4ZX9A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10b
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
519
structure length
519
Chain Sequence
b'ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable M17 family aminopeptidase
molecule tags Hydrolase/hydrolase inhibitor
source organism Plasmodium falciparum fcb1/columbia
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
total genus 176
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zx9A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zx9A02
2PIYA 4OC3A 2V8VA 4PPZA 2C1CA 2EK8A 3KR4A 5K8OA 5K8PA 4UEEA 3V45A 5HIHA 5F09A 1Y0YA 3KQXA 3V38A 3BHXA 1TY8A 4J5SA 7CPAA 2PJCA 3CDXA 1LFWA 3NA6A 3KZWA 1LOKA 4Q7AA 4EWTA 1NSAA 3SJGA 1BLLE 3FVLA 1TKFA 3FF3A 3TC8A 4KSIA 3KI9A 4FWUA 1XMBA 1YMEA 4YWYA 3LWUA 3HUVA 5I4MA 4KYBA 1KWMA 3D7DA 5HVFA 3EWPA 2HC9A 1CP7A 1IY7A 3D4UA 3GQOA 1YW4A 1ZR5A 1HDUA 4ONWA 4MMOA 4A37A 5LRKA 2BOAA 1M4LA 3WC5A 4DJLA 1LANA 3PB7X 5LRGA 5FSUA 1XFOA 3EWRA 4OC1A 1DE4C 2PJ4A 4UEFA 1VHUA 4ESSA 2G9DA 4IHMA 4JZ0A 3B2YA 3CT9A 3FEDA 3WC6A 3KQZA 3ETIA 2JEWA 3SIGA 3BI0A 4MXUA 4PXBA 2PJ3A 5HXDA 2V77A 5LYDA 1YW6A 4NGQA 4GVVA 3V2BA 2JBKA 4MHZA 5THWA 1Z5RA 1IGBA 2VRIA 1ZR3A 3B3SA 4J5QA 3FECA 1BPNA 1LAPA 4J5RA 4ETKA 1ELLP 3LMSA 2L8RA 3I1UA 1CPXA 4NFRA 1RTQA 2C6CA 3B3VA 2PJ1A 3IJ3A 1JQGA 3BI1A 3SI2A 2C6PA 2PRQA 3K9TA 1CX8A 1F2PA 3D7HA 5HOLA 4PXEA 3DGVA 4MHYA 3H8GA 2PJBA 3FX6A 1TXRA 3GLJA 1HJZA 2PJ7A 3D68A 4NGTA 3WT4A 3B3CA 1ARMA 1NJRA 2LGRA 3D7FA 4MHNA 1TF9A 3GB0A 3B3WA 3VARA 4A38A 3EJGA 1DTDA 3SIJA 1ZLHA 4WWVA 3D66A 1ARLA 3DLJA 2FXKA 2PIZA 1YSJA 3KHXA 3PFEA 3S9MA 4OKOA 3RZAA 5LYFA 1PYTB 3GPQA 4A94A 4MCPA 1FNOA 2GLJA 4F8ZA 3Q6ZA 3GPOA 5K8MA 3PFOA 4OMEA 2V8DA 1R43A 5CBMA 1EE3P 4AXVA 5E3BA 3PB8X 3PB9X 2ZEMA 4LQGA 3V7ZA 3VATA 1LAMA 2IJZA 2EWBA 4MRIA 3ISXA 1BAVA 3MRUA 2VL1A 4TWEA 2GU2A 3IIBA 4MCRA 2PJ9A 2I3CA 4P10A 2PJ0A 3KASA 3H8EA 1BPMA 2AFCA 4JVVA 4NGPA 4P6YA 2PJ2A 3IO1A 1VHOA 2ABZA 2PVVA 3VFQA 4MCSA 3B3TA 4NJRA 4ZY2A 3IIDA 3IWWA 3SI1A 5HVHA 1Z2LA 4ABLA 1VGYA 1TKJA 1OBRA 4EFDA 3FMCA 1H8LA 2ANPA 1YLOA 2AFXA 4P4FA 2DEAA 4ZY0A 5ELYA 2BFQA 2AFWA 3PEIA 2IQ6A 3CPAA 2CF4A 3KR5A 1UWYA 5JH9A 1XBUA 4PXCA 5CMSA 4H2KA 3IIFA 2EK9A 4UIBA 2XEGA 4UF4A 4P4IA 3L2NA 2ZEEA 3EWOA 3WABA 4NGRA 4ZI6A 3EJFA 5FSXA 4NJQA 5AILA 4W9YA 2ZEDA 4JCAA 3NH8A 3FJUA 3QNVA 4BD9A 2ZENA 2XEIA 4X8IA 3NH4A 4K3NA 3GUXA 2ZOFA 3IC1A 1SPVA 2O53A 3K2KA 4PXDA 3PB6X 4DYOA 1GYTA 4ZX9A 1ZG9A 2OR4A 3RAMA 2X47A 3IEHA 5HVGA 3PBEA 2O4HA 4X3RA 4P44A 4IQYA 4ZY1A 1ELMP 1F2OA 4MHPA 2BO9A 1LCPA 4GM5A 2AFOA 3TX8A 4J4ZA 4F9VA 2QVPA 3EW5A 2ACFA 2F7VA 3JZTA 1AYEA 3KHZA 2BCOA 1QQ9A 5LYIA 5DS0A 1F57A 4D86A 4ZYQA 2QYVA 2ZELA 2C6GA 4ABKA 8CPAA 2V8GA 2GREA 3FH4A 4R6TA 2J9AA 5CB3A 4OP4A 4OC4A 2EEEA 3NFZA 4B6ZA 4RUHA 3IFEA 4CPAA 2PJ6A 3SI0A 4R7MA 5K8NA 5FSZA 1CBXA 2BFRA 4P4BA 2PJ5A 2NSMA 4GUAA 1XRYA 1VHEA 4R8FA 5LRJA 5JM6A 2Q51A 2AFSA 2XD7A 4FBEA 2ZEOA 3GPGA 5CB5A 4YU9A 2F8HA 4MCQA 3EWQA 3H8FA 2ZEPA 1Y0RA 2ZOGA 4NGSA 4ETJA 4UEZA 1PCAA 3Q71A 4OC0A 4TU0A 3PBBA 3RBUA 5D29A 3S9LA 3PRTA 5IB9A 1R3NA 1XJOA 4UIAA 4Z65A 2WYRA 3PB4X 1ZLIA 1Y7EA 2PJ8A 3FEEA 4OC5A 2HB6A 2V8HA 3D7GA 5DUSA 1HEEA 4P45A 4ZX8A 3B7IA 1AMPA 4OC2A 2RFHA 4OIWA 3S9NA 3N5FA 4A39A 2JBJA 1ZG7A 1VIXA 3SIIA 1CG2A 2Q43A 4WJBA 2ZEFA 4IK2A 4GVWA 1CPSA 5CPAA 3KGQA 2CTCA 3NH5A 4PQAA 5JGFA 3SIHA 4TNUA 1FT7A 1TF8A 2AFUA 4P4DA 3D67A 3MN8A 4G1PA 2AFZA 4FUUA 2AFMA 2WZNA 3HLPA 2OOTA 2CIJA 2PCUA 4EMEA 3T8WA 2DX6A 3EKEA 1HDQA 2FG1A 2NYQA 2PJAA 4P4JA 4O23A 5FSVA 3ISZA 1Z8LA 4JLLA 1YD9A 2RB7A 3SJEA 2PE3A 1CP6A 1ZG8A 2PVWA 2XEJA 3B35A 3BXMA 2CTBA 4NGNA 2XEFA 4JGKA 4K0CA 3VH9A 2IMOA 3KL9A 2FAVA 4FAIA 5LYLA 3WC7A 2POKA 2QJ8A 1QMUA 3SJXA 4X2TA 3SJFA 5J1QA 4JYWA 1Q7LA 4OIDA 3JRUA 2Q4ZA 5D8NA 4NGMA 5FSYA 2FVGA 4IAVA 3GQEA 6CPAA 4F9UA 4R76A 4P4EA 3CPXA 2GLFA 1TXZA 1TKHA 2ZEHA 4DUKA 2ZEGA 4UMLA
chains in the Genus database with same CATH superfamily
2PIYA 4OC3A 2G3AA 2VXKA 4IUSA 4UFVA 3GY9A 3QB8A 2PSWA 1YVKA 2V8VA 4MFLA 3ZZIA 4CAXA 2OZHA 1IYLA 4PPZA 4CS0B 2C1CA 4F0XA 1QSMA 4KVOE 2EK8A 5AG6A 4PK2A 3KR4A 1YR0A 5K8OA 5K8PA 4UEEA 3V45A 4A2ZA 1S5KA 4L8AA 2WCTA 5HIHA 2Q0YA 4NXYA 3K9UA 2EUIA 1P0HA 4HNYB 1I1DA 5F09A 4KOVA 2B3VA 1Y0YA 3I9SA 3WR7A 3KQXA 4F6AA 3C26A 3V38A 2I79A 1PUAA 3BHXA 1TY8A 2CY2A 1NMTA 4J5SA 2FCKA 1WK4A 1A2ZA 7CPAA 1S60A 2PJCA 3CDXA 4Y49C 1LFWA 3NA6A 3KZWA 4JXQA 1YQEA 4CAVA 4PK3A 1LOKA 2B5GB 4LX9A 4Q7AA 3TO9A 4EWTA 5BWAB 1NSAA 3NE7A 3SJGA 1WWZA 4CYPA 1BLLE 3FVLA 3PGPA 1RO5A 1TKFA 2VBQA 3FF3A 3TC8A 3S6HA 4KSIA 3KI9A 4FWUA 1XMBA 1YMEA 2P6EA 4YWYA 3LODA 3LWUA 3JUWA 5G20A 3HUVA 4BBHA 5I4MA 4E0AA 3N7ZA 4MI4A 4KYBA 1MK4A 1KWMA 4CYOA 2PR1A 1R57A 3D7DA 2KQVA 2NMTA 5HVFA 4R9MA 3CXSA 4A31A 5JQ4A 2J8MA 4R87A 2QECA 1M4IA 2Y0MA 2YNEA 3EWPA 2GIVA 4MFQA 2HC9A 1S7NA 3BJ8A 1CP7A 1IY7A 3D4UA 3GQOA 1S7KA 1YW4A 4LQ6A 1ZR5A 2FSRA 3D2MA 1HDUA 4ONWA 3FB3A 4YGOA 5I0CA 4MMOA 2R8VA 3EFAA 4A37A 2B58A 1SQHA 5LRKA 3DSBA 2BOAA 1M4LA 5A27A 3WC5A 4UFWA 1LANA 1M1DA 3D8PA 3PB7X 4R57A 5FSUA 1XFOA 3IGRA 5LRGA 3V8IA 3EWRA 4OC1A 1DE4C 1X12A 3IU1A 1KZFA 3MGDA 4FD4A 2PJ4A 4JLYA 4NSQA 4UEFA 4XPDB 3R96A 1VHUA 4ESSA 4UA3A 1XF8A 2I00A 2G9DA 4IHMA 4JZ0A 2AE6A 1XEBA 2Z0ZA 1S7LA 3B2YA 2FIWA 3CT9A 3FEDA 3WC6A 3KQZA 3ETIA 2D4PA 3SIGA 2JEWA 2YNCA 3BI0A 2PJ3A 2ZXVA 2B4BA 2Z3MA 4KZTA 4MXUA 4PXBA 4U9YA 4CYQA 2V77A 4RN7A 2GANA 5LYDA 4ONUA 2FS5A 1YW6A 5AG4A 5G1ZA 3VWEA 2D4OA 1S3ZA 4NGQA 3R95A 5IB0A 4GVVA 3V2BA 2JBKA 2OZGA 4MHZA 2Z3NA 4QC6A 4KSFA 1Z5RA 1IGBA 3D3SA 5THWA 4JJXA 1B87A 2VRIA 2J8RA 4MY3A 4R3LA 1ZR3A 3B3SA 4KOTA 4UCPA 2EVNA 4J5QA 1BPNA 3FECA 1LAPA 4HKFA 2G3TA 4J5RA 4ETKA 2ARHA 3TO7A 1ELLP 1OZPA 1YLEA 3LMSA 4UWIA 2L8RA 3SXOA 3FYNA 3I1UA 2F5IA 1CPXA 4NFRA 1RTQA 2C6CA 3B3VA 3SHPA 2PJ1A 1RXTA 4AVAA 3IJ3A 3W6XA 3G8WA 1JQGA 5G22A 3TOAA 3BI1A 3SI2A 2C6PA 4M85A 2PRQA 2WUUA 1Y9KA 4M6GA 4RS2A 4JD6A 2Z3KA 3DR8A 1YVOA 4RI1A 1TIQA 4BMHA 2REFA 3K9TA 4C68A 1CX8A 1F2PA 3D7HA 5HOLA 4PXEA 2Q4VA 5A28A 4FD5A 3DGVA 4MHYA 1K4JA 2A4NA 4MFZA 4UWJA 3H8GA 2ODFA 3SXNA 4A32A 2PJBA 3R9FA 4KUBA 5F48A 2OH1A 2DXQA 4E2AA 3FX6A 1TXRA 3GLJA 3QAYA 1HJZA 3UY5A 2PJ7A 3D68A 4KLVA 4NGTA 3WT4A 1BO4A 1CJWA 3B3CA 3CXQA 4BINA 1ARMA 1NJRA 2LGRA 3D7FA 4MHNA 1TF9A 3GB0A 3CXPA 1XOVA 3B3WA 3VARA 4FD7A 4A38A 4C7IA 3EJGA 3G3SA 3BJ7A 4GXHA 5E96A 3H5ZA 4R3KA 1DTDA 3SIJA 1ZLHA 2Q04A 4WWVA 3TTHA 2W2GA 2YNCC 3D66A 1IOFA 2VZYA 1ARLA 2C27A 1IYKA 3DLJA 4EVYA 2ATRA 2CNMA 1M44A 4MFPA 2FXKA 2PIZA 1IU8A 1YSJA 3KHXA 3PFEA 4MHDA 3S9MA 4CGOA 4OKOA 3RZAA 5IV0A 4H89A 5LYFA 3TCVA 3D2PA 3S6KA 4B10A 1PYTB 2AJ6A 3GPQA 4A94A 4CGMA 2R98A 3H4QA 4MCPA 2Z10A 3FBUA 3EO4A 1FNOA 2GLJA 2BL1A 4F8ZA 3Q6ZA 5EMIA 4A95A 3GPOA 5G21A 5K8MA 2REEA 2IL4A 3PFOA 4PSXA 1XIXA 4YRHA 2BUEA 4OMEA 5AG5A 2GE3A 2V8DA 4A33A 1R43A 5CBMA 1EE3P 5KTDA 3B8GA 4AXVA 5E3BA 3PB8X 3PB9X 1QSNA 2ZEMA 4LQGA 3V7ZA 3VATA 1IOIA 3VWDA 2VQYA 1LAMA 2IJZA 2EWBA 2YNDA 1X10A 4MRIA 1GHEA 1BAVA 3ISXA 4AB7A 3MRUA 2VL1A 4TWEA 2GU2A 4HPSA 2ZW7A 4KLWA 4KVME 2FIAA 3IIBA 4MCRA 1VKCA 4UCMA 2PJ9A 3PP9A 1KUXA 4XNHC 4AVBA 2I3CA 3TE4A 4PV6A 4X5KA 1IICA 5DWMA 4MFKA 3P2HA 4P10A 4K30A 1KUVA 2OZUA 4M3SA 2PJ0A 4UFXA 4C7HA 3KASA 3H8EA 1BPMA 4QUSA 5C82A 4U5YA 2AFCA 2JZEA 4JVVA 4NGPA 4QBJA 2JDCA 4P6YA 2PJ2A 3IO1A 1Q2CA 1Z8WA 1VHOA 2ABZA 2PVVA 3VFQA 4MCSA 3B3TA 4NJRA 4OAEA 4ZY2A 3NE8A 2K5TA 3IIDA 4FD6A 3IWWA 3SI1A 5HVHA 4L89A 1Z2LA 4M6IA 4ABLA 1J4JA 1VGYA 1BOBA 1YREA 2Z11A 1B6BA 2PQ8A 2H5MA 2GFQA 5F49A 4YFJA 4PSWA 4CRYB 3GYAA 3LACA 1TKJA 1OBRA 4EFDA 4MBUA 1Y9WA 1KUYA 2R1IA 3FMCA 2WPXA 1H8LA 2ANPA 1YLOA 2AFXA 4P4FA 3TT2A 2DEAA 4Y49B 4ZY0A 3F0AA 5ELYA 2BFQA 2AFWA 3PEIA 2IQ6A 3CPAA 2CF4A 3FXTA 2B5GA 1ON0A 3KR5A 2DPTA 1UWYA 5JH9A 3BLNA 3OWCA 1XBUA 1Z9UA 4PXCA 5CMSA 4H2KA 3IIFA 2EK9A 3FIXA 4MY0A 4UCNA 4UIBA 2XEGA 4UF4A 4P4IA 3TFYA 2J8NA 2ZEEA 2RNKA 3L2NA 1MJAA 3EWOA 3WABA 4NGRA 4ZI6A 4XPLA 3EJFA 5FSXA 4NJQA 5AILA 2VI7A 4KOXA 2P0WA 2Z3PA 4W9YA 5HH1A 4NCZA 2ZEDA 4JCAA 3NH8A 3FJUA 1Z4RA 3IWGA 3QNVA 3DR6A 4JWPA 4BD9A 2ZENA 4MJ8A 2XEIA 4X8IA 3W91A 3NH4A 4K3NA 3GUXA 2ZOFA 3IC1A 1SPVA 4H6UA 2O53A 3K2KA 2VEZA 2WSAA 4PXDA 3PB6X 4DYOA 1GYTA 4ZX9A 1FY7A 1PU9A 1ZG9A 2OR4A 3RAMA 2KCWA 2X47A 3IEHA 5HVGA 3PBEA 1IB1E 2O4HA 3F5BA 4HNWB 4X3RA 4P44A 3T9YA 4IQYA 5J8CA 4ZY1A 1ELMP 1Z8TA 3S6GA 5AGEA 1F2OA 1LRZA 2BO9A 4MHPA 4OLLA 1LCPA 2B4DB 4GM5A 2AFOA 4IF5A 4J4ZA 5CNPA 5GCNA 4KSAA 3R9EA 3TX8A 5J8FA 5ISVA 4OADA 4B13A 4F9VA 2QVPA 4AG7A 4UBRA 4F0YA 4ZGYB 1P4NA 3EW5A 2ACFA 2F7VA 3JZTA 4I49A 1AYEA 4E8OA 3KHZA 1AUGA 2BCOA 1QQ9A 2HQYA 5AG7A 5LYIA 5DS0A 1F57A 4D86A 4ZYQA 2QYVA 3PZJA 3RO0A 2R7HA 2ZELA 2C6GA 4ABKA 3EXNA 2V8GA 8CPAA 1QSTA 2EO8A 2JZDA 2GREA 3FH4A 2QMLA 4KOYA 3RYOA 4R6TA 2PR8A 2Z3OA 2J9AA 3EY5A 3QAHA 4C2ZA 5CB3A 4OP4A 4OC4A 2P6GA 2EEEA 3NFZA 1S7FA 4B6ZA 5EC4A 4DJLA 2WPWA 3IFEA 4RUHA 4CPAA 2PJ6A 3SI0A 3KKWA 2FT0A 5F47A 4R7MA 3S6FA 5K8NA 5FSZA 1QSOA 1Z8XA 1CBXA 2BFRA 2FL4A 4P4BA 4XPDC 2PJ5A 2NSMA 4GUAA 1XRYA 1VHEA 4R8FA 5LRJA 5JM6A 2Q51A 2AFSA 1V0CA 2XD7A 4FBEA 3W6SA 2ZEOA 3GPGA 1MJ9A 4Q36A 5CB5A 4YU9A 2JZFA 3JVNA 2F8HA 4ORFA 2QIRA 2B4DA 4MCQA 4Q38A 3EWQA 1QSRA 3H8FA 2ZEPA 3EC4A 1Y0RA 2ZOGA 3FNCA 3R1KA 4ETJA 4NGSA 4AG9A 1VHSA 2G0BA 4UEZA 4ZBGA 1PCAA 2DF5A 3Q71A 4OC0A 2O28A 4B14A 4TU0A 3PBBA 4CAFA 5EBVA 3RBUA 5D29A 1YK3A 2ZW5A 3S9LA 2CNSA 2X7BA 1IIDA 2BEIA 4A30A 3PRTA 5IB9A 1R3NA 1XJOA 4UIAA 4Z65A 2WYRA 4CRZB 3PB4X 1ZLIA 4KORA 1Y7EA 2PJ8A 4KUAA 3FEEA 4OC5A 2HB6A 2OB0A 4XPKA 2V8HA 3D7GA 1M4GA 5DUSA 1HEEA 4LUAA 4P45A 3TOBA 4ZX8A 3B7IA 1AMPA 4OC2A 4B5OA 2RFHA 4II9A 4OIWA 3A9LA 5F46A 3S9NA 3N5FA 1N71A 1Z4EA 3DNSA 2JBJA 4KOWA 1ZG7A 4A39A 1VIXA 1UFHA 3SIIA 1CG2A 2Q43A 4WJBA 5C88A 2ZPAA 4C2YA 2ZEFA 4IK2A 4GVWA 1CPSA 5CPAA 1NSLA 2JLMA 2CTCA 3KGQA 4KOUA 3NH5A 3E0KA 2DPSA 3SIHA 4PQAA 4TNUA 5JGFA 3JTKA 1FT7A 5KTAA 1TF8A 2AFUA 4P4DA 2B3UA 3D67A 5H86A 3MN8A 2Q4YA 4G1PA 4GS4A 4KOSA 2RC4A 5JPHA 2AFZA 2YGWA 3P2FA 4FUUA 1Y7RA 2AFMA 2WZNA 4C2XA 2Q7SA 3HLPA 4QB9A 2OOTA 2CIJA 4U9ZA 2PCUA 2PC1A 3FRMA 4CAWA 2HV2A 1NE9A 2PRBA 4EMEA 3T8WA 2FE7A 3GKRA 5KTCA 2DX6A 3EKEA 3GIUA 1HDQA 2FG1A 2ZW4A 2NYQA 2PJAA 4P4JA 4O23A 2Q7BA 1YX0A 5FSVA 3ISZA 1Z8LA 2EBJA 4JLLA 2JDDA 1YD9A 2RB7A 1YGHA 2P6FA 3SJEA 2PE3A 1CP6A 2CXAA 3R9GA 1ZG8A 4KVXA 4CYNA 5IX3A 2VZZA 3IWEA 4HNXB 4XNHB 2PVWA 5FVJA 2XEJA 4B5PB 1Q2DA 3F8KA 4DNCA 1I12A 3B35A 1I21A 2CTBA 2PDOA 3BXMA 4H6ZA 2Q44A 2XEFA 4NGNA 4JGKA 3IU2A 4NEXA 4K0CA 3VH9A 4CAEA 2IMOA 3TO6A 1MJBA 3KL9A 2FAVA 4FAIA 5LYLA 3WC7A 2POKA 4CGPA 2OU2A 4CGLA 2QJ8A 2ZW6A 3ZJ0A 3T90A 1QMUA 2HUZA 2BSWA 3I3GA 4B5PA 3SJXA 1L0CA 4X2TA 1XE4A 2FXFA 2JEVA 3SJFA 1CM0A 5J1QA 4JYWA 4JXRA 1M4DA 1Q7LA 4CGNA 4MFJA 2CNTA 4KS9A 4OIDA 4M6HA 3JRUA 1XMTA 4B12A 2Q4ZA 5D8NA 3LD2A 2Z3LA 4NGMA 5FSYA 2FVGA 5HXDA 4IAVA 3GQEA 3CZXA 6CPAA 4AVCA 5HMNA 4F9UA 4R76A 4J3GA 4NF1A 4P4EA 3CPXA 1U6MA 2GLFA 3DDDA 1TXZA 1TKHA 4B11A 2ZEHA 5DWNA 3RNZA 4DUKA 1Q2YA 2ZEGA 4QVTA 1JWQA 4UMLA 5H84A 1ZO0A
chains in the Genus database with same CATH topology
2PIYA 4OC3A 2V8VA 4PPZA 2C1CA 2EK8A 3KR4A 5K8OA 5K8PA 4UEEA 3V45A 5HIHA 5F09A 1Y0YA 3KQXA 3V38A 3BHXA 1TY8A 4J5SA 7CPAA 2PJCA 3CDXA 1LFWA 3NA6A 3KZWA 1LOKA 4Q7AA 4EWTA 1NSAA 3SJGA 1BLLE 3FVLA 1TKFA 3FF3A 3TC8A 4KSIA 3KI9A 4FWUA 1XMBA 1YMEA 4YWYA 3LWUA 3HUVA 5I4MA 4KYBA 1KWMA 3D7DA 5HVFA 3EWPA 2HC9A 1CP7A 1IY7A 3D4UA 3GQOA 1YW4A 1ZR5A 1HDUA 4ONWA 4MMOA 4A37A 5LRKA 2BOAA 1M4LA 3WC5A 4DJLA 1LANA 3PB7X 5LRGA 5FSUA 1XFOA 3EWRA 4OC1A 1DE4C 2PJ4A 4UEFA 1VHUA 4ESSA 2G9DA 4IHMA 4JZ0A 3B2YA 3CT9A 3FEDA 3WC6A 3KQZA 3ETIA 2JEWA 3SIGA 3BI0A 4MXUA 4PXBA 2PJ3A 5HXDA 2V77A 5LYDA 1YW6A 4NGQA 4GVVA 3V2BA 2JBKA 4MHZA 5THWA 1Z5RA 1IGBA 2VRIA 1ZR3A 3B3SA 4J5QA 3FECA 1BPNA 1LAPA 4J5RA 4ETKA 1ELLP 3LMSA 2L8RA 3I1UA 1CPXA 4NFRA 1RTQA 2C6CA 3B3VA 2PJ1A 3IJ3A 1JQGA 3BI1A 3SI2A 2C6PA 2PRQA 3K9TA 1CX8A 1F2PA 3D7HA 5HOLA 4PXEA 3DGVA 4MHYA 3H8GA 2PJBA 3FX6A 1TXRA 3GLJA 1HJZA 2PJ7A 3D68A 4NGTA 3WT4A 3B3CA 1ARMA 1NJRA 2LGRA 3D7FA 4MHNA 1TF9A 3GB0A 3B3WA 3VARA 4A38A 3EJGA 1DTDA 3SIJA 1ZLHA 4WWVA 3D66A 1ARLA 3DLJA 2FXKA 2PIZA 1YSJA 3KHXA 3PFEA 3S9MA 4OKOA 3RZAA 5LYFA 1PYTB 3GPQA 4A94A 4MCPA 1FNOA 2GLJA 4F8ZA 3Q6ZA 3GPOA 5K8MA 3PFOA 4OMEA 2V8DA 1R43A 5CBMA 1EE3P 4AXVA 5E3BA 3PB8X 3PB9X 2ZEMA 4LQGA 3V7ZA 3VATA 1LAMA 2IJZA 2EWBA 4MRIA 3ISXA 1BAVA 3MRUA 2VL1A 4TWEA 2GU2A 3IIBA 4MCRA 2PJ9A 2I3CA 4P10A 2PJ0A 3KASA 3H8EA 1BPMA 2AFCA 4JVVA 4NGPA 4P6YA 2PJ2A 3IO1A 1VHOA 2ABZA 2PVVA 3VFQA 4MCSA 3B3TA 4NJRA 4ZY2A 3IIDA 3IWWA 3SI1A 5HVHA 1Z2LA 4ABLA 1VGYA 1TKJA 1OBRA 4EFDA 3FMCA 1H8LA 2ANPA 1YLOA 2AFXA 4P4FA 2DEAA 4ZY0A 5ELYA 2BFQA 2AFWA 3PEIA 2IQ6A 3CPAA 2CF4A 3KR5A 1UWYA 5JH9A 1XBUA 4PXCA 5CMSA 4H2KA 3IIFA 2EK9A 4UIBA 2XEGA 4UF4A 4P4IA 3L2NA 2ZEEA 3EWOA 3WABA 4NGRA 4ZI6A 3EJFA 5FSXA 4NJQA 5AILA 4W9YA 2ZEDA 4JCAA 3NH8A 3FJUA 3QNVA 4BD9A 2ZENA 2XEIA 4X8IA 3NH4A 4K3NA 3GUXA 2ZOFA 3IC1A 1SPVA 2O53A 3K2KA 4PXDA 3PB6X 4DYOA 1GYTA 4ZX9A 1ZG9A 2OR4A 3RAMA 2X47A 3IEHA 5HVGA 3PBEA 2O4HA 4X3RA 4P44A 4IQYA 4ZY1A 1ELMP 1F2OA 4MHPA 2BO9A 1LCPA 4GM5A 2AFOA 3TX8A 4J4ZA 4F9VA 2QVPA 3EW5A 2ACFA 2F7VA 3JZTA 1AYEA 3KHZA 2BCOA 1QQ9A 5LYIA 5DS0A 1F57A 4D86A 4ZYQA 2QYVA 2ZELA 2C6GA 4ABKA 8CPAA 2V8GA 2GREA 3FH4A 4R6TA 2J9AA 5CB3A 4OP4A 4OC4A 2EEEA 3NFZA 4B6ZA 4RUHA 3IFEA 4CPAA 2PJ6A 3SI0A 4R7MA 5K8NA 5FSZA 1CBXA 2BFRA 4P4BA 2PJ5A 2NSMA 4GUAA 1XRYA 1VHEA 4R8FA 5LRJA 5JM6A 2Q51A 2AFSA 2XD7A 4FBEA 2ZEOA 3GPGA 5CB5A 4YU9A 2F8HA 4MCQA 3EWQA 3H8FA 2ZEPA 1Y0RA 2ZOGA 4NGSA 4ETJA 4UEZA 1PCAA 3Q71A 4OC0A 4TU0A 3PBBA 3RBUA 5D29A 3S9LA 3PRTA 5IB9A 1R3NA 1XJOA 4UIAA 4Z65A 2WYRA 3PB4X 1ZLIA 1Y7EA 2PJ8A 3FEEA 4OC5A 2HB6A 2V8HA 3D7GA 5DUSA 1HEEA 4P45A 4ZX8A 3B7IA 1AMPA 4OC2A 2RFHA 4OIWA 3S9NA 3N5FA 4A39A 2JBJA 1ZG7A 1VIXA 3SIIA 1CG2A 2Q43A 4WJBA 2ZEFA 4IK2A 4GVWA 1CPSA 5CPAA 3KGQA 2CTCA 3NH5A 4PQAA 5JGFA 3SIHA 4TNUA 1FT7A 1TF8A 2AFUA 4P4DA 3D67A 3MN8A 4G1PA 2AFZA 4FUUA 2AFMA 2WZNA 3HLPA 2OOTA 2CIJA 2PCUA 4EMEA 3T8WA 2DX6A 3EKEA 1HDQA 2FG1A 2NYQA 2PJAA 4P4JA 4O23A 5FSVA 3ISZA 1Z8LA 4JLLA 1YD9A 2RB7A 3SJEA 2PE3A 1CP6A 1ZG8A 2PVWA 2XEJA 3B35A 3BXMA 2CTBA 4NGNA 2XEFA 4JGKA 4K0CA 3VH9A 2IMOA 3KL9A 2FAVA 4FAIA 5LYLA 3WC7A 2POKA 2QJ8A 1QMUA 3SJXA 4X2TA 3SJFA 5J1QA 4JYWA 1Q7LA 4OIDA 3JRUA 2Q4ZA 5D8NA 4NGMA 5FSYA 2FVGA 4IAVA 3GQEA 6CPAA 4F9UA 4R76A 4P4EA 3CPXA 2GLFA 1TXZA 1TKHA 2ZEHA 4DUKA 2ZEGA 4UMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PIY A;  4OC3 A;  2V8V A;  4PPZ A;  2C1C A;  2EK8 A;  3KR4 A;  5K8O A;  5K8P A;  4UEE A;  3V45 A;  5HIH A;  5F09 A;  1Y0Y A;  3KQX A;  3V38 A;  3BHX A;  1TY8 A;  4J5S A;  7CPA A;  2PJC A;  3CDX A;  1LFW A;  3NA6 A;  3KZW A;  1LOK A;  4Q7A A;  4EWT A;  1NSA A;  3SJG A;  1BLL E;  3FVL A;  1TKF A;  3FF3 A;  3TC8 A;  4KSI A;  3KI9 A;  4FWU A;  1XMB A;  1YME A;  4YWY A;  3LWU A;  3HUV A;  5I4M A;  4KYB A;  1KWM A;  3D7D A;  5HVF A;  3EWP A;  2HC9 A;  1CP7 A;  1IY7 A;  3D4U A;  3GQO A;  1YW4 A;  1ZR5 A;  1HDU A;  4ONW A;  4MMO A;  4A37 A;  5LRK A;  2BOA A;  1M4L A;  3WC5 A;  4DJL A;  1LAN A;  3PB7 X;  5LRG A;  5FSU A;  1XFO A;  3EWR A;  4OC1 A;  1DE4 C;  2PJ4 A;  4UEF A;  1VHU A;  4ESS A;  2G9D A;  4IHM A;  4JZ0 A;  3B2Y A;  3CT9 A;  3FED A;  3WC6 A;  3KQZ A;  3ETI A;  2JEW A;  3SIG A;  3BI0 A;  4MXU A;  4PXB A;  2PJ3 A;  5HXD A;  2V77 A;  5LYD A;  1YW6 A;  4NGQ A;  4GVV A;  3V2B A;  2JBK A;  4MHZ A;  5THW A;  1Z5R A;  1IGB A;  2VRI A;  1ZR3 A;  3B3S A;  4J5Q A;  3FEC A;  1BPN A;  1LAP A;  4J5R A;  4ETK A;  1ELL P;  3LMS A;  2L8R A;  3I1U A;  1CPX A;  4NFR A;  1RTQ A;  2C6C A;  3B3V A;  2PJ1 A;  3IJ3 A;  1JQG A;  3BI1 A;  3SI2 A;  2C6P A;  2PRQ A;  3K9T A;  1CX8 A;  1F2P A;  3D7H A;  5HOL A;  4PXE A;  3DGV A;  4MHY A;  3H8G A;  2PJB A;  3FX6 A;  1TXR A;  3GLJ A;  1HJZ A;  2PJ7 A;  3D68 A;  4NGT A;  3WT4 A;  3B3C A;  1ARM A;  1NJR A;  2LGR A;  3D7F A;  4MHN A;  1TF9 A;  3GB0 A;  3B3W A;  3VAR A;  4A38 A;  3EJG A;  1DTD A;  3SIJ A;  1ZLH A;  4WWV A;  3D66 A;  1ARL A;  3DLJ A;  2FXK A;  2PIZ A;  1YSJ A;  3KHX A;  3PFE A;  3S9M A;  4OKO A;  3RZA A;  5LYF A;  1PYT B;  3GPQ A;  4A94 A;  4MCP A;  1FNO A;  2GLJ A;  4F8Z A;  3Q6Z A;  3GPO A;  5K8M A;  3PFO A;  4OME A;  2V8D A;  1R43 A;  5CBM A;  1EE3 P;  4AXV A;  5E3B A;  3PB8 X;  3PB9 X;  2ZEM A;  4LQG A;  3V7Z A;  3VAT A;  1LAM A;  2IJZ A;  2EWB A;  4MRI A;  3ISX A;  1BAV A;  3MRU A;  2VL1 A;  4TWE A;  2GU2 A;  3IIB A;  4MCR A;  2PJ9 A;  2I3C A;  4P10 A;  2PJ0 A;  3KAS A;  3H8E A;  1BPM A;  2AFC A;  4JVV A;  4NGP A;  4P6Y A;  2PJ2 A;  3IO1 A;  1VHO A;  2ABZ A;  2PVV A;  3VFQ A;  4MCS A;  3B3T A;  4NJR A;  4ZY2 A;  3IID A;  3IWW A;  3SI1 A;  5HVH A;  1Z2L A;  4ABL A;  1VGY A;  1TKJ A;  1OBR A;  4EFD A;  3FMC A;  1H8L A;  2ANP A;  1YLO A;  2AFX A;  4P4F A;  2DEA A;  4ZY0 A;  5ELY A;  2BFQ A;  2AFW A;  3PEI A;  2IQ6 A;  3CPA A;  2CF4 A;  3KR5 A;  1UWY A;  5JH9 A;  1XBU A;  4PXC A;  5CMS A;  4H2K A;  3IIF A;  2EK9 A;  4UIB A;  2XEG A;  4UF4 A;  4P4I A;  3L2N A;  2ZEE A;  3EWO A;  3WAB A;  4NGR A;  4ZI6 A;  3EJF A;  5FSX A;  4NJQ A;  5AIL A;  4W9Y A;  2ZED A;  4JCA A;  3NH8 A;  3FJU A;  3QNV A;  4BD9 A;  2ZEN A;  2XEI A;  4X8I A;  3NH4 A;  4K3N A;  3GUX A;  2ZOF A;  3IC1 A;  1SPV A;  2O53 A;  3K2K A;  4PXD A;  3PB6 X;  4DYO A;  1GYT A;  4ZX9 A;  1ZG9 A;  2OR4 A;  3RAM A;  2X47 A;  3IEH A;  5HVG A;  3PBE A;  2O4H A;  4X3R A;  4P44 A;  4IQY A;  4ZY1 A;  1ELM P;  1F2O A;  4MHP A;  2BO9 A;  1LCP A;  4GM5 A;  2AFO A;  3TX8 A;  4J4Z A;  4F9V A;  2QVP A;  3EW5 A;  2ACF A;  2F7V A;  3JZT A;  1AYE A;  3KHZ A;  2BCO A;  1QQ9 A;  5LYI A;  5DS0 A;  1F57 A;  4D86 A;  4ZYQ A;  2QYV A;  2ZEL A;  2C6G A;  4ABK A;  8CPA A;  2V8G A;  2GRE A;  3FH4 A;  4R6T A;  2J9A A;  5CB3 A;  4OP4 A;  4OC4 A;  2EEE A;  3NFZ A;  4B6Z A;  4RUH A;  3IFE A;  4CPA A;  2PJ6 A;  3SI0 A;  4R7M A;  5K8N A;  5FSZ A;  1CBX A;  2BFR A;  4P4B A;  2PJ5 A;  2NSM A;  4GUA A;  1XRY A;  1VHE A;  4R8F A;  5LRJ A;  5JM6 A;  2Q51 A;  2AFS A;  2XD7 A;  4FBE A;  2ZEO A;  3GPG A;  5CB5 A;  4YU9 A;  2F8H A;  4MCQ A;  3EWQ A;  3H8F A;  2ZEP A;  1Y0R A;  2ZOG A;  4NGS A;  4ETJ A;  4UEZ A;  1PCA A;  3Q71 A;  4OC0 A;  4TU0 A;  3PBB A;  3RBU A;  5D29 A;  3S9L A;  3PRT A;  5IB9 A;  1R3N A;  1XJO A;  4UIA A;  4Z65 A;  2WYR A;  3PB4 X;  1ZLI A;  1Y7E A;  2PJ8 A;  3FEE A;  4OC5 A;  2HB6 A;  2V8H A;  3D7G A;  5DUS A;  1HEE A;  4P45 A;  4ZX8 A;  3B7I A;  1AMP A;  4OC2 A;  2RFH A;  4OIW A;  3S9N A;  3N5F A;  4A39 A;  2JBJ A;  1ZG7 A;  1VIX A;  3SII A;  1CG2 A;  2Q43 A;  4WJB A;  2ZEF A;  4IK2 A;  4GVW A;  1CPS A;  5CPA A;  3KGQ A;  2CTC A;  3NH5 A;  4PQA A;  5JGF A;  3SIH A;  4TNU A;  1FT7 A;  1TF8 A;  2AFU A;  4P4D A;  3D67 A;  3MN8 A;  4G1P A;  2AFZ A;  4FUU A;  2AFM A;  2WZN A;  3HLP A;  2OOT A;  2CIJ A;  2PCU A;  4EME A;  3T8W A;  2DX6 A;  3EKE A;  1HDQ A;  2FG1 A;  2NYQ A;  2PJA A;  4P4J A;  4O23 A;  5FSV A;  3ISZ A;  1Z8L A;  4JLL A;  1YD9 A;  2RB7 A;  3SJE A;  2PE3 A;  1CP6 A;  1ZG8 A;  2PVW A;  2XEJ A;  3B35 A;  3BXM A;  2CTB A;  4NGN A;  2XEF A;  4JGK A;  4K0C A;  3VH9 A;  2IMO A;  3KL9 A;  2FAV A;  4FAI A;  5LYL A;  3WC7 A;  2POK A;  2QJ8 A;  1QMU A;  3SJX A;  4X2T A;  3SJF A;  5J1Q A;  4JYW A;  1Q7L A;  4OID A;  3JRU A;  2Q4Z A;  5D8N A;  4NGM A;  5FSY A;  2FVG A;  4IAV A;  3GQE A;  6CPA A;  4F9U A;  4R76 A;  4P4E A;  3CPX A;  2GLF A;  1TXZ A;  1TKH A;  2ZEH A;  4DUK A;  2ZEG A;  4UML A; 
#chains in the Genus database with same CATH topology
 2PIY A;  4OC3 A;  2G3A A;  2VXK A;  4IUS A;  4UFV A;  3GY9 A;  3QB8 A;  2PSW A;  1YVK A;  2V8V A;  4MFL A;  3ZZI A;  4CAX A;  2OZH A;  1IYL A;  4PPZ A;  4CS0 B;  2C1C A;  4F0X A;  1QSM A;  4KVO E;  2EK8 A;  5AG6 A;  4PK2 A;  3KR4 A;  1YR0 A;  5K8O A;  5K8P A;  4UEE A;  3V45 A;  4A2Z A;  1S5K A;  4L8A A;  2WCT A;  5HIH A;  2Q0Y A;  4NXY A;  3K9U A;  2EUI A;  1P0H A;  4HNY B;  1I1D A;  5F09 A;  4KOV A;  2B3V A;  1Y0Y A;  3I9S A;  3WR7 A;  3KQX A;  4F6A A;  3C26 A;  3V38 A;  2I79 A;  1PUA A;  3BHX A;  1TY8 A;  2CY2 A;  1NMT A;  4J5S A;  2FCK A;  1WK4 A;  1A2Z A;  7CPA A;  1S60 A;  2PJC A;  3CDX A;  4Y49 C;  1LFW A;  3NA6 A;  3KZW A;  4JXQ A;  1YQE A;  4CAV A;  4PK3 A;  1LOK A;  2B5G B;  4LX9 A;  4Q7A A;  3TO9 A;  4EWT A;  5BWA B;  1NSA A;  3NE7 A;  3SJG A;  1WWZ A;  4CYP A;  1BLL E;  3FVL A;  3PGP A;  1RO5 A;  1TKF A;  2VBQ A;  3FF3 A;  3TC8 A;  3S6H A;  4KSI A;  3KI9 A;  4FWU A;  1XMB A;  1YME A;  2P6E A;  4YWY A;  3LOD A;  3LWU A;  3JUW A;  5G20 A;  3HUV A;  4BBH A;  5I4M A;  4E0A A;  3N7Z A;  4MI4 A;  4KYB A;  1MK4 A;  1KWM A;  4CYO A;  2PR1 A;  1R57 A;  3D7D A;  2KQV A;  2NMT A;  5HVF A;  4R9M A;  3CXS A;  4A31 A;  5JQ4 A;  2J8M A;  4R87 A;  2QEC A;  1M4I A;  2Y0M A;  2YNE A;  3EWP A;  2GIV A;  4MFQ A;  2HC9 A;  1S7N A;  3BJ8 A;  1CP7 A;  1IY7 A;  3D4U A;  3GQO A;  1S7K A;  1YW4 A;  4LQ6 A;  1ZR5 A;  2FSR A;  3D2M A;  1HDU A;  4ONW A;  3FB3 A;  4YGO A;  5I0C A;  4MMO A;  2R8V A;  3EFA A;  4A37 A;  2B58 A;  1SQH A;  5LRK A;  3DSB A;  2BOA A;  1M4L A;  5A27 A;  3WC5 A;  4UFW A;  1LAN A;  1M1D A;  3D8P A;  3PB7 X;  4R57 A;  5FSU A;  1XFO A;  3IGR A;  5LRG A;  3V8I A;  3EWR A;  4OC1 A;  1DE4 C;  1X12 A;  3IU1 A;  1KZF A;  3MGD A;  4FD4 A;  2PJ4 A;  4JLY A;  4NSQ A;  4UEF A;  4XPD B;  3R96 A;  1VHU A;  4ESS A;  4UA3 A;  1XF8 A;  2I00 A;  2G9D A;  4IHM A;  4JZ0 A;  2AE6 A;  1XEB A;  2Z0Z A;  1S7L A;  3B2Y A;  2FIW A;  3CT9 A;  3FED A;  3WC6 A;  3KQZ A;  3ETI A;  2D4P A;  3SIG A;  2JEW A;  2YNC A;  3BI0 A;  2PJ3 A;  2ZXV A;  2B4B A;  2Z3M A;  4KZT A;  4MXU A;  4PXB A;  4U9Y A;  4CYQ A;  2V77 A;  4RN7 A;  2GAN A;  5LYD A;  4ONU A;  2FS5 A;  1YW6 A;  5AG4 A;  5G1Z A;  3VWE A;  2D4O A;  1S3Z A;  4NGQ A;  3R95 A;  5IB0 A;  4GVV A;  3V2B A;  2JBK A;  2OZG A;  4MHZ A;  2Z3N A;  4QC6 A;  4KSF A;  1Z5R A;  1IGB A;  3D3S A;  5THW A;  4JJX A;  1B87 A;  2VRI A;  2J8R A;  4MY3 A;  4R3L A;  1ZR3 A;  3B3S A;  4KOT A;  4UCP A;  2EVN A;  4J5Q A;  1BPN A;  3FEC A;  1LAP A;  4HKF A;  2G3T A;  4J5R A;  4ETK A;  2ARH A;  3TO7 A;  1ELL P;  1OZP A;  1YLE A;  3LMS A;  4UWI A;  2L8R A;  3SXO A;  3FYN A;  3I1U A;  2F5I A;  1CPX A;  4NFR A;  1RTQ A;  2C6C A;  3B3V A;  3SHP A;  2PJ1 A;  1RXT A;  4AVA A;  3IJ3 A;  3W6X A;  3G8W A;  1JQG A;  5G22 A;  3TOA A;  3BI1 A;  3SI2 A;  2C6P A;  4M85 A;  2PRQ A;  2WUU A;  1Y9K A;  4M6G A;  4RS2 A;  4JD6 A;  2Z3K A;  3DR8 A;  1YVO A;  4RI1 A;  1TIQ A;  4BMH A;  2REF A;  3K9T A;  4C68 A;  1CX8 A;  1F2P A;  3D7H A;  5HOL A;  4PXE A;  2Q4V A;  5A28 A;  4FD5 A;  3DGV A;  4MHY A;  1K4J A;  2A4N A;  4MFZ A;  4UWJ A;  3H8G A;  2ODF A;  3SXN A;  4A32 A;  2PJB A;  3R9F A;  4KUB A;  5F48 A;  2OH1 A;  2DXQ A;  4E2A A;  3FX6 A;  1TXR A;  3GLJ A;  3QAY A;  1HJZ A;  3UY5 A;  2PJ7 A;  3D68 A;  4KLV A;  4NGT A;  3WT4 A;  1BO4 A;  1CJW A;  3B3C A;  3CXQ A;  4BIN A;  1ARM A;  1NJR A;  2LGR A;  3D7F A;  4MHN A;  1TF9 A;  3GB0 A;  3CXP A;  1XOV A;  3B3W A;  3VAR A;  4FD7 A;  4A38 A;  4C7I A;  3EJG A;  3G3S A;  3BJ7 A;  4GXH A;  5E96 A;  3H5Z A;  4R3K A;  1DTD A;  3SIJ A;  1ZLH A;  2Q04 A;  4WWV A;  3TTH A;  2W2G A;  2YNC C;  3D66 A;  1IOF A;  2VZY A;  1ARL A;  2C27 A;  1IYK A;  3DLJ A;  4EVY A;  2ATR A;  2CNM A;  1M44 A;  4MFP A;  2FXK A;  2PIZ A;  1IU8 A;  1YSJ A;  3KHX A;  3PFE A;  4MHD A;  3S9M A;  4CGO A;  4OKO A;  3RZA A;  5IV0 A;  4H89 A;  5LYF A;  3TCV A;  3D2P A;  3S6K A;  4B10 A;  1PYT B;  2AJ6 A;  3GPQ A;  4A94 A;  4CGM A;  2R98 A;  3H4Q A;  4MCP A;  2Z10 A;  3FBU A;  3EO4 A;  1FNO A;  2GLJ A;  2BL1 A;  4F8Z A;  3Q6Z A;  5EMI A;  4A95 A;  3GPO A;  5G21 A;  5K8M A;  2REE A;  2IL4 A;  3PFO A;  4PSX A;  1XIX A;  4YRH A;  2BUE A;  4OME A;  5AG5 A;  2GE3 A;  2V8D A;  4A33 A;  1R43 A;  5CBM A;  1EE3 P;  5KTD A;  3B8G A;  4AXV A;  5E3B A;  3PB8 X;  3PB9 X;  1QSN A;  2ZEM A;  4LQG A;  3V7Z A;  3VAT A;  1IOI A;  3VWD A;  2VQY A;  1LAM A;  2IJZ A;  2EWB A;  2YND A;  1X10 A;  4MRI A;  1GHE A;  1BAV A;  3ISX A;  4AB7 A;  3MRU A;  2VL1 A;  4TWE A;  2GU2 A;  4HPS A;  2ZW7 A;  4KLW A;  4KVM E;  2FIA A;  3IIB A;  4MCR A;  1VKC A;  4UCM A;  2PJ9 A;  3PP9 A;  1KUX A;  4XNH C;  4AVB A;  2I3C A;  3TE4 A;  4PV6 A;  4X5K A;  1IIC A;  5DWM A;  4MFK A;  3P2H A;  4P10 A;  4K30 A;  1KUV A;  2OZU A;  4M3S A;  2PJ0 A;  4UFX A;  4C7H A;  3KAS A;  3H8E A;  1BPM A;  4QUS A;  5C82 A;  4U5Y A;  2AFC A;  2JZE A;  4JVV A;  4NGP A;  4QBJ A;  2JDC A;  4P6Y A;  2PJ2 A;  3IO1 A;  1Q2C A;  1Z8W A;  1VHO A;  2ABZ A;  2PVV A;  3VFQ A;  4MCS A;  3B3T A;  4NJR A;  4OAE A;  4ZY2 A;  3NE8 A;  2K5T A;  3IID A;  4FD6 A;  3IWW A;  3SI1 A;  5HVH A;  4L89 A;  1Z2L A;  4M6I A;  4ABL A;  1J4J A;  1VGY A;  1BOB A;  1YRE A;  2Z11 A;  1B6B A;  2PQ8 A;  2H5M A;  2GFQ A;  5F49 A;  4YFJ A;  4PSW A;  4CRY B;  3GYA A;  3LAC A;  1TKJ A;  1OBR A;  4EFD A;  4MBU A;  1Y9W A;  1KUY A;  2R1I A;  3FMC A;  2WPX A;  1H8L A;  2ANP A;  1YLO A;  2AFX A;  4P4F A;  3TT2 A;  2DEA A;  4Y49 B;  4ZY0 A;  3F0A A;  5ELY A;  2BFQ A;  2AFW A;  3PEI A;  2IQ6 A;  3CPA A;  2CF4 A;  3FXT A;  2B5G A;  1ON0 A;  3KR5 A;  2DPT A;  1UWY A;  5JH9 A;  3BLN A;  3OWC A;  1XBU A;  1Z9U A;  4PXC A;  5CMS A;  4H2K A;  3IIF A;  2EK9 A;  3FIX A;  4MY0 A;  4UCN A;  4UIB A;  2XEG A;  4UF4 A;  4P4I A;  3TFY A;  2J8N A;  2ZEE A;  2RNK A;  3L2N A;  1MJA A;  3EWO A;  3WAB A;  4NGR A;  4ZI6 A;  4XPL A;  3EJF A;  5FSX A;  4NJQ A;  5AIL A;  2VI7 A;  4KOX A;  2P0W A;  2Z3P A;  4W9Y A;  5HH1 A;  4NCZ A;  2ZED A;  4JCA A;  3NH8 A;  3FJU A;  1Z4R A;  3IWG A;  3QNV A;  3DR6 A;  4JWP A;  4BD9 A;  2ZEN A;  4MJ8 A;  2XEI A;  4X8I A;  3W91 A;  3NH4 A;  4K3N A;  3GUX A;  2ZOF A;  3IC1 A;  1SPV A;  4H6U A;  2O53 A;  3K2K A;  2VEZ A;  2WSA A;  4PXD A;  3PB6 X;  4DYO A;  1GYT A;  4ZX9 A;  1FY7 A;  1PU9 A;  1ZG9 A;  2OR4 A;  3RAM A;  2KCW A;  2X47 A;  3IEH A;  5HVG A;  3PBE A;  1IB1 E;  2O4H A;  3F5B A;  4HNW B;  4X3R A;  4P44 A;  3T9Y A;  4IQY A;  5J8C A;  4ZY1 A;  1ELM P;  1Z8T A;  3S6G A;  5AGE A;  1F2O A;  1LRZ A;  2BO9 A;  4MHP A;  4OLL A;  1LCP A;  2B4D B;  4GM5 A;  2AFO A;  4IF5 A;  4J4Z A;  5CNP A;  5GCN A;  4KSA A;  3R9E A;  3TX8 A;  5J8F A;  5ISV A;  4OAD A;  4B13 A;  4F9V A;  2QVP A;  4AG7 A;  4UBR A;  4F0Y A;  4ZGY B;  1P4N A;  3EW5 A;  2ACF A;  2F7V A;  3JZT A;  4I49 A;  1AYE A;  4E8O A;  3KHZ A;  1AUG A;  2BCO A;  1QQ9 A;  2HQY A;  5AG7 A;  5LYI A;  5DS0 A;  1F57 A;  4D86 A;  4ZYQ A;  2QYV A;  3PZJ A;  3RO0 A;  2R7H A;  2ZEL A;  2C6G A;  4ABK A;  3EXN A;  2V8G A;  8CPA A;  1QST A;  2EO8 A;  2JZD A;  2GRE A;  3FH4 A;  2QML A;  4KOY A;  3RYO A;  4R6T A;  2PR8 A;  2Z3O A;  2J9A A;  3EY5 A;  3QAH A;  4C2Z A;  5CB3 A;  4OP4 A;  4OC4 A;  2P6G A;  2EEE A;  3NFZ A;  1S7F A;  4B6Z A;  5EC4 A;  4DJL A;  2WPW A;  3IFE A;  4RUH A;  4CPA A;  2PJ6 A;  3SI0 A;  3KKW A;  2FT0 A;  5F47 A;  4R7M A;  3S6F A;  5K8N A;  5FSZ A;  1QSO A;  1Z8X A;  1CBX A;  2BFR A;  2FL4 A;  4P4B A;  4XPD C;  2PJ5 A;  2NSM A;  4GUA A;  1XRY A;  1VHE A;  4R8F A;  5LRJ A;  5JM6 A;  2Q51 A;  2AFS A;  1V0C A;  2XD7 A;  4FBE A;  3W6S A;  2ZEO A;  3GPG A;  1MJ9 A;  4Q36 A;  5CB5 A;  4YU9 A;  2JZF A;  3JVN A;  2F8H A;  4ORF A;  2QIR A;  2B4D A;  4MCQ A;  4Q38 A;  3EWQ A;  1QSR A;  3H8F A;  2ZEP A;  3EC4 A;  1Y0R A;  2ZOG A;  3FNC A;  3R1K A;  4ETJ A;  4NGS A;  4AG9 A;  1VHS A;  2G0B A;  4UEZ A;  4ZBG A;  1PCA A;  2DF5 A;  3Q71 A;  4OC0 A;  2O28 A;  4B14 A;  4TU0 A;  3PBB A;  4CAF A;  5EBV A;  3RBU A;  5D29 A;  1YK3 A;  2ZW5 A;  3S9L A;  2CNS A;  2X7B A;  1IID A;  2BEI A;  4A30 A;  3PRT A;  5IB9 A;  1R3N A;  1XJO A;  4UIA A;  4Z65 A;  2WYR A;  4CRZ B;  3PB4 X;  1ZLI A;  4KOR A;  1Y7E A;  2PJ8 A;  4KUA A;  3FEE A;  4OC5 A;  2HB6 A;  2OB0 A;  4XPK A;  2V8H A;  3D7G A;  1M4G A;  5DUS A;  1HEE A;  4LUA A;  4P45 A;  3TOB A;  4ZX8 A;  3B7I A;  1AMP A;  4OC2 A;  4B5O A;  2RFH A;  4II9 A;  4OIW A;  3A9L A;  5F46 A;  3S9N A;  3N5F A;  1N71 A;  1Z4E A;  3DNS A;  2JBJ A;  4KOW A;  1ZG7 A;  4A39 A;  1VIX A;  1UFH A;  3SII A;  1CG2 A;  2Q43 A;  4WJB A;  5C88 A;  2ZPA A;  4C2Y A;  2ZEF A;  4IK2 A;  4GVW A;  1CPS A;  5CPA A;  1NSL A;  2JLM A;  2CTC A;  3KGQ A;  4KOU A;  3NH5 A;  3E0K A;  2DPS A;  3SIH A;  4PQA A;  4TNU A;  5JGF A;  3JTK A;  1FT7 A;  5KTA A;  1TF8 A;  2AFU A;  4P4D A;  2B3U A;  3D67 A;  5H86 A;  3MN8 A;  2Q4Y A;  4G1P A;  4GS4 A;  4KOS A;  2RC4 A;  5JPH A;  2AFZ A;  2YGW A;  3P2F A;  4FUU A;  1Y7R A;  2AFM A;  2WZN A;  4C2X A;  2Q7S A;  3HLP A;  4QB9 A;  2OOT A;  2CIJ A;  4U9Z A;  2PCU A;  2PC1 A;  3FRM A;  4CAW A;  2HV2 A;  1NE9 A;  2PRB A;  4EME A;  3T8W A;  2FE7 A;  3GKR A;  5KTC A;  2DX6 A;  3EKE A;  3GIU A;  1HDQ A;  2FG1 A;  2ZW4 A;  2NYQ A;  2PJA A;  4P4J A;  4O23 A;  2Q7B A;  1YX0 A;  5FSV A;  3ISZ A;  1Z8L A;  2EBJ A;  4JLL A;  2JDD A;  1YD9 A;  2RB7 A;  1YGH A;  2P6F A;  3SJE A;  2PE3 A;  1CP6 A;  2CXA A;  3R9G A;  1ZG8 A;  4KVX A;  4CYN A;  5IX3 A;  2VZZ A;  3IWE A;  4HNX B;  4XNH B;  2PVW A;  5FVJ A;  2XEJ A;  4B5P B;  1Q2D A;  3F8K A;  4DNC A;  1I12 A;  3B35 A;  1I21 A;  2CTB A;  2PDO A;  3BXM A;  4H6Z A;  2Q44 A;  2XEF A;  4NGN A;  4JGK A;  3IU2 A;  4NEX A;  4K0C A;  3VH9 A;  4CAE A;  2IMO A;  3TO6 A;  1MJB A;  3KL9 A;  2FAV A;  4FAI A;  5LYL A;  3WC7 A;  2POK A;  4CGP A;  2OU2 A;  4CGL A;  2QJ8 A;  2ZW6 A;  3ZJ0 A;  3T90 A;  1QMU A;  2HUZ A;  2BSW A;  3I3G A;  4B5P A;  3SJX A;  1L0C A;  4X2T A;  1XE4 A;  2FXF A;  2JEV A;  3SJF A;  1CM0 A;  5J1Q A;  4JYW A;  4JXR A;  1M4D A;  1Q7L A;  4CGN A;  4MFJ A;  2CNT A;  4KS9 A;  4OID A;  4M6H A;  3JRU A;  1XMT A;  4B12 A;  2Q4Z A;  5D8N A;  3LD2 A;  2Z3L A;  4NGM A;  5FSY A;  2FVG A;  5HXD A;  4IAV A;  3GQE A;  3CZX A;  6CPA A;  4AVC A;  5HMN A;  4F9U A;  4R76 A;  4J3G A;  4NF1 A;  4P4E A;  3CPX A;  1U6M A;  2GLF A;  3DDD A;  1TXZ A;  1TKH A;  4B11 A;  2ZEH A;  5DWN A;  3RNZ A;  4DUK A;  1Q2Y A;  2ZEG A;  4QVT A;  1JWQ A;  4UML A;  5H84 A;  1ZO0 A; 
#chains in the Genus database with same CATH homology
 2PIY A;  4OC3 A;  2V8V A;  4PPZ A;  2C1C A;  2EK8 A;  3KR4 A;  5K8O A;  5K8P A;  4UEE A;  3V45 A;  5HIH A;  5F09 A;  1Y0Y A;  3KQX A;  3V38 A;  3BHX A;  1TY8 A;  4J5S A;  7CPA A;  2PJC A;  3CDX A;  1LFW A;  3NA6 A;  3KZW A;  1LOK A;  4Q7A A;  4EWT A;  1NSA A;  3SJG A;  1BLL E;  3FVL A;  1TKF A;  3FF3 A;  3TC8 A;  4KSI A;  3KI9 A;  4FWU A;  1XMB A;  1YME A;  4YWY A;  3LWU A;  3HUV A;  5I4M A;  4KYB A;  1KWM A;  3D7D A;  5HVF A;  3EWP A;  2HC9 A;  1CP7 A;  1IY7 A;  3D4U A;  3GQO A;  1YW4 A;  1ZR5 A;  1HDU A;  4ONW A;  4MMO A;  4A37 A;  5LRK A;  2BOA A;  1M4L A;  3WC5 A;  4DJL A;  1LAN A;  3PB7 X;  5LRG A;  5FSU A;  1XFO A;  3EWR A;  4OC1 A;  1DE4 C;  2PJ4 A;  4UEF A;  1VHU A;  4ESS A;  2G9D A;  4IHM A;  4JZ0 A;  3B2Y A;  3CT9 A;  3FED A;  3WC6 A;  3KQZ A;  3ETI A;  2JEW A;  3SIG A;  3BI0 A;  4MXU A;  4PXB A;  2PJ3 A;  5HXD A;  2V77 A;  5LYD A;  1YW6 A;  4NGQ A;  4GVV A;  3V2B A;  2JBK A;  4MHZ A;  5THW A;  1Z5R A;  1IGB A;  2VRI A;  1ZR3 A;  3B3S A;  4J5Q A;  3FEC A;  1BPN A;  1LAP A;  4J5R A;  4ETK A;  1ELL P;  3LMS A;  2L8R A;  3I1U A;  1CPX A;  4NFR A;  1RTQ A;  2C6C A;  3B3V A;  2PJ1 A;  3IJ3 A;  1JQG A;  3BI1 A;  3SI2 A;  2C6P A;  2PRQ A;  3K9T A;  1CX8 A;  1F2P A;  3D7H A;  5HOL A;  4PXE A;  3DGV A;  4MHY A;  3H8G A;  2PJB A;  3FX6 A;  1TXR A;  3GLJ A;  1HJZ A;  2PJ7 A;  3D68 A;  4NGT A;  3WT4 A;  3B3C A;  1ARM A;  1NJR A;  2LGR A;  3D7F A;  4MHN A;  1TF9 A;  3GB0 A;  3B3W A;  3VAR A;  4A38 A;  3EJG A;  1DTD A;  3SIJ A;  1ZLH A;  4WWV A;  3D66 A;  1ARL A;  3DLJ A;  2FXK A;  2PIZ A;  1YSJ A;  3KHX A;  3PFE A;  3S9M A;  4OKO A;  3RZA A;  5LYF A;  1PYT B;  3GPQ A;  4A94 A;  4MCP A;  1FNO A;  2GLJ A;  4F8Z A;  3Q6Z A;  3GPO A;  5K8M A;  3PFO A;  4OME A;  2V8D A;  1R43 A;  5CBM A;  1EE3 P;  4AXV A;  5E3B A;  3PB8 X;  3PB9 X;  2ZEM A;  4LQG A;  3V7Z A;  3VAT A;  1LAM A;  2IJZ A;  2EWB A;  4MRI A;  3ISX A;  1BAV A;  3MRU A;  2VL1 A;  4TWE A;  2GU2 A;  3IIB A;  4MCR A;  2PJ9 A;  2I3C A;  4P10 A;  2PJ0 A;  3KAS A;  3H8E A;  1BPM A;  2AFC A;  4JVV A;  4NGP A;  4P6Y A;  2PJ2 A;  3IO1 A;  1VHO A;  2ABZ A;  2PVV A;  3VFQ A;  4MCS A;  3B3T A;  4NJR A;  4ZY2 A;  3IID A;  3IWW A;  3SI1 A;  5HVH A;  1Z2L A;  4ABL A;  1VGY A;  1TKJ A;  1OBR A;  4EFD A;  3FMC A;  1H8L A;  2ANP A;  1YLO A;  2AFX A;  4P4F A;  2DEA A;  4ZY0 A;  5ELY A;  2BFQ A;  2AFW A;  3PEI A;  2IQ6 A;  3CPA A;  2CF4 A;  3KR5 A;  1UWY A;  5JH9 A;  1XBU A;  4PXC A;  5CMS A;  4H2K A;  3IIF A;  2EK9 A;  4UIB A;  2XEG A;  4UF4 A;  4P4I A;  3L2N A;  2ZEE A;  3EWO A;  3WAB A;  4NGR A;  4ZI6 A;  3EJF A;  5FSX A;  4NJQ A;  5AIL A;  4W9Y A;  2ZED A;  4JCA A;  3NH8 A;  3FJU A;  3QNV A;  4BD9 A;  2ZEN A;  2XEI A;  4X8I A;  3NH4 A;  4K3N A;  3GUX A;  2ZOF A;  3IC1 A;  1SPV A;  2O53 A;  3K2K A;  4PXD A;  3PB6 X;  4DYO A;  1GYT A;  4ZX9 A;  1ZG9 A;  2OR4 A;  3RAM A;  2X47 A;  3IEH A;  5HVG A;  3PBE A;  2O4H A;  4X3R A;  4P44 A;  4IQY A;  4ZY1 A;  1ELM P;  1F2O A;  4MHP A;  2BO9 A;  1LCP A;  4GM5 A;  2AFO A;  3TX8 A;  4J4Z A;  4F9V A;  2QVP A;  3EW5 A;  2ACF A;  2F7V A;  3JZT A;  1AYE A;  3KHZ A;  2BCO A;  1QQ9 A;  5LYI A;  5DS0 A;  1F57 A;  4D86 A;  4ZYQ A;  2QYV A;  2ZEL A;  2C6G A;  4ABK A;  8CPA A;  2V8G A;  2GRE A;  3FH4 A;  4R6T A;  2J9A A;  5CB3 A;  4OP4 A;  4OC4 A;  2EEE A;  3NFZ A;  4B6Z A;  4RUH A;  3IFE A;  4CPA A;  2PJ6 A;  3SI0 A;  4R7M A;  5K8N A;  5FSZ A;  1CBX A;  2BFR A;  4P4B A;  2PJ5 A;  2NSM A;  4GUA A;  1XRY A;  1VHE A;  4R8F A;  5LRJ A;  5JM6 A;  2Q51 A;  2AFS A;  2XD7 A;  4FBE A;  2ZEO A;  3GPG A;  5CB5 A;  4YU9 A;  2F8H A;  4MCQ A;  3EWQ A;  3H8F A;  2ZEP A;  1Y0R A;  2ZOG A;  4NGS A;  4ETJ A;  4UEZ A;  1PCA A;  3Q71 A;  4OC0 A;  4TU0 A;  3PBB A;  3RBU A;  5D29 A;  3S9L A;  3PRT A;  5IB9 A;  1R3N A;  1XJO A;  4UIA A;  4Z65 A;  2WYR A;  3PB4 X;  1ZLI A;  1Y7E A;  2PJ8 A;  3FEE A;  4OC5 A;  2HB6 A;  2V8H A;  3D7G A;  5DUS A;  1HEE A;  4P45 A;  4ZX8 A;  3B7I A;  1AMP A;  4OC2 A;  2RFH A;  4OIW A;  3S9N A;  3N5F A;  4A39 A;  2JBJ A;  1ZG7 A;  1VIX A;  3SII A;  1CG2 A;  2Q43 A;  4WJB A;  2ZEF A;  4IK2 A;  4GVW A;  1CPS A;  5CPA A;  3KGQ A;  2CTC A;  3NH5 A;  4PQA A;  5JGF A;  3SIH A;  4TNU A;  1FT7 A;  1TF8 A;  2AFU A;  4P4D A;  3D67 A;  3MN8 A;  4G1P A;  2AFZ A;  4FUU A;  2AFM A;  2WZN A;  3HLP A;  2OOT A;  2CIJ A;  2PCU A;  4EME A;  3T8W A;  2DX6 A;  3EKE A;  1HDQ A;  2FG1 A;  2NYQ A;  2PJA A;  4P4J A;  4O23 A;  5FSV A;  3ISZ A;  1Z8L A;  4JLL A;  1YD9 A;  2RB7 A;  3SJE A;  2PE3 A;  1CP6 A;  1ZG8 A;  2PVW A;  2XEJ A;  3B35 A;  3BXM A;  2CTB A;  4NGN A;  2XEF A;  4JGK A;  4K0C A;  3VH9 A;  2IMO A;  3KL9 A;  2FAV A;  4FAI A;  5LYL A;  3WC7 A;  2POK A;  2QJ8 A;  1QMU A;  3SJX A;  4X2T A;  3SJF A;  5J1Q A;  4JYW A;  1Q7L A;  4OID A;  3JRU A;  2Q4Z A;  5D8N A;  4NGM A;  5FSY A;  2FVG A;  4IAV A;  3GQE A;  6CPA A;  4F9U A;  4R76 A;  4P4E A;  3CPX A;  2GLF A;  1TXZ A;  1TKH A;  2ZEH A;  4DUK A;  2ZEG A;  4UML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...