4ZX9A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10b
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Probable M17 family aminopeptidase
total genus 176
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zx9A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zx9A02
4OC0A 2O53A 2L8RA 3PEIA 2GLJA 2POKA 3RAMA 4X2TA 4J5RA 5CBMA 4UEEA 2AFSA 5HXDA 2Q51A 4P44A 4DYOA 4OC1A 1UWYA 3FEEA 2C6GA 2ZEFA 1TF8A 1M4LA 2ZOFA 1XFOA 1FNOA 3SI0A 3B3CA 3WC6A 1TKJA 2V8VA 3FVLA 1H8LA 5J1QA 5HIHA 3FJUA 1BAVA 5D29A 4IHMA 3VH9A 1LFWA 4UIBA 5DUSA 3EKEA 1ZLIA 5LYLA 4OMEA 6CPAA 1GYTA 1TY8A 2V8DA 3K9TA 1CPSA 4Z65A 2ZEPA 2AFWA 2HC9A 2FVGA 2DX6A 1ARMA 3BXMA 3HUVA 2J9AA 2OOTA 4ZX9A 2Q4ZA 4F9UA 3NH4A 1YMEA 4R76A 3PFOA 4ZYQA 4X3RA 1JQGA 4PXCA 4ABLA 3PB8X 4J4ZA 1VGYA 3B7IA 4NGPA 2NSMA 2CIJA 3GPQA 3SIIA 2PIZA 4D86A 3V2BA 2V8GA 5LYIA 1TXZA 3CPAA 4P4EA 1RTQA 1TF9A 2C6CA 2ZELA 4MRIA 4FWUA 2AFZA 4NGNA 2PJ7A 4ONWA 5JGFA 1CP6A 1CP7A 4YWYA 4JVVA 5HVHA 1QQ9A 3ETIA 1HJZA 3FECA 4O23A 4GVVA 3IIFA 5LRJA 1VIXA 2PVVA 1Y0YA 3SJXA 2QVPA 4ZI6A 4OC4A 2HB6A 3CT9A 3D68A 2PRQA 2ZEDA 4F8ZA 2PVWA 5K8OA 3FF3A 3PBBA 1ZR3A 1F2PA 3SJGA 3SIJA 3LWUA 4G1PA 4R8FA 1YW4A 3RZAA 1HEEA 4IAVA 4FBEA 3SIHA 3K2KA 1VHEA 2O4HA 3B3TA 3LMSA 4MCPA 2FAVA 2BOAA 1OBRA 3D7GA 3SIGA 3SI1A 3B3VA 4WWVA 2C6PA 2IJZA 3S9LA 4ZX8A 2C1CA 4TWEA 3IC1A 3BI0A 2CTCA 1LOKA 3CPXA 1XBUA 1ZLHA 3KASA 5E3BA 1HDQA 3FMCA 1ZR5A 5FSYA 3SJEA 3EWQA 2PJCA 5HOLA 5FSXA 2AFOA 4BD9A 3EJFA 4OIDA 1Y7EA 3S9MA 1ZG7A 1CX8A 4A39A 3D7FA 1LANA 5CB5A 1NSAA 3FX6A 2I3CA 2ZEGA 2V8HA 4ETJA 2JBKA 3D67A 3KR5A 2GU2A 3IIBA 3D7DA 2F7VA 1VHOA 4EFDA 4A94A 4MHNA 4NGQA 4OKOA 3PRTA 4W9YA 1CG2A 3H8GA 3H8EA 4ZY0A 3IFEA 4MHPA 1IGBA 3EJGA 1CBXA 3WABA 2X47A 2ZENA 3KR4A 1HDUA 3BI1A 1TKHA 1YD9A 4P4JA 4UEFA 3MN8A 3DGVA 5LRGA 4OC3A 2RB7A 1SPVA 4MHYA 2PJAA 5CPAA 1DTDA 4AXVA 3DLJA 2XEGA 3B3SA 2PJ3A 4PQAA 4MHZA 3KHZA 7CPAA 4K3NA 3TX8A 4NGRA 1R3NA 2ZEMA 4A38A 4ZY1A 2V77A 1ELLP 4FAIA 2PJ9A 4P4BA 3B3WA 2JEWA 4P45A 3GQEA 2PJ8A 1XJOA 4MCQA 3KZWA 5F09A 4FUUA 3WC5A 3NH8A 1Z5RA 3SI2A 2FG1A 4NJQA 2VL1A 4UEZA 5FSZA 2PJ5A 3IJ3A 5JH9A 3IO1A 4JZ0A 3IIDA 3N5FA 2WZNA 4P4IA 4P10A 2ZOGA 8CPAA 5AILA 3D66A 3EW5A 3GPOA 2XEJA 4OC5A 5FSUA 3SJFA 3V38A 4NGTA 1Q7LA 3KQXA 2BCOA 4DUKA 2QJ8A 3IEHA 4MXUA 5LYDA 2GLFA 4CPAA 1BPNA 5LRKA 4K0CA 3D4UA 1FT7A 1KWMA 3ISZA 1CPXA 2ZEOA 1LCPA 3EWPA 4OIWA 3JRUA 2AFUA 4IK2A 1YLOA 4TU0A 2AFMA 4PPZA 4ESSA 3GLJA 1PYTB 1XRYA 2PJ4A 2VRIA 4R6TA 3QNVA 3S9NA 3EWOA 4PXBA 4TNUA 2ZEHA 3WC7A 1ZG9A 1DE4C 1PCAA 2ANPA 2PJ1A 1ARLA 2CTBA 4P4FA 1QMUA 4P6YA 1LAPA 1AYEA 1IY7A 4F9VA 3KQZA 1Z8LA 3BHXA 2OR4A 3VFQA 4ETKA 4JLLA 2PCUA 3V45A 2FXKA 5D8NA 4ABKA 2EK9A 4DJLA 2IMOA 4JYWA 1TKFA 3GQOA 1ZG8A 3PB4X 4NJRA 3I1UA 1XMBA 2WYRA 4RUHA 4JCAA 5K8PA 2PJ6A 1ELMP 4GUAA 1AMPA 4MCSA 2PE3A 3IWWA 3EWRA 4GM5A 5ELYA 1F57A 3VARA 4Q7AA 2XD7A 4EMEA 1EE3P 2F8HA 2JBJA 4YU9A 1BLLE 1YW6A 3NA6A 3D7HA 3GB0A 3Q71A 4OC2A 3TC8A 3Q6ZA 3GPGA 3PBEA 3VATA 5IB9A 4OP4A 4KYBA 4NGSA 5JM6A 2GREA 4J5QA 3NFZA 3MRUA 3T8WA 4PXEA 1Y0RA 5K8NA 4R7MA 3CDXA 4NFRA 1VHUA 1F2OA 4PXDA 1TXRA 2XEIA 4A37A 2DEAA 3L2NA 3H8FA 2PJBA 4UF4A 2EEEA 4MCRA 2CF4A 2G9DA 3NH5A 3RBUA 2LGRA 1YSJA 5CB3A 4P4DA 3KHXA 3WT4A 4KSIA 2IQ6A 5K8MA 2EWBA 2XEFA 2AFCA 3KGQA 4EWTA 4IQYA 4X8IA 1LAMA 3B2YA 3PB6X 1R43A 3HLPA 3PB7X 2ACFA 3FH4A 5THWA 4J5SA 5LYFA 1NJRA 3KL9A 4ZY2A 4B6ZA 2EK8A 2PIYA 5DS0A 3GUXA 2ZEEA 5CMSA 3PFEA 2AFXA 2PJ2A 3V7ZA 4H2KA 4LQGA 3FEDA 4GVWA 5I4MA 3JZTA 3KI9A 5HVFA 2PJ0A 2BFRA 2RFHA 4JGKA 3B35A 3ISXA 5HVGA 3PB9X 2NYQA 4UMLA 1Z2LA 2ABZA 2BFQA 4NGMA 2QYVA 1BPMA 5FSVA 4UIAA 2Q43A 4MMOA 4WJBA 2BO9A
chains in the Genus database with same CATH superfamily
5A28A 4OC0A 2O53A 2VI7A 2L8RA 3PEIA 2GLJA 2POKA 3RAMA 4X2TA 4J5RA 5CBMA 1YGHA 4UEEA 4EVYA 3GYAA 2AFSA 5HXDA 2Q51A 4P44A 1KUVA 2OB0A 4OC1A 4DYOA 1UWYA 1MK4A 2ARHA 3FEEA 4H6ZA 1IB1E 2C6GA 4B14A 2ZEFA 1TF8A 5ISVA 3CXPA 1KUYA 2FIWA 2K5TA 4JWPA 1M4LA 1Z4RA 1MJBA 2ZOFA 2VEZA 2Z3MA 1XFOA 1FNOA 3SI0A 3B3CA 3WC6A 1TKJA 2O28A 4CRYB 2QIRA 2V8VA 4C7HA 3FVLA 3SXOA 3D2MA 1H8LA 2D4PA 4YFJA 1P0HA 5J1QA 5HIHA 1I21A 3FJUA 1BAVA 5D29A 2I00A 3CZXA 4IHMA 3VH9A 4A95A 1WWZA 4RN7A 3T9YA 4H89A 1LFWA 5AGEA 4UIBA 5J8CA 3FBUA 5DUSA 3EKEA 5H86A 2PR8A 4RS2A 4FD7A 3S6HA 1ZO0A 1ZLIA 5LYLA 5F47A 4PV6A 5G21A 2FS5A 4M6GA 4OMEA 4LX9A 6CPAA 5IX3A 1GYTA 3GY9A 1TY8A 2V8DA 4MJ8A 3K9TA 1CPSA 4Z65A 2ZEPA 2AFWA 2HC9A 4C2ZA 2FVGA 2DX6A 4CYOA 1ARMA 4R87A 3BXMA 2CY2A 2J9AA 1B87A 3HUVA 4OLLA 2REFA 2OOTA 4ZX9A 5KTCA 3CXSA 4CYNA 2Q4ZA 2FXFA 4F9UA 1YVKA 3NH4A 2P6EA 1YMEA 4R76A 3PFOA 4C2YA 4ZYQA 4PSWA 4X3RA 5EC4A 3WR7A 1JQGA 4PXCA 3I3GA 3ZZIA 4ABLA 3PB8X 3D8PA 3TO9A 1M1DA 4J4ZA 1VKCA 1VGYA 4KS9A 2B4BA 3B7IA 5H84A 4NGPA 2NSMA 3IU1A 2CIJA 2Z3KA 3GPQA 3SIIA 2PIZA 4D86A 3BLNA 3A9LA 3V2BA 4CAFA 2V8GA 2ZW7A 4CAXA 1NSLA 1A2ZA 1TXZA 1S7KA 5LYIA 1IYKA 3CPAA 4P4EA 4R3KA 1XOVA 1RTQA 3I9SA 1V0CA 1TF9A 4B12A 2G3AA 2C6CA 1Y9WA 3TOAA 2WCTA 2ZELA 3EC4A 4MRIA 4FWUA 2ZW6A 4JLYA 4B13A 3KKWA 4X5KA 4OADA 3GKRA 1YLEA 2C27A 2AFZA 4R3LA 4NGNA 2PJ7A 2X7BA 4ONWA 3TT2A 3W6SA 5JGFA 4Y49C 4KOYA 4KUAA 4AVCA 1CP6A 1CP7A 1ON0A 3BJ8A 4JVVA 4YWYA 2CNTA 5HVHA 1QQ9A 1Z4EA 4NEXA 2VQYA 3ETIA 2FCKA 3SXNA 1HJZA 2OZGA 3FECA 4O23A 5EBVA 4FD5A 4GVVA 3IIFA 4KOUA 5LRJA 1VIXA 2PVVA 1Y0YA 2J8NA 4E0AA 5AG6A 3SJXA 2QVPA 3LACA 4ZI6A 4GXHA 1MJ9A 4C68A 3EY5A 4OC4A 2REEA 2HB6A 3CT9A 3D68A 3W6XA 2J8RA 1GHEA 5I0CA 2PRQA 2ZEDA 4F8ZA 4FD6A 2PVWA 2B5GA 5K8OA 3FF3A 3PBBA 1ZR3A 2VZYA 4KOWA 1F2PA 3SJGA 3SIJA 2Y0MA 3LWUA 4G1PA 4CGNA 1IYLA 4C2XA 4R8FA 2CNMA 1YW4A 4UCMA 3TO6A 3RZAA 1HEEA 4IAVA 1S7NA 4FBEA 3ZJ0A 3SIHA 3K2KA 1VHEA 3RO0A 1QSTA 2O4HA 4HNWB 1I12A 1M4DA 1IIDA 2KCWA 3B3TA 4XPDC 2Q44A 3LMSA 4KLWA 4MCPA 2FAVA 2BOAA 2YGWA 4MFKA 4K30A 1NE9A 1OBRA 3D7GA 4YRHA 3SIGA 3CXQA 2B58A 3N7ZA 4UFWA 1BO4A 2HUZA 3SI1A 2Z3NA 3B3VA 4WWVA 4CAEA 2C6PA 2QECA 4KVXA 3R1KA 4JXRA 5IB0A 3FB3A 3QAHA 1FY7A 2IJZA 4MFQA 4ZX8A 4QUSA 3R95A 2C1CA 4TWEA 3IC1A 3BI0A 4JXQA 3R9GA 1XEBA 2CTCA 1LOKA 3CPXA 3EO4A 1XBUA 1ZLHA 2A4NA 3KASA 5E3BA 1HDQA 3D3SA 4KSAA 3JVNA 3FMCA 1ZR5A 4UCNA 4CGLA 5FSYA 2EBJA 3SJEA 2VZZA 5C88A 3EWQA 5E96A 2PJCA 1QSRA 2P0WA 1IU8A 4U5YA 4OAEA 5HOLA 5FSXA 1K4JA 2AFOA 2PC1A 4BD9A 5KTDA 4QBJA 4E2AA 4HKFA 3EJFA 4OIDA 4HPSA 1Y7EA 3S9MA 2CXAA 4L8AA 3S6FA 4UBRA 1ZG7A 1CX8A 1OZPA 2YNCC 4BBHA 4A39A 1Z8TA 3D7FA 5HMNA 1LANA 5CB5A 1NSAA 3FX6A 4U9YA 4IF5A 4PSXA 2I3CA 2ZEGA 3RNZA 2V8HA 4XPKA 4ETJA 2DF5A 2JBKA 3D67A 4A32A 3KR5A 2GU2A 5JPHA 3IIBA 4B5PB 3D7DA 3PZJA 2B4DB 2F7VA 5J8FA 1VHOA 3PP9A 2ZPAA 4EFDA 2W2GA 4M3SA 3DSBA 4MHNA 5F48A 4A94A 4NGQA 4OKOA 4CGPA 4II9A 2B3VA 1XIXA 3PRTA 1CG2A 4W9YA 2R7HA 3H8GA 3H8EA 4ZY0A 3IFEA 4MHPA 1IGBA 1YREA 3EJGA 1CBXA 3WABA 2X47A 2ZENA 3F5BA 2D4OA 2QMLA 2WPWA 4KOVA 4NCZA 3KR4A 1HDUA 4KLVA 5G22A 3BI1A 1TKHA 1YD9A 3DDDA 4P4JA 3MN8A 4UEFA 1XE4A 2BUEA 3DGVA 5LRGA 4OC3A 2RB7A 4R9MA 5BWAB 1SPVA 1NMTA 2PJAA 3OWCA 1DTDA 4MHYA 5CPAA 2G0BA 4F6AA 3PGPA 4AXVA 5G1ZA 3DLJA 2XEGA 3B3SA 2PJ3A 4PQAA 4MHZA 4CRZB 2Z3PA 1X10A 2PSWA 2YNEA 3KHZA 7CPAA 4K3NA 5EMIA 4YGOA 3TX8A 2JDDA 2J8MA 4NGRA 1R3NA 3RYOA 2ZEMA 4UCPA 2PR1A 1YQEA 4A38A 4C7IA 4ZY1A 2V77A 3VWDA 1ELLP 4FAIA 2PJ9A 5DWMA 4P4BA 3B3WA 2JEWA 2OU2A 3GQEA 3QAYA 4M6IA 4MFLA 4P45A 4GS4A 4QC6A 2PJ8A 1XJOA 2YNCA 4MCQA 4LUAA 4R57A 3KZWA 5F09A 4FUUA 3WC5A 4IUSA 2JZFA 4KOXA 1Q2YA 4LQ6A 1P4NA 4AG9A 3NH8A 1Z5RA 3SI2A 2FG1A 4NJQA 2VL1A 4UEZA 2GIVA 5FSZA 5G20A 2PJ5A 1KUXA 4Y49B 3IJ3A 5JH9A 5HH1A 3IO1A 4JZ0A 1IOIA 3IIDA 3B8GA 3TTHA 2YNDA 3N5FA 2WZNA 1YVOA 4AG7A 4P4IA 3TE4A 1KZFA 4NF1A 3JTKA 2ZOGA 4P10A 2WUUA 3DR8A 8CPAA 1Y7RA 4KORA 2HV2A 5F49A 5AILA 3D66A 3EW5A 3GPOA 2XEJA 4OC5A 1L0CA 4UA3A 5FSUA 1S3ZA 3SJFA 3V38A 4NGTA 5CNPA 1YR0A 4ONUA 3H4QA 1Q7LA 3MGDA 4UWIA 4MFZA 3FRMA 3KQXA 2BCOA 4DUKA 2RNKA 1QSNA 2ATRA 2QJ8A 2R1IA 4L89A 5C82A 3H5ZA 5DWNA 3IEHA 3IWEA 4MXUA 2GLFA 5LYDA 4CPAA 2FIAA 2JZDA 1Z9UA 1BPNA 3FNCA 2AE6A 5LRKA 4K0CA 4KOSA 3D4UA 3R96A 1FT7A 1KWMA 3ISZA 4A30A 4KOTA 1CPXA 2ZEOA 1LCPA 3EWPA 4OIWA 3JRUA 2AFUA 2VXKA 3P2FA 5A27A 4IK2A 1YLOA 4TU0A 2ZW4A 2ZXVA 2AFMA 2FSRA 4ESSA 4PPZA 3GLJA 1TIQA 2B3UA 1PYTB 1XRYA 2PJ4A 1YX0A 2CNSA 1I1DA 2VRIA 4R6TA 3QNVA 2G3TA 3F8KA 2JLMA 3EWOA 3IGRA 4PXBA 3S9NA 4TNUA 2ZEHA 3WC7A 1ZG9A 2Q04A 4Q36A 1DE4C 1PCAA 2ANPA 4F0XA 1U6MA 2PJ1A 1ARLA 4PK3A 4ZBGA 2CTBA 2OH1A 2Z3LA 4P4FA 1YK3A 1QMUA 4A33A 4P6YA 5KTAA 1LAPA 1AYEA 1IY7A 4F9VA 2AJ6A 3TFYA 3KQZA 4J3GA 1Z8LA 3BHXA 4NSQA 2PRBA 2OR4A 3VFQA 4ETKA 2B4DA 3FXTA 1CJWA 4JLLA 2PCUA 3C26A 3V45A 4AVAA 4QB9A 2OZHA 3NE7A 2FXKA 5D8NA 4ABKA 1BOBA 2Z3OA 2EK9A 4DJLA 2IMOA 4JYWA 2KQVA 1TKFA 4DNCA 3GQOA 1ZG8A 3PB4X 1Q2CA 4NJRA 3I1UA 1Z8XA 1XMBA 4U9ZA 2WYRA 4RUHA 4I49A 4JCAA 1PUAA 1IOFA 1QSOA 4NXYA 2Q7SA 5K8PA 2PJ6A 1ELMP 4GUAA 3G8WA 4HNXB 1AMPA 2BEIA 2ZW5A 4A31A 4MCSA 4B10A 3TCVA 2DXQA 4H6UA 3R9EA 1RO5A 4F0YA 2PE3A 2R98A 3EWRA 3IWWA 2BL1A 4GM5A 5ELYA 4A2ZA 2HQYA 1B6BA 4B5PA 3G3SA 1F57A 3VARA 2EUIA 3P2HA 4Q7AA 2XD7A 3VWEA 4EMEA 1IICA 1RXTA 1EE3P 2Q7BA 4CGMA 2F8HA 2JBJA 4Q38A 2R8VA 3GIUA 4YU9A 1BLLE 1YW6A 3NA6A 5AG4A 3D7HA 3GB0A 4M6HA 3Q71A 2IL4A 2PQ8A 3JUWA 4AVBA 1Q2DA 4OC2A 4E8OA 3TC8A 3F0AA 1XMTA 4KSFA 3Q6ZA 2GE3A 3GPGA 4MY3A 2BSWA 3PBEA 3VATA 5IB9A 5GCNA 4OP4A 4KYBA 3FIXA 4NGSA 4XPLA 4CS0B 2GREA 3DR6A 4J5QA 4MY0A 2Z0ZA 5JM6A 1XF8A 3NFZA 1S60A 3MRUA 3T8WA 1AUGA 5F46A 2VBQA 1X12A 4PXEA 5IV0A 5JQ4A 4XNHB 3QB8A 4CYQA 1Z8WA 1Y0RA 5K8NA 4R7MA 2GANA 3LD2A 2EVNA 2F5IA 3CDXA 4MHDA 1SQHA 4NFRA 4JD6A 4MI4A 1VHUA 1F2OA 4PXDA 4HNYB 4B5OA 1TXRA 1M4GA 2XEIA 3TOBA 1CM0A 1S7FA 4A37A 2RC4A 2DEAA 3L2NA 4AB7A 4FD4A 3H8FA 2B5GB 2PJBA 3S6GA 1UFHA 4M85A 2EEEA 4UF4A 5AG5A 2FT0A 4MCRA 2CF4A 2G9DA 3NH5A 2PDOA 2Z10A 2LGRA 3DNSA 3RBUA 1YSJA 5CB3A 2DPTA 1R57A 4P4DA 3TO7A 1N71A 3S6KA 4UWJA 4CAVA 3KHXA 2Q4YA 3K9UA 1S5KA 3WT4A 4MFJA 4KVOE 4KSIA 2Q4VA 4UFVA 2WSAA 4PK2A 2IQ6A 3V8IA 3S9LA 5K8MA 2EWBA 2XEFA 2AFCA 3KGQA 4EWTA 2NMTA 4IQYA 4X8IA 1LAMA 2OZUA 3IWGA 3LODA 2I79A 2DPSA 1LRZA 2JEVA 3B2YA 4KUBA 3PB6X 1R43A 3W91A 2FL4A 3R9FA 2ODFA 3HLPA 3PB7X 2ACFA 4BINA 4KZTA 3FH4A 4QVTA 5THWA 1J4JA 2EO8A 4J5SA 3IU2A 4MBUA 5LYFA 1VHSA 1NJRA 4ORFA 3FYNA 3T90A 3KL9A 4ZY2A 4B6ZA 4CAWA 2EK8A 2PIYA 4UFXA 3GUXA 5DS0A 4XPDB 4XNHC 4CYPA 5AG7A 4JJXA 2ZEEA 2GFQA 1S7LA 5CMSA 3PFEA 3EXNA 1WK4A 2AFXA 3NE8A 2JZEA 4BMHA 2PJ2A 5FVJA 4CGOA 3SHPA 2JDCA 3E0KA 3V7ZA 4H2KA 1PU9A 4LQGA 3FEDA 4GVWA 3D2PA 4RI1A 5I4MA 3JZTA 2H5MA 3KI9A 5HVFA 2PJ0A 4ZGYB 2BFRA 1M4IA 4MFPA 2WPXA 1Y9KA 4JGKA 2FE7A 2RFHA 3B35A 2P6FA 1MJAA 3BJ7A 3ISXA 5HVGA 2Q0YA 3UY5A 3PB9X 4KVME 2NYQA 4UMLA 1Z2LA 2ABZA 2BFQA 1M44A 2Z11A 3EFAA 4NGMA 1QSMA 2QYVA 1BPMA 5FSVA 2P6GA 4B11A 4UIAA 2Q43A 4MMOA 1JWQA 4WJBA 2BO9A
chains in the Genus database with same CATH topology
4OC0A 2O53A 2L8RA 3PEIA 2GLJA 2POKA 3RAMA 4X2TA 4J5RA 5CBMA 4UEEA 2AFSA 5HXDA 2Q51A 4P44A 4DYOA 4OC1A 1UWYA 3FEEA 2C6GA 2ZEFA 1TF8A 1M4LA 2ZOFA 1XFOA 1FNOA 3SI0A 3B3CA 3WC6A 1TKJA 2V8VA 3FVLA 1H8LA 5J1QA 5HIHA 3FJUA 1BAVA 5D29A 4IHMA 3VH9A 1LFWA 4UIBA 5DUSA 3EKEA 1ZLIA 5LYLA 4OMEA 6CPAA 1GYTA 1TY8A 2V8DA 3K9TA 1CPSA 4Z65A 2ZEPA 2AFWA 2HC9A 2FVGA 2DX6A 1ARMA 3BXMA 3HUVA 2J9AA 2OOTA 4ZX9A 2Q4ZA 4F9UA 3NH4A 1YMEA 4R76A 3PFOA 4ZYQA 4X3RA 1JQGA 4PXCA 4ABLA 3PB8X 4J4ZA 1VGYA 3B7IA 4NGPA 2NSMA 2CIJA 3GPQA 3SIIA 2PIZA 4D86A 3V2BA 2V8GA 5LYIA 1TXZA 3CPAA 4P4EA 1RTQA 1TF9A 2C6CA 2ZELA 4MRIA 4FWUA 2AFZA 4NGNA 2PJ7A 4ONWA 5JGFA 1CP6A 1CP7A 4YWYA 4JVVA 5HVHA 1QQ9A 3ETIA 1HJZA 3FECA 4O23A 4GVVA 3IIFA 5LRJA 1VIXA 2PVVA 1Y0YA 3SJXA 2QVPA 4ZI6A 4OC4A 2HB6A 3CT9A 3D68A 2PRQA 2ZEDA 4F8ZA 2PVWA 5K8OA 3FF3A 3PBBA 1ZR3A 1F2PA 3SJGA 3SIJA 3LWUA 4G1PA 4R8FA 1YW4A 3RZAA 1HEEA 4IAVA 4FBEA 3SIHA 3K2KA 1VHEA 2O4HA 3B3TA 3LMSA 4MCPA 2FAVA 2BOAA 1OBRA 3D7GA 3SIGA 3SI1A 3B3VA 4WWVA 2C6PA 2IJZA 3S9LA 4ZX8A 2C1CA 4TWEA 3IC1A 3BI0A 2CTCA 1LOKA 3CPXA 1XBUA 1ZLHA 3KASA 5E3BA 1HDQA 3FMCA 1ZR5A 5FSYA 3SJEA 3EWQA 2PJCA 5HOLA 5FSXA 2AFOA 4BD9A 3EJFA 4OIDA 1Y7EA 3S9MA 1ZG7A 1CX8A 4A39A 3D7FA 1LANA 5CB5A 1NSAA 3FX6A 2I3CA 2ZEGA 2V8HA 4ETJA 2JBKA 3D67A 3KR5A 2GU2A 3IIBA 3D7DA 2F7VA 1VHOA 4EFDA 4A94A 4MHNA 4NGQA 4OKOA 3PRTA 4W9YA 1CG2A 3H8GA 3H8EA 4ZY0A 3IFEA 4MHPA 1IGBA 3EJGA 1CBXA 3WABA 2X47A 2ZENA 3KR4A 1HDUA 3BI1A 1TKHA 1YD9A 4P4JA 4UEFA 3MN8A 3DGVA 5LRGA 4OC3A 2RB7A 1SPVA 4MHYA 2PJAA 5CPAA 1DTDA 4AXVA 3DLJA 2XEGA 3B3SA 2PJ3A 4PQAA 4MHZA 3KHZA 7CPAA 4K3NA 3TX8A 4NGRA 1R3NA 2ZEMA 4A38A 4ZY1A 2V77A 1ELLP 4FAIA 2PJ9A 4P4BA 3B3WA 2JEWA 4P45A 3GQEA 2PJ8A 1XJOA 4MCQA 3KZWA 5F09A 4FUUA 3WC5A 3NH8A 1Z5RA 3SI2A 2FG1A 4NJQA 2VL1A 4UEZA 5FSZA 2PJ5A 3IJ3A 5JH9A 3IO1A 4JZ0A 3IIDA 3N5FA 2WZNA 4P4IA 4P10A 2ZOGA 8CPAA 5AILA 3D66A 3EW5A 3GPOA 2XEJA 4OC5A 5FSUA 3SJFA 3V38A 4NGTA 1Q7LA 3KQXA 2BCOA 4DUKA 2QJ8A 3IEHA 4MXUA 5LYDA 2GLFA 4CPAA 1BPNA 5LRKA 4K0CA 3D4UA 1FT7A 1KWMA 3ISZA 1CPXA 2ZEOA 1LCPA 3EWPA 4OIWA 3JRUA 2AFUA 4IK2A 1YLOA 4TU0A 2AFMA 4PPZA 4ESSA 3GLJA 1PYTB 1XRYA 2PJ4A 2VRIA 4R6TA 3QNVA 3S9NA 3EWOA 4PXBA 4TNUA 2ZEHA 3WC7A 1ZG9A 1DE4C 1PCAA 2ANPA 2PJ1A 1ARLA 2CTBA 4P4FA 1QMUA 4P6YA 1LAPA 1AYEA 1IY7A 4F9VA 3KQZA 1Z8LA 3BHXA 2OR4A 3VFQA 4ETKA 4JLLA 2PCUA 3V45A 2FXKA 5D8NA 4ABKA 2EK9A 4DJLA 2IMOA 4JYWA 1TKFA 3GQOA 1ZG8A 3PB4X 4NJRA 3I1UA 1XMBA 2WYRA 4RUHA 4JCAA 5K8PA 2PJ6A 1ELMP 4GUAA 1AMPA 4MCSA 2PE3A 3IWWA 3EWRA 4GM5A 5ELYA 1F57A 3VARA 4Q7AA 2XD7A 4EMEA 1EE3P 2F8HA 2JBJA 4YU9A 1BLLE 1YW6A 3NA6A 3D7HA 3GB0A 3Q71A 4OC2A 3TC8A 3Q6ZA 3GPGA 3PBEA 3VATA 5IB9A 4OP4A 4KYBA 4NGSA 5JM6A 2GREA 4J5QA 3NFZA 3MRUA 3T8WA 4PXEA 1Y0RA 5K8NA 4R7MA 3CDXA 4NFRA 1VHUA 1F2OA 4PXDA 1TXRA 2XEIA 4A37A 2DEAA 3L2NA 3H8FA 2PJBA 4UF4A 2EEEA 4MCRA 2CF4A 2G9DA 3NH5A 3RBUA 2LGRA 1YSJA 5CB3A 4P4DA 3KHXA 3WT4A 4KSIA 2IQ6A 5K8MA 2EWBA 2XEFA 2AFCA 3KGQA 4EWTA 4IQYA 4X8IA 1LAMA 3B2YA 3PB6X 1R43A 3HLPA 3PB7X 2ACFA 3FH4A 5THWA 4J5SA 5LYFA 1NJRA 3KL9A 4ZY2A 4B6ZA 2EK8A 2PIYA 5DS0A 3GUXA 2ZEEA 5CMSA 3PFEA 2AFXA 2PJ2A 3V7ZA 4H2KA 4LQGA 3FEDA 4GVWA 5I4MA 3JZTA 3KI9A 5HVFA 2PJ0A 2BFRA 2RFHA 4JGKA 3B35A 3ISXA 5HVGA 3PB9X 2NYQA 4UMLA 1Z2LA 2ABZA 2BFQA 4NGMA 2QYVA 1BPMA 5FSVA 4UIAA 2Q43A 4MMOA 4WJBA 2BO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OC0 A;  2O53 A;  2L8R A;  3PEI A;  2GLJ A;  2POK A;  3RAM A;  4X2T A;  4J5R A;  5CBM A;  4UEE A;  2AFS A;  5HXD A;  2Q51 A;  4P44 A;  4DYO A;  4OC1 A;  1UWY A;  3FEE A;  2C6G A;  2ZEF A;  1TF8 A;  1M4L A;  2ZOF A;  1XFO A;  1FNO A;  3SI0 A;  3B3C A;  3WC6 A;  1TKJ A;  2V8V A;  3FVL A;  1H8L A;  5J1Q A;  5HIH A;  3FJU A;  1BAV A;  5D29 A;  4IHM A;  3VH9 A;  1LFW A;  4UIB A;  5DUS A;  3EKE A;  1ZLI A;  5LYL A;  4OME A;  6CPA A;  1GYT A;  1TY8 A;  2V8D A;  3K9T A;  1CPS A;  4Z65 A;  2ZEP A;  2AFW A;  2HC9 A;  2FVG A;  2DX6 A;  1ARM A;  3BXM A;  3HUV A;  2J9A A;  2OOT A;  4ZX9 A;  2Q4Z A;  4F9U A;  3NH4 A;  1YME A;  4R76 A;  3PFO A;  4ZYQ A;  4X3R A;  1JQG A;  4PXC A;  4ABL A;  3PB8 X;  4J4Z A;  1VGY A;  3B7I A;  4NGP A;  2NSM A;  2CIJ A;  3GPQ A;  3SII A;  2PIZ A;  4D86 A;  3V2B A;  2V8G A;  5LYI A;  1TXZ A;  3CPA A;  4P4E A;  1RTQ A;  1TF9 A;  2C6C A;  2ZEL A;  4MRI A;  4FWU A;  2AFZ A;  4NGN A;  2PJ7 A;  4ONW A;  5JGF A;  1CP6 A;  1CP7 A;  4YWY A;  4JVV A;  5HVH A;  1QQ9 A;  3ETI A;  1HJZ A;  3FEC A;  4O23 A;  4GVV A;  3IIF A;  5LRJ A;  1VIX A;  2PVV A;  1Y0Y A;  3SJX A;  2QVP A;  4ZI6 A;  4OC4 A;  2HB6 A;  3CT9 A;  3D68 A;  2PRQ A;  2ZED A;  4F8Z A;  2PVW A;  5K8O A;  3FF3 A;  3PBB A;  1ZR3 A;  1F2P A;  3SJG A;  3SIJ A;  3LWU A;  4G1P A;  4R8F A;  1YW4 A;  3RZA A;  1HEE A;  4IAV A;  4FBE A;  3SIH A;  3K2K A;  1VHE A;  2O4H A;  3B3T A;  3LMS A;  4MCP A;  2FAV A;  2BOA A;  1OBR A;  3D7G A;  3SIG A;  3SI1 A;  3B3V A;  4WWV A;  2C6P A;  2IJZ A;  3S9L A;  4ZX8 A;  2C1C A;  4TWE A;  3IC1 A;  3BI0 A;  2CTC A;  1LOK A;  3CPX A;  1XBU A;  1ZLH A;  3KAS A;  5E3B A;  1HDQ A;  3FMC A;  1ZR5 A;  5FSY A;  3SJE A;  3EWQ A;  2PJC A;  5HOL A;  5FSX A;  2AFO A;  4BD9 A;  3EJF A;  4OID A;  1Y7E A;  3S9M A;  1ZG7 A;  1CX8 A;  4A39 A;  3D7F A;  1LAN A;  5CB5 A;  1NSA A;  3FX6 A;  2I3C A;  2ZEG A;  2V8H A;  4ETJ A;  2JBK A;  3D67 A;  3KR5 A;  2GU2 A;  3IIB A;  3D7D A;  2F7V A;  1VHO A;  4EFD A;  4A94 A;  4MHN A;  4NGQ A;  4OKO A;  3PRT A;  4W9Y A;  1CG2 A;  3H8G A;  3H8E A;  4ZY0 A;  3IFE A;  4MHP A;  1IGB A;  3EJG A;  1CBX A;  3WAB A;  2X47 A;  2ZEN A;  3KR4 A;  1HDU A;  3BI1 A;  1TKH A;  1YD9 A;  4P4J A;  4UEF A;  3MN8 A;  3DGV A;  5LRG A;  4OC3 A;  2RB7 A;  1SPV A;  4MHY A;  2PJA A;  5CPA A;  1DTD A;  4AXV A;  3DLJ A;  2XEG A;  3B3S A;  2PJ3 A;  4PQA A;  4MHZ A;  3KHZ A;  7CPA A;  4K3N A;  3TX8 A;  4NGR A;  1R3N A;  2ZEM A;  4A38 A;  4ZY1 A;  2V77 A;  1ELL P;  4FAI A;  2PJ9 A;  4P4B A;  3B3W A;  2JEW A;  4P45 A;  3GQE A;  2PJ8 A;  1XJO A;  4MCQ A;  3KZW A;  5F09 A;  4FUU A;  3WC5 A;  3NH8 A;  1Z5R A;  3SI2 A;  2FG1 A;  4NJQ A;  2VL1 A;  4UEZ A;  5FSZ A;  2PJ5 A;  3IJ3 A;  5JH9 A;  3IO1 A;  4JZ0 A;  3IID A;  3N5F A;  2WZN A;  4P4I A;  4P10 A;  2ZOG A;  8CPA A;  5AIL A;  3D66 A;  3EW5 A;  3GPO A;  2XEJ A;  4OC5 A;  5FSU A;  3SJF A;  3V38 A;  4NGT A;  1Q7L A;  3KQX A;  2BCO A;  4DUK A;  2QJ8 A;  3IEH A;  4MXU A;  5LYD A;  2GLF A;  4CPA A;  1BPN A;  5LRK A;  4K0C A;  3D4U A;  1FT7 A;  1KWM A;  3ISZ A;  1CPX A;  2ZEO A;  1LCP A;  3EWP A;  4OIW A;  3JRU A;  2AFU A;  4IK2 A;  1YLO A;  4TU0 A;  2AFM A;  4PPZ A;  4ESS A;  3GLJ A;  1PYT B;  1XRY A;  2PJ4 A;  2VRI A;  4R6T A;  3QNV A;  3S9N A;  3EWO A;  4PXB A;  4TNU A;  2ZEH A;  3WC7 A;  1ZG9 A;  1DE4 C;  1PCA A;  2ANP A;  2PJ1 A;  1ARL A;  2CTB A;  4P4F A;  1QMU A;  4P6Y A;  1LAP A;  1AYE A;  1IY7 A;  4F9V A;  3KQZ A;  1Z8L A;  3BHX A;  2OR4 A;  3VFQ A;  4ETK A;  4JLL A;  2PCU A;  3V45 A;  2FXK A;  5D8N A;  4ABK A;  2EK9 A;  4DJL A;  2IMO A;  4JYW A;  1TKF A;  3GQO A;  1ZG8 A;  3PB4 X;  4NJR A;  3I1U A;  1XMB A;  2WYR A;  4RUH A;  4JCA A;  5K8P A;  2PJ6 A;  1ELM P;  4GUA A;  1AMP A;  4MCS A;  2PE3 A;  3IWW A;  3EWR A;  4GM5 A;  5ELY A;  1F57 A;  3VAR A;  4Q7A A;  2XD7 A;  4EME A;  1EE3 P;  2F8H A;  2JBJ A;  4YU9 A;  1BLL E;  1YW6 A;  3NA6 A;  3D7H A;  3GB0 A;  3Q71 A;  4OC2 A;  3TC8 A;  3Q6Z A;  3GPG A;  3PBE A;  3VAT A;  5IB9 A;  4OP4 A;  4KYB A;  4NGS A;  5JM6 A;  2GRE A;  4J5Q A;  3NFZ A;  3MRU A;  3T8W A;  4PXE A;  1Y0R A;  5K8N A;  4R7M A;  3CDX A;  4NFR A;  1VHU A;  1F2O A;  4PXD A;  1TXR A;  2XEI A;  4A37 A;  2DEA A;  3L2N A;  3H8F A;  2PJB A;  4UF4 A;  2EEE A;  4MCR A;  2CF4 A;  2G9D A;  3NH5 A;  3RBU A;  2LGR A;  1YSJ A;  5CB3 A;  4P4D A;  3KHX A;  3WT4 A;  4KSI A;  2IQ6 A;  5K8M A;  2EWB A;  2XEF A;  2AFC A;  3KGQ A;  4EWT A;  4IQY A;  4X8I A;  1LAM A;  3B2Y A;  3PB6 X;  1R43 A;  3HLP A;  3PB7 X;  2ACF A;  3FH4 A;  5THW A;  4J5S A;  5LYF A;  1NJR A;  3KL9 A;  4ZY2 A;  4B6Z A;  2EK8 A;  2PIY A;  5DS0 A;  3GUX A;  2ZEE A;  5CMS A;  3PFE A;  2AFX A;  2PJ2 A;  3V7Z A;  4H2K A;  4LQG A;  3FED A;  4GVW A;  5I4M A;  3JZT A;  3KI9 A;  5HVF A;  2PJ0 A;  2BFR A;  2RFH A;  4JGK A;  3B35 A;  3ISX A;  5HVG A;  3PB9 X;  2NYQ A;  4UML A;  1Z2L A;  2ABZ A;  2BFQ A;  4NGM A;  2QYV A;  1BPM A;  5FSV A;  4UIA A;  2Q43 A;  4MMO A;  4WJB A;  2BO9 A; 
#chains in the Genus database with same CATH topology
 5A28 A;  4OC0 A;  2O53 A;  2VI7 A;  2L8R A;  3PEI A;  2GLJ A;  2POK A;  3RAM A;  4X2T A;  4J5R A;  5CBM A;  1YGH A;  4UEE A;  4EVY A;  3GYA A;  2AFS A;  5HXD A;  2Q51 A;  4P44 A;  1KUV A;  2OB0 A;  4OC1 A;  4DYO A;  1UWY A;  1MK4 A;  2ARH A;  3FEE A;  4H6Z A;  1IB1 E;  2C6G A;  4B14 A;  2ZEF A;  1TF8 A;  5ISV A;  3CXP A;  1KUY A;  2FIW A;  2K5T A;  4JWP A;  1M4L A;  1Z4R A;  1MJB A;  2ZOF A;  2VEZ A;  2Z3M A;  1XFO A;  1FNO A;  3SI0 A;  3B3C A;  3WC6 A;  1TKJ A;  2O28 A;  4CRY B;  2QIR A;  2V8V A;  4C7H A;  3FVL A;  3SXO A;  3D2M A;  1H8L A;  2D4P A;  4YFJ A;  1P0H A;  5J1Q A;  5HIH A;  1I21 A;  3FJU A;  1BAV A;  5D29 A;  2I00 A;  3CZX A;  4IHM A;  3VH9 A;  4A95 A;  1WWZ A;  4RN7 A;  3T9Y A;  4H89 A;  1LFW A;  5AGE A;  4UIB A;  5J8C A;  3FBU A;  5DUS A;  3EKE A;  5H86 A;  2PR8 A;  4RS2 A;  4FD7 A;  3S6H A;  1ZO0 A;  1ZLI A;  5LYL A;  5F47 A;  4PV6 A;  5G21 A;  2FS5 A;  4M6G A;  4OME A;  4LX9 A;  6CPA A;  5IX3 A;  1GYT A;  3GY9 A;  1TY8 A;  2V8D A;  4MJ8 A;  3K9T A;  1CPS A;  4Z65 A;  2ZEP A;  2AFW A;  2HC9 A;  4C2Z A;  2FVG A;  2DX6 A;  4CYO A;  1ARM A;  4R87 A;  3BXM A;  2CY2 A;  2J9A A;  1B87 A;  3HUV A;  4OLL A;  2REF A;  2OOT A;  4ZX9 A;  5KTC A;  3CXS A;  4CYN A;  2Q4Z A;  2FXF A;  4F9U A;  1YVK A;  3NH4 A;  2P6E A;  1YME A;  4R76 A;  3PFO A;  4C2Y A;  4ZYQ A;  4PSW A;  4X3R A;  5EC4 A;  3WR7 A;  1JQG A;  4PXC A;  3I3G A;  3ZZI A;  4ABL A;  3PB8 X;  3D8P A;  3TO9 A;  1M1D A;  4J4Z A;  1VKC A;  1VGY A;  4KS9 A;  2B4B A;  3B7I A;  5H84 A;  4NGP A;  2NSM A;  3IU1 A;  2CIJ A;  2Z3K A;  3GPQ A;  3SII A;  2PIZ A;  4D86 A;  3BLN A;  3A9L A;  3V2B A;  4CAF A;  2V8G A;  2ZW7 A;  4CAX A;  1NSL A;  1A2Z A;  1TXZ A;  1S7K A;  5LYI A;  1IYK A;  3CPA A;  4P4E A;  4R3K A;  1XOV A;  1RTQ A;  3I9S A;  1V0C A;  1TF9 A;  4B12 A;  2G3A A;  2C6C A;  1Y9W A;  3TOA A;  2WCT A;  2ZEL A;  3EC4 A;  4MRI A;  4FWU A;  2ZW6 A;  4JLY A;  4B13 A;  3KKW A;  4X5K A;  4OAD A;  3GKR A;  1YLE A;  2C27 A;  2AFZ A;  4R3L A;  4NGN A;  2PJ7 A;  2X7B A;  4ONW A;  3TT2 A;  3W6S A;  5JGF A;  4Y49 C;  4KOY A;  4KUA A;  4AVC A;  1CP6 A;  1CP7 A;  1ON0 A;  3BJ8 A;  4JVV A;  4YWY A;  2CNT A;  5HVH A;  1QQ9 A;  1Z4E A;  4NEX A;  2VQY A;  3ETI A;  2FCK A;  3SXN A;  1HJZ A;  2OZG A;  3FEC A;  4O23 A;  5EBV A;  4FD5 A;  4GVV A;  3IIF A;  4KOU A;  5LRJ A;  1VIX A;  2PVV A;  1Y0Y A;  2J8N A;  4E0A A;  5AG6 A;  3SJX A;  2QVP A;  3LAC A;  4ZI6 A;  4GXH A;  1MJ9 A;  4C68 A;  3EY5 A;  4OC4 A;  2REE A;  2HB6 A;  3CT9 A;  3D68 A;  3W6X A;  2J8R A;  1GHE A;  5I0C A;  2PRQ A;  2ZED A;  4F8Z A;  4FD6 A;  2PVW A;  2B5G A;  5K8O A;  3FF3 A;  3PBB A;  1ZR3 A;  2VZY A;  4KOW A;  1F2P A;  3SJG A;  3SIJ A;  2Y0M A;  3LWU A;  4G1P A;  4CGN A;  1IYL A;  4C2X A;  4R8F A;  2CNM A;  1YW4 A;  4UCM A;  3TO6 A;  3RZA A;  1HEE A;  4IAV A;  1S7N A;  4FBE A;  3ZJ0 A;  3SIH A;  3K2K A;  1VHE A;  3RO0 A;  1QST A;  2O4H A;  4HNW B;  1I12 A;  1M4D A;  1IID A;  2KCW A;  3B3T A;  4XPD C;  2Q44 A;  3LMS A;  4KLW A;  4MCP A;  2FAV A;  2BOA A;  2YGW A;  4MFK A;  4K30 A;  1NE9 A;  1OBR A;  3D7G A;  4YRH A;  3SIG A;  3CXQ A;  2B58 A;  3N7Z A;  4UFW A;  1BO4 A;  2HUZ A;  3SI1 A;  2Z3N A;  3B3V A;  4WWV A;  4CAE A;  2C6P A;  2QEC A;  4KVX A;  3R1K A;  4JXR A;  5IB0 A;  3FB3 A;  3QAH A;  1FY7 A;  2IJZ A;  4MFQ A;  4ZX8 A;  4QUS A;  3R95 A;  2C1C A;  4TWE A;  3IC1 A;  3BI0 A;  4JXQ A;  3R9G A;  1XEB A;  2CTC A;  1LOK A;  3CPX A;  3EO4 A;  1XBU A;  1ZLH A;  2A4N A;  3KAS A;  5E3B A;  1HDQ A;  3D3S A;  4KSA A;  3JVN A;  3FMC A;  1ZR5 A;  4UCN A;  4CGL A;  5FSY A;  2EBJ A;  3SJE A;  2VZZ A;  5C88 A;  3EWQ A;  5E96 A;  2PJC A;  1QSR A;  2P0W A;  1IU8 A;  4U5Y A;  4OAE A;  5HOL A;  5FSX A;  1K4J A;  2AFO A;  2PC1 A;  4BD9 A;  5KTD A;  4QBJ A;  4E2A A;  4HKF A;  3EJF A;  4OID A;  4HPS A;  1Y7E A;  3S9M A;  2CXA A;  4L8A A;  3S6F A;  4UBR A;  1ZG7 A;  1CX8 A;  1OZP A;  2YNC C;  4BBH A;  4A39 A;  1Z8T A;  3D7F A;  5HMN A;  1LAN A;  5CB5 A;  1NSA A;  3FX6 A;  4U9Y A;  4IF5 A;  4PSX A;  2I3C A;  2ZEG A;  3RNZ A;  2V8H A;  4XPK A;  4ETJ A;  2DF5 A;  2JBK A;  3D67 A;  4A32 A;  3KR5 A;  2GU2 A;  5JPH A;  3IIB A;  4B5P B;  3D7D A;  3PZJ A;  2B4D B;  2F7V A;  5J8F A;  1VHO A;  3PP9 A;  2ZPA A;  4EFD A;  2W2G A;  4M3S A;  3DSB A;  4MHN A;  5F48 A;  4A94 A;  4NGQ A;  4OKO A;  4CGP A;  4II9 A;  2B3V A;  1XIX A;  3PRT A;  1CG2 A;  4W9Y A;  2R7H A;  3H8G A;  3H8E A;  4ZY0 A;  3IFE A;  4MHP A;  1IGB A;  1YRE A;  3EJG A;  1CBX A;  3WAB A;  2X47 A;  2ZEN A;  3F5B A;  2D4O A;  2QML A;  2WPW A;  4KOV A;  4NCZ A;  3KR4 A;  1HDU A;  4KLV A;  5G22 A;  3BI1 A;  1TKH A;  1YD9 A;  3DDD A;  4P4J A;  3MN8 A;  4UEF A;  1XE4 A;  2BUE A;  3DGV A;  5LRG A;  4OC3 A;  2RB7 A;  4R9M A;  5BWA B;  1SPV A;  1NMT A;  2PJA A;  3OWC A;  1DTD A;  4MHY A;  5CPA A;  2G0B A;  4F6A A;  3PGP A;  4AXV A;  5G1Z A;  3DLJ A;  2XEG A;  3B3S A;  2PJ3 A;  4PQA A;  4MHZ A;  4CRZ B;  2Z3P A;  1X10 A;  2PSW A;  2YNE A;  3KHZ A;  7CPA A;  4K3N A;  5EMI A;  4YGO A;  3TX8 A;  2JDD A;  2J8M A;  4NGR A;  1R3N A;  3RYO A;  2ZEM A;  4UCP A;  2PR1 A;  1YQE A;  4A38 A;  4C7I A;  4ZY1 A;  2V77 A;  3VWD A;  1ELL P;  4FAI A;  2PJ9 A;  5DWM A;  4P4B A;  3B3W A;  2JEW A;  2OU2 A;  3GQE A;  3QAY A;  4M6I A;  4MFL A;  4P45 A;  4GS4 A;  4QC6 A;  2PJ8 A;  1XJO A;  2YNC A;  4MCQ A;  4LUA A;  4R57 A;  3KZW A;  5F09 A;  4FUU A;  3WC5 A;  4IUS A;  2JZF A;  4KOX A;  1Q2Y A;  4LQ6 A;  1P4N A;  4AG9 A;  3NH8 A;  1Z5R A;  3SI2 A;  2FG1 A;  4NJQ A;  2VL1 A;  4UEZ A;  2GIV A;  5FSZ A;  5G20 A;  2PJ5 A;  1KUX A;  4Y49 B;  3IJ3 A;  5JH9 A;  5HH1 A;  3IO1 A;  4JZ0 A;  1IOI A;  3IID A;  3B8G A;  3TTH A;  2YND A;  3N5F A;  2WZN A;  1YVO A;  4AG7 A;  4P4I A;  3TE4 A;  1KZF A;  4NF1 A;  3JTK A;  2ZOG A;  4P10 A;  2WUU A;  3DR8 A;  8CPA A;  1Y7R A;  4KOR A;  2HV2 A;  5F49 A;  5AIL A;  3D66 A;  3EW5 A;  3GPO A;  2XEJ A;  4OC5 A;  1L0C A;  4UA3 A;  5FSU A;  1S3Z A;  3SJF A;  3V38 A;  4NGT A;  5CNP A;  1YR0 A;  4ONU A;  3H4Q A;  1Q7L A;  3MGD A;  4UWI A;  4MFZ A;  3FRM A;  3KQX A;  2BCO A;  4DUK A;  2RNK A;  1QSN A;  2ATR A;  2QJ8 A;  2R1I A;  4L89 A;  5C82 A;  3H5Z A;  5DWN A;  3IEH A;  3IWE A;  4MXU A;  2GLF A;  5LYD A;  4CPA A;  2FIA A;  2JZD A;  1Z9U A;  1BPN A;  3FNC A;  2AE6 A;  5LRK A;  4K0C A;  4KOS A;  3D4U A;  3R96 A;  1FT7 A;  1KWM A;  3ISZ A;  4A30 A;  4KOT A;  1CPX A;  2ZEO A;  1LCP A;  3EWP A;  4OIW A;  3JRU A;  2AFU A;  2VXK A;  3P2F A;  5A27 A;  4IK2 A;  1YLO A;  4TU0 A;  2ZW4 A;  2ZXV A;  2AFM A;  2FSR A;  4ESS A;  4PPZ A;  3GLJ A;  1TIQ A;  2B3U A;  1PYT B;  1XRY A;  2PJ4 A;  1YX0 A;  2CNS A;  1I1D A;  2VRI A;  4R6T A;  3QNV A;  2G3T A;  3F8K A;  2JLM A;  3EWO A;  3IGR A;  4PXB A;  3S9N A;  4TNU A;  2ZEH A;  3WC7 A;  1ZG9 A;  2Q04 A;  4Q36 A;  1DE4 C;  1PCA A;  2ANP A;  4F0X A;  1U6M A;  2PJ1 A;  1ARL A;  4PK3 A;  4ZBG A;  2CTB A;  2OH1 A;  2Z3L A;  4P4F A;  1YK3 A;  1QMU A;  4A33 A;  4P6Y A;  5KTA A;  1LAP A;  1AYE A;  1IY7 A;  4F9V A;  2AJ6 A;  3TFY A;  3KQZ A;  4J3G A;  1Z8L A;  3BHX A;  4NSQ A;  2PRB A;  2OR4 A;  3VFQ A;  4ETK A;  2B4D A;  3FXT A;  1CJW A;  4JLL A;  2PCU A;  3C26 A;  3V45 A;  4AVA A;  4QB9 A;  2OZH A;  3NE7 A;  2FXK A;  5D8N A;  4ABK A;  1BOB A;  2Z3O A;  2EK9 A;  4DJL A;  2IMO A;  4JYW A;  2KQV A;  1TKF A;  4DNC A;  3GQO A;  1ZG8 A;  3PB4 X;  1Q2C A;  4NJR A;  3I1U A;  1Z8X A;  1XMB A;  4U9Z A;  2WYR A;  4RUH A;  4I49 A;  4JCA A;  1PUA A;  1IOF A;  1QSO A;  4NXY A;  2Q7S A;  5K8P A;  2PJ6 A;  1ELM P;  4GUA A;  3G8W A;  4HNX B;  1AMP A;  2BEI A;  2ZW5 A;  4A31 A;  4MCS A;  4B10 A;  3TCV A;  2DXQ A;  4H6U A;  3R9E A;  1RO5 A;  4F0Y A;  2PE3 A;  2R98 A;  3EWR A;  3IWW A;  2BL1 A;  4GM5 A;  5ELY A;  4A2Z A;  2HQY A;  1B6B A;  4B5P A;  3G3S A;  1F57 A;  3VAR A;  2EUI A;  3P2H A;  4Q7A A;  2XD7 A;  3VWE A;  4EME A;  1IIC A;  1RXT A;  1EE3 P;  2Q7B A;  4CGM A;  2F8H A;  2JBJ A;  4Q38 A;  2R8V A;  3GIU A;  4YU9 A;  1BLL E;  1YW6 A;  3NA6 A;  5AG4 A;  3D7H A;  3GB0 A;  4M6H A;  3Q71 A;  2IL4 A;  2PQ8 A;  3JUW A;  4AVB A;  1Q2D A;  4OC2 A;  4E8O A;  3TC8 A;  3F0A A;  1XMT A;  4KSF A;  3Q6Z A;  2GE3 A;  3GPG A;  4MY3 A;  2BSW A;  3PBE A;  3VAT A;  5IB9 A;  5GCN A;  4OP4 A;  4KYB A;  3FIX A;  4NGS A;  4XPL A;  4CS0 B;  2GRE A;  3DR6 A;  4J5Q A;  4MY0 A;  2Z0Z A;  5JM6 A;  1XF8 A;  3NFZ A;  1S60 A;  3MRU A;  3T8W A;  1AUG A;  5F46 A;  2VBQ A;  1X12 A;  4PXE A;  5IV0 A;  5JQ4 A;  4XNH B;  3QB8 A;  4CYQ A;  1Z8W A;  1Y0R A;  5K8N A;  4R7M A;  2GAN A;  3LD2 A;  2EVN A;  2F5I A;  3CDX A;  4MHD A;  1SQH A;  4NFR A;  4JD6 A;  4MI4 A;  1VHU A;  1F2O A;  4PXD A;  4HNY B;  4B5O A;  1TXR A;  1M4G A;  2XEI A;  3TOB A;  1CM0 A;  1S7F A;  4A37 A;  2RC4 A;  2DEA A;  3L2N A;  4AB7 A;  4FD4 A;  3H8F A;  2B5G B;  2PJB A;  3S6G A;  1UFH A;  4M85 A;  2EEE A;  4UF4 A;  5AG5 A;  2FT0 A;  4MCR A;  2CF4 A;  2G9D A;  3NH5 A;  2PDO A;  2Z10 A;  2LGR A;  3DNS A;  3RBU A;  1YSJ A;  5CB3 A;  2DPT A;  1R57 A;  4P4D A;  3TO7 A;  1N71 A;  3S6K A;  4UWJ A;  4CAV A;  3KHX A;  2Q4Y A;  3K9U A;  1S5K A;  3WT4 A;  4MFJ A;  4KVO E;  4KSI A;  2Q4V A;  4UFV A;  2WSA A;  4PK2 A;  2IQ6 A;  3V8I A;  3S9L A;  5K8M A;  2EWB A;  2XEF A;  2AFC A;  3KGQ A;  4EWT A;  2NMT A;  4IQY A;  4X8I A;  1LAM A;  2OZU A;  3IWG A;  3LOD A;  2I79 A;  2DPS A;  1LRZ A;  2JEV A;  3B2Y A;  4KUB A;  3PB6 X;  1R43 A;  3W91 A;  2FL4 A;  3R9F A;  2ODF A;  3HLP A;  3PB7 X;  2ACF A;  4BIN A;  4KZT A;  3FH4 A;  4QVT A;  5THW A;  1J4J A;  2EO8 A;  4J5S A;  3IU2 A;  4MBU A;  5LYF A;  1VHS A;  1NJR A;  4ORF A;  3FYN A;  3T90 A;  3KL9 A;  4ZY2 A;  4B6Z A;  4CAW A;  2EK8 A;  2PIY A;  4UFX A;  3GUX A;  5DS0 A;  4XPD B;  4XNH C;  4CYP A;  5AG7 A;  4JJX A;  2ZEE A;  2GFQ A;  1S7L A;  5CMS A;  3PFE A;  3EXN A;  1WK4 A;  2AFX A;  3NE8 A;  2JZE A;  4BMH A;  2PJ2 A;  5FVJ A;  4CGO A;  3SHP A;  2JDC A;  3E0K A;  3V7Z A;  4H2K A;  1PU9 A;  4LQG A;  3FED A;  4GVW A;  3D2P A;  4RI1 A;  5I4M A;  3JZT A;  2H5M A;  3KI9 A;  5HVF A;  2PJ0 A;  4ZGY B;  2BFR A;  1M4I A;  4MFP A;  2WPX A;  1Y9K A;  4JGK A;  2FE7 A;  2RFH A;  3B35 A;  2P6F A;  1MJA A;  3BJ7 A;  3ISX A;  5HVG A;  2Q0Y A;  3UY5 A;  3PB9 X;  4KVM E;  2NYQ A;  4UML A;  1Z2L A;  2ABZ A;  2BFQ A;  1M44 A;  2Z11 A;  3EFA A;  4NGM A;  1QSM A;  2QYV A;  1BPM A;  5FSV A;  2P6G A;  4B11 A;  4UIA A;  2Q43 A;  4MMO A;  1JWQ A;  4WJB A;  2BO9 A; 
#chains in the Genus database with same CATH homology
 4OC0 A;  2O53 A;  2L8R A;  3PEI A;  2GLJ A;  2POK A;  3RAM A;  4X2T A;  4J5R A;  5CBM A;  4UEE A;  2AFS A;  5HXD A;  2Q51 A;  4P44 A;  4DYO A;  4OC1 A;  1UWY A;  3FEE A;  2C6G A;  2ZEF A;  1TF8 A;  1M4L A;  2ZOF A;  1XFO A;  1FNO A;  3SI0 A;  3B3C A;  3WC6 A;  1TKJ A;  2V8V A;  3FVL A;  1H8L A;  5J1Q A;  5HIH A;  3FJU A;  1BAV A;  5D29 A;  4IHM A;  3VH9 A;  1LFW A;  4UIB A;  5DUS A;  3EKE A;  1ZLI A;  5LYL A;  4OME A;  6CPA A;  1GYT A;  1TY8 A;  2V8D A;  3K9T A;  1CPS A;  4Z65 A;  2ZEP A;  2AFW A;  2HC9 A;  2FVG A;  2DX6 A;  1ARM A;  3BXM A;  3HUV A;  2J9A A;  2OOT A;  4ZX9 A;  2Q4Z A;  4F9U A;  3NH4 A;  1YME A;  4R76 A;  3PFO A;  4ZYQ A;  4X3R A;  1JQG A;  4PXC A;  4ABL A;  3PB8 X;  4J4Z A;  1VGY A;  3B7I A;  4NGP A;  2NSM A;  2CIJ A;  3GPQ A;  3SII A;  2PIZ A;  4D86 A;  3V2B A;  2V8G A;  5LYI A;  1TXZ A;  3CPA A;  4P4E A;  1RTQ A;  1TF9 A;  2C6C A;  2ZEL A;  4MRI A;  4FWU A;  2AFZ A;  4NGN A;  2PJ7 A;  4ONW A;  5JGF A;  1CP6 A;  1CP7 A;  4YWY A;  4JVV A;  5HVH A;  1QQ9 A;  3ETI A;  1HJZ A;  3FEC A;  4O23 A;  4GVV A;  3IIF A;  5LRJ A;  1VIX A;  2PVV A;  1Y0Y A;  3SJX A;  2QVP A;  4ZI6 A;  4OC4 A;  2HB6 A;  3CT9 A;  3D68 A;  2PRQ A;  2ZED A;  4F8Z A;  2PVW A;  5K8O A;  3FF3 A;  3PBB A;  1ZR3 A;  1F2P A;  3SJG A;  3SIJ A;  3LWU A;  4G1P A;  4R8F A;  1YW4 A;  3RZA A;  1HEE A;  4IAV A;  4FBE A;  3SIH A;  3K2K A;  1VHE A;  2O4H A;  3B3T A;  3LMS A;  4MCP A;  2FAV A;  2BOA A;  1OBR A;  3D7G A;  3SIG A;  3SI1 A;  3B3V A;  4WWV A;  2C6P A;  2IJZ A;  3S9L A;  4ZX8 A;  2C1C A;  4TWE A;  3IC1 A;  3BI0 A;  2CTC A;  1LOK A;  3CPX A;  1XBU A;  1ZLH A;  3KAS A;  5E3B A;  1HDQ A;  3FMC A;  1ZR5 A;  5FSY A;  3SJE A;  3EWQ A;  2PJC A;  5HOL A;  5FSX A;  2AFO A;  4BD9 A;  3EJF A;  4OID A;  1Y7E A;  3S9M A;  1ZG7 A;  1CX8 A;  4A39 A;  3D7F A;  1LAN A;  5CB5 A;  1NSA A;  3FX6 A;  2I3C A;  2ZEG A;  2V8H A;  4ETJ A;  2JBK A;  3D67 A;  3KR5 A;  2GU2 A;  3IIB A;  3D7D A;  2F7V A;  1VHO A;  4EFD A;  4A94 A;  4MHN A;  4NGQ A;  4OKO A;  3PRT A;  4W9Y A;  1CG2 A;  3H8G A;  3H8E A;  4ZY0 A;  3IFE A;  4MHP A;  1IGB A;  3EJG A;  1CBX A;  3WAB A;  2X47 A;  2ZEN A;  3KR4 A;  1HDU A;  3BI1 A;  1TKH A;  1YD9 A;  4P4J A;  4UEF A;  3MN8 A;  3DGV A;  5LRG A;  4OC3 A;  2RB7 A;  1SPV A;  4MHY A;  2PJA A;  5CPA A;  1DTD A;  4AXV A;  3DLJ A;  2XEG A;  3B3S A;  2PJ3 A;  4PQA A;  4MHZ A;  3KHZ A;  7CPA A;  4K3N A;  3TX8 A;  4NGR A;  1R3N A;  2ZEM A;  4A38 A;  4ZY1 A;  2V77 A;  1ELL P;  4FAI A;  2PJ9 A;  4P4B A;  3B3W A;  2JEW A;  4P45 A;  3GQE A;  2PJ8 A;  1XJO A;  4MCQ A;  3KZW A;  5F09 A;  4FUU A;  3WC5 A;  3NH8 A;  1Z5R A;  3SI2 A;  2FG1 A;  4NJQ A;  2VL1 A;  4UEZ A;  5FSZ A;  2PJ5 A;  3IJ3 A;  5JH9 A;  3IO1 A;  4JZ0 A;  3IID A;  3N5F A;  2WZN A;  4P4I A;  4P10 A;  2ZOG A;  8CPA A;  5AIL A;  3D66 A;  3EW5 A;  3GPO A;  2XEJ A;  4OC5 A;  5FSU A;  3SJF A;  3V38 A;  4NGT A;  1Q7L A;  3KQX A;  2BCO A;  4DUK A;  2QJ8 A;  3IEH A;  4MXU A;  5LYD A;  2GLF A;  4CPA A;  1BPN A;  5LRK A;  4K0C A;  3D4U A;  1FT7 A;  1KWM A;  3ISZ A;  1CPX A;  2ZEO A;  1LCP A;  3EWP A;  4OIW A;  3JRU A;  2AFU A;  4IK2 A;  1YLO A;  4TU0 A;  2AFM A;  4PPZ A;  4ESS A;  3GLJ A;  1PYT B;  1XRY A;  2PJ4 A;  2VRI A;  4R6T A;  3QNV A;  3S9N A;  3EWO A;  4PXB A;  4TNU A;  2ZEH A;  3WC7 A;  1ZG9 A;  1DE4 C;  1PCA A;  2ANP A;  2PJ1 A;  1ARL A;  2CTB A;  4P4F A;  1QMU A;  4P6Y A;  1LAP A;  1AYE A;  1IY7 A;  4F9V A;  3KQZ A;  1Z8L A;  3BHX A;  2OR4 A;  3VFQ A;  4ETK A;  4JLL A;  2PCU A;  3V45 A;  2FXK A;  5D8N A;  4ABK A;  2EK9 A;  4DJL A;  2IMO A;  4JYW A;  1TKF A;  3GQO A;  1ZG8 A;  3PB4 X;  4NJR A;  3I1U A;  1XMB A;  2WYR A;  4RUH A;  4JCA A;  5K8P A;  2PJ6 A;  1ELM P;  4GUA A;  1AMP A;  4MCS A;  2PE3 A;  3IWW A;  3EWR A;  4GM5 A;  5ELY A;  1F57 A;  3VAR A;  4Q7A A;  2XD7 A;  4EME A;  1EE3 P;  2F8H A;  2JBJ A;  4YU9 A;  1BLL E;  1YW6 A;  3NA6 A;  3D7H A;  3GB0 A;  3Q71 A;  4OC2 A;  3TC8 A;  3Q6Z A;  3GPG A;  3PBE A;  3VAT A;  5IB9 A;  4OP4 A;  4KYB A;  4NGS A;  5JM6 A;  2GRE A;  4J5Q A;  3NFZ A;  3MRU A;  3T8W A;  4PXE A;  1Y0R A;  5K8N A;  4R7M A;  3CDX A;  4NFR A;  1VHU A;  1F2O A;  4PXD A;  1TXR A;  2XEI A;  4A37 A;  2DEA A;  3L2N A;  3H8F A;  2PJB A;  4UF4 A;  2EEE A;  4MCR A;  2CF4 A;  2G9D A;  3NH5 A;  3RBU A;  2LGR A;  1YSJ A;  5CB3 A;  4P4D A;  3KHX A;  3WT4 A;  4KSI A;  2IQ6 A;  5K8M A;  2EWB A;  2XEF A;  2AFC A;  3KGQ A;  4EWT A;  4IQY A;  4X8I A;  1LAM A;  3B2Y A;  3PB6 X;  1R43 A;  3HLP A;  3PB7 X;  2ACF A;  3FH4 A;  5THW A;  4J5S A;  5LYF A;  1NJR A;  3KL9 A;  4ZY2 A;  4B6Z A;  2EK8 A;  2PIY A;  5DS0 A;  3GUX A;  2ZEE A;  5CMS A;  3PFE A;  2AFX A;  2PJ2 A;  3V7Z A;  4H2K A;  4LQG A;  3FED A;  4GVW A;  5I4M A;  3JZT A;  3KI9 A;  5HVF A;  2PJ0 A;  2BFR A;  2RFH A;  4JGK A;  3B35 A;  3ISX A;  5HVG A;  3PB9 X;  2NYQ A;  4UML A;  1Z2L A;  2ABZ A;  2BFQ A;  4NGM A;  2QYV A;  1BPM A;  5FSV A;  4UIA A;  2Q43 A;  4MMO A;  4WJB A;  2BO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...