A;  4IK2 A;  2O4H A;  3ETI A;  4ABL A;  3EW5 A;  2Q4Z A;  4FBE A;  3SI2 A;  3IIF A;  5K8P A;  1PYT B;  3LWU A;  2AFS A;  2X47 A;  1YW6 A;  3EWP A;  5CMS A;  4ESS A;  1ELM P;  4ABK A;  3B7I A;  5K8M A;  2FG1 A;  3H8F A;  5HXD A;  2V77 A;  1CPX A;  5ELY A;  1ARM A;  4OC5 A;  3B3V A;  4OC1 A;  1DE4 C;  2PIY A;  4A38 A;  2ACF A;  3VAT A;  1VHU A;  3CPX A;  3EJF A;  1LOK A;  1ZG7 A;  2ZOF A;  4JGK A;  3MN8 A;  1TY8 A;  3PFO A;  4PQA A;  4UEF A;  5HOL A;  5F09 A;  3VFQ A;  3FMC A;  3MRU A;  3CDX A;  3EWO A;  4R7M A;  4ZY1 A;  4JCA A;  1TF9 A;  4ZY0 A;  2PCU A;  4JLL A;  3D7G A;  4IHM A;  2OOT A;  4EME A;  3D66 A;  1HDQ A;  2LGR A;  3PB7 X;  4J5Q A;  3LMS A;  3K9T A;  2J9A A;  2ZEN A;  5LRJ A;  1GYT A;  2HC9 A;  1CBX A;  2BCO A;  1PCA A;  2PJ1 A;  4DYO A;  4J5R A;  3BXM A;  3WC6 A;  3IJ3 A;  2AFU A;  5JM6 A;  3B3S A;  1XFO A;  2AFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...