4ZXBB

Structure of the human insulin receptor ectodomain, irdeltabeta construct, in complex with four fab molecules
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
218
structure length
218
Chain Sequence
b'DIVMSQSPSSLVVSVGEKVTMSCKSSQSLLYSSNQKNFLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYFRYRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 83-7 heavy chain
publication title Higher-Resolution Structure of the Human Insulin Receptor Ectodomain: Multi-Modal Inclusion of the Insert Domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hormone receptor/immune system
total genus 54
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2015-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbB01
1CICC 2HTLC 2X1WL 3DX7B 1KULA 3MXWL 1OY3B 3M1BB 4KWUA 4PJGE 1WITA 5DMKA 5HVWA 4MJIA 5GS1A 1MLCB 2HJLB 4Z7WF 3FOLB 5E9DE 4OKVB 2D7OA 4M48H 4PJ7A 4HQQL 1ZSDB 5CZVH 3EDDA 1KBGL 1KPRA 3HCVA 1UWXK 4P3CL 4NHCL 4PGCB 4X7CC 3B8SA 4MJID 3ZKNC 1FFOA 4CU8A 4JZOA 2FH6A 3LCYA 1CQYA 5C08B 2IC2A 3N85L 1KPUB 3CUPA 2XFXB 5F96L 1TETL 3QUXD 1A7QH 4EI5A 3V6ZA 4F8TA 5MI0B 1RY7B 5FIEA 4N8CL 3BEVA 4KRNA 3OKLA 1QYGH 3MRFA 1NCBH 4IMLB 1D5BB 1PKQE 1MFCH 4U1NA 4P3DB 3O6LH 2CKNA 2WV3A 4G8EB 4NRXA 5F1SA 1S7RA 1UQSB 3X13B 1G7IB 1FZKA 3LQZB 3DRQA 3KHQA 5FGBA 5MI0C 3DURA 2OQJA 3QXAA 4W6WB 3D2UA 5IB1A 2NXZB 4OV6F 2HVJA 3KYAA 1EK3A 3L3HB 5D7JA 5DMJB 5DTFB 3HZMA 4DGIH 1JNJA 5D2NB 3BYYA 2DQEH 1RD6A 2X4PB 3F7QA 1KSRA 2KBGA 4K23H 3V9FA 2OTUB 1U9KA 3CLEL 1TVHA 1VGKB 2HG5B 2OTWB 2CKBL 4HPOL 2Y36L 5I8EA 4YLQT 2I26N 5D7JD 2D7QA 4MNQA 1KIPA 4NRZB 4C83A 1F3JA 2FX9L 3BQUA 3RDTB 1YEJH 2C4FU 3TO4A 4M6ML 4H8WL 1J8HE 1AGDB 3RWHA 4ZSOB 1OAKH 2VUYA 4UDUB 3K74B 1A9EB 3TBVA 4I3RL 1W0YT 4UQ2B 4Z7QF 3BH9B 2A74A 4JANB 3VFVB 4GXUN 4MNQD 4PUBL 5DURB 3MV11 1F11B 5JLZA 5C8JB 5DK2A 4X7FC 4LLQA 3EYOA 1MFAL 5TFSL 4O5LH 5DD0H 5IESH 3GMLB 4P5KA 4PRNB 3RDTC 1EO7A 1W0WA 5BXFB 5JMRA 1FBIH 2AJVL 3QNZA 1BX2B 2P5EE 3ARBA 5I15H 4RMVA 5ILTL 4AIOA 2O5YH 3EYUH 3VGGA 2CMRH 3L3GB 4FRWA 1WC7A 1OM3L 1BQSA 5E24E 1E6OL 3NN8A 3SBWC 5EU4A 4MA7H 1U8KA 5ESAB 3GSRB 4TTDC 2NY6B 3FO9B 2WMPA 3ARBD 3WNOA 2LV4A 1AE6H 1N0XL 1EV2E 3ULVL 2AXFA 3HNVH 5MENE 2YUZA 5FYLL 4NN6B 3FT3A 4XTRC 1BBDL 1XCQB 3PP4H 2EE2A 5DO2C 4QGYA 3P2TA 5I19H 3ROOB 2D3VA 1P7KA 4PG9A 4WCYL 4K3EH 1BVLB 4E41E 2W65B 5IB4A 2FX7L 4AH2B 1YY8B 2EZ0D 4JM4H 1S7XB 3VMOA 1WBYA 2FECL 2G5RA 1MELA 3RTQA 5HYQB 1VFMA 3HG1B 1IGJA 3M8OL 3I50L 4KDVA 5D7SL 4F7EB 1RHHB 1JZ4A 4BZ1H 5E6IA 4XPTL 3WXWH 4ZUTA 5F7HA 3HN3A 3NFSL 4J7RA 2CDGB 2ZCKL 4PD4J 1KJMA 4OCNC 3RTQD 5DR5H 4Q6IB 1R5VA 5JUEL 2VAJA 1NQBA 4KC3B 4HULB 5I1GH 5D1ZA 4LK4A 4JO1H 4I77L 3VH8G 5JPNB 4QOKB 1VESA 1QBAA 1DBKL 1P4IL 1ZHLA 3AS0A 4C4KT 3BP4A 5DMGD 4Y5VB 1YEEH 2V7NA 3I75B 5JO5A 3QRGL 5E95B 5HHXH 1MNUL 1QFUH 4LSTH 3WFCL 4JRYE 1M1SA 4Z7WE 4BZYA 4ZMAT 4Q6IC 4ODVH 1RIVL 2NYYC 4L8SA 3FFDA 4MJ2A 4J3OC 1GRWA 2GCYB 4OTXL 1GGIH 4ZUWB 4LHUD 1A6WL 2FLRT 4TPRL 2BOCB 1A4JB 1S7QB 2V9RA 2YS4A 2BRQA 3WFDL 2KQNA 1RURH 3VGFA 5FXCH 1U6AL 5HHQA 4Z18A 2NQCA 4DKFL 1CFBA 4Y5VC 1RPQA 4NZRH 3QXWA 1E0OB 1QR1A 4YXHH 5C0ND 3RGVB 3L3DB 1QSEB 4LARH 4MA3B 3BEWB 2X9XA 5EUOA 4L3EA 1ROWA 4APQA 3DXAB 3U0PB 1IGIH 4PJEF 2IH1A 4KRMB 4A6YB 1DVFA 2E5EA 2WQ8A 1QPXA 3WD5L 1CE6A 3B9EA 1AR1C 43C9A 4Z7OF 1Q9LB 2FO4B 4AENB 3OB8A 3INUL 4G8GE 4M7KL 4FXGB 4W4OA 4QY8B 3QZWA 4OLZH 2OP4L 4Y19D 4APQD 2OJEB 5LXGH 3MGOB 4GKNA 3KPSD 3HPLB 4HFWA 3ULSB 3RGVC 3V0WH 4R4BA 1R5WA 1T66C 5CEXB 5I76B 5GGRY 3EOBA 4ZFGH 4JFYB 5ALBL 3REWA 3QIBD 4YJZL 4YHKH 1KV3A 4J6RH 2VLRA 1S7TA 1ZA3B 5D72H 5T33H 1SJEA 3QDGB 4K9EC 4U1KB 1MI5B 1T1YA 4JKPH 1U41A 4JDTH 4LSQL 1BIIB 1U8LA 2EXWD 4P2OA 3MRMA 3RPIB 1EERB 2FEEL 3ET9F 4A6YL 2EIZB 4WI4A 2E6QA 1I9JL 1Q9KB 1ZK9A 2APVA 2FDBP 3F6IA 4HBCH 4YHLL 4OZGB 2EIBA 3C5SB 3PE9A 3RAJL 3WNNA 1J10A 4Y5YA 4P2YA 1YUHA 5DRNB 3X3GH 1G6RL 4XWOD 2ADJB 2NZ9D 1U8QB 4MA8H 3TNNA 4BK5A 3GSNB 3SGEI 3BW9A 1A7RL 4K3HA 4KKLD 4R96A 4Z7QE 3GK8H 4YK4B 3RWFB 3O8XB 4OLUH 1H9VA 1RUPL 4U05A 5ITBL 4R6UA 2MCG1 5DJDB 2I9TB 3NMEA 1MFDH 2WUCL 4I0PB 4LCWA 4F7CB 4LU5H 3NFPA 2E7LC 1DUYA 5I8OL 2A83B 1GGUA 4KRLB 2GTZB 2HLFC 4D9LL 3QEUA 4RFEB 2Z31C 5FA3B 4PRHA 5I1KH 1ETZA 4YK4C 1OAUL 1FVCA 3TVMC 2OX5A 4Q74A 2KH2B 5EZJB 4LCWD 1TVBA 1BD2A 5LVEA 5IEKA 1KB5A 1U0QA 3VXUA 3R1GL 1MCOL 4I0PC 5ICYB 3GSNL 1S8DA 2DTSA 2Y7QA 5HGBB 5CKAA 4PRHD 1G1YA 3VWJA 4HPYL 2XKSA 1NGYB 3OHXA 4KTDL 4G9FE 2Y6SC 1ZHNB 3D3VE 4OSUH 32C2B 3HRZB 2H2PD 2CDFA 4E5XB 5DT1H 3V6BR 3VXUD 3NACL 1TXKA 3OAUL 4WV1B 2D7NA 4G42B 3E3QC 5DRZB 1I8KB 3LEYL 1AGCA 1OB1B 3VWJD 3D85A 2VISA 1OTUC 2F53D 2YPVH 5HY9B 2YBRB 3U0TA 5MEOA 4YEFA 5INDA 3RUGA 3PHSA 3QWQB 1B2WL 3LKRA 3JWDH 1E27A 2A9NH 4YBQC 1R3LA 1X5ZA 9CGTA 1QUNA 4X6CA 1KB9K 4OLYH 1QQDB 4J4PA 1PZ5B 5I1AA 4N1HB 2YMXL 1KOAA 5F9AC 1IKFL 1A7NH 1A0QL 3LZFL 3HI6H 4JAMA 3D85D 4QTIL 3L95A 3VRLF 4QHMA 2Z92A 1B4RA 4KKCD 4YWGH 3VFRB 1G9NL 3UXFA 2J3SA 3VRJB 1BZ7A 1ZT1B 1AGFB 4XCYA 1LO2L 1EO8H 4J4PD 4N0RA 2O5ZH 1EHAA 3GHEL 4FXLA 4BSVA 1NMAL 5BVJB 2QQKL 1P6AB 4TVPE 5I8KL 5HHVL 3HZYB 3ZTJH 3MA9L 4G8IA 3D69A 4ZS7H 5MEQB 2KDGA 2BVPB 3DI2B 3WIFA 1XZ0B 1JRHI 4UT9L 3VA6A 2E8ZA 3MPCA 4NWUH 1QFWL 5DUPL 4HX1B 4MNGB 3I6LE 3WFEL 3JXAA 2KKQA 4DKEL 2JF1A 4PJBB 1KJVB 3D0VB 5IT2H 3O6MH 3H9SB 1OGAB 3VXRA 3EFFA 3EYFA 4P2CG 5IR1B 3QDMB 1IC7H 2AJYL 2RCSH 4L4VE 3BKYH 5EWIL 3U2SB 1CG9B 1NH6A 5H37G 1U8HA 4FQXB 3OKYA 1QNZL 4PBVC 1UWGL 3G5ZB 3G6AA 1PBYA 1JPTL 3H6JA 3S5LB 3KLHC 3BSZH 3VXRD 1MCCA 1NC4B 3SN6N 2IF7A 4PJEE 1JUFA 1YDPB 3FL7A 3GNMH 5DEGA 2HMID 4HZAA 4LIQL 4UNTA 3FQRA 3MRPA 4RFOH 5E8EB 4OFDA 4Z7OE 3MFFB 5EIQA 2GJ6B 3V4PH 1H0DB 1Z9LA 2IPKA 3CFKB 5ITFA 4CRPA 3LEVH 1RHFA 1GGBH 4MLIA 3T4AA 2DI9A 5T1LA 2BFVL 3MO1A 4FQIH 4LCUA 1EGJA 3GBML 4AEIL 3SDYL 5C9JB 1NC2A 4KK9D 1UWEH 4NZUH 1ZHBB 3CU7A 1A6UH 1JGLL 3MCLL 4QWWC 5EA0L 4D9QD 3DVGB 4NPYB 4KVNH 4MCYA 5GRXG 2WUBH 4XX1E 5T1LD 4Z5RA 3CFBA 1X4YA 1GIGH 4DFIA 2XN9A 4Z7UA 4P46D 1ZLVH 4NN5B 1MCJA 1YYLH 2PR4H 4GG8B 1OT2A 1SM3H 4BUGA 3SDXA 2VAAB 2QSVA 2HFFB 2XA8L 1IJ9A 5DZNA 1HHGB 1MHEB 3MREA 5GRJH 2DTML 4HJJL 4XZUA 1DL7L 1XF4A 5T1KB 1RUAL 5GZOC 4P23A 5HGHB 2YR3A 4OQTL 3IB4A 5CWSA 1M4KA 4ZXBA 3UYPA 5TJWK 2OXGA 1P4LA 2BNQA 2R1WA 4M1GL 1XGRB 4XNZB 5D1QC 3WFHA 3ARSA 4NN5C 2DQTH 4H0HB 1UEMA 5DRXB 1PQZB 4LSRL 2NY4D 4P23D 1ZHKB 2JELH 3L5JA 4ZODA 1B0RB 2OJZL 4ZXBD 3NZHH 3HC4L 1XR9B 2BNQD 3CSGA 4NRYB 5E4EB 2IH3A 1KN2H 2JIXD 3UBXI 4U1SB 5DK0A 2N1KA 5I9QB 3TYGH 3EW3B 4O2EA 1CE1H 4GAYA 4OI9A 1JWSA 2A73A 4OM0L 5J56B 1RJCA 1J87A 1CXLA 5JW5A 1EEYA 2FCBA 5FO7A 4O4YH 2ED8A 4U49A 5HDLA 3FFCB 5CHNA 3SDCD 4JPKH 4WW2A 3PWLB 1N64L 2HT3C 1JE6A 2AEQH 5HI5D 1JZ7A 3OB0H 4LL9A 5I0DA 4BSWA 1AD0A 1UM5H 3HNTL 3P0YL 4PGBA 2A0LC 5IW1B 2A6DB 4OZHA 4C56A 4H5SB 2BVQB 1ONQB 3O6FA 2VLLB 4Q9RH 2MHAB 5F7DB 5ETUB 2IBBA 3IETA 2V6HA 1JFQL 2Q3AA 5EUKB 3AREA 5C0AE 5J4MA 1INEH 1N26A 2F54B 4R7DB 5ELIA 4PREB 3DARA 4UOW0 5HHOE 4C56D 3VD5A 4MHHG 4AIZA 3O6FD 3UJJH 5H94B 1F6AA 3L5WB 5ALCH 4X4MA 4S1SL 1CXHA 4G6KL 4YDJA 3ULUH 2R29L 1T5XA 1QLRA 5DMIL 3RKDC 4KKBC 4DVBB 1RUMH 4ZDHA 4GXUM 1MEXL 5HHMD 2ZPKH 4P3WA 3RNQB 4QYOA 3BN9C 1HHHB 4MXVF 3NTCL 5C0CE 3MRNB 5A2JH 1GCFA 3MOAH 3ULUD 3MNVB 1AY1L 2VLJB 4XVJL 3VRLE 3F7VB 3CH1B 2PW2B 4RMTA 1CT8B 1J1OH 4K94H 4LSDA 4OJFL 3SKJH 3EOTH 5C2UB 2DRUA 5I0ZA 2QSTA 5TE6L 2P1YA 2DQIL 1AFVL 1KCLA 4M9OA 5I17A 4G9DB 3W39A 4GW4B 2AXJA 4X7EC 5FYJL 3C8KB 1MJ7H 3D48R 2DQHH 2VXQL 2PTTB 4JPIA 3GGWB 5D5MA 2BSSB 1I1CA 1NCTA 5BOZG 1C5BH 3SPVA 3G6DL 3WNMA 2R9HC 3VFWA 1E4KA 2FGWH 4F57L 5E94B 1RU9L 2R2EA 2UWEA 3QXDB 4NM4L 4NC1C 4WGWB 4PRAB 3LKOB 1VFUA 1AGEB 4RBPK 1A1NB 4L8CA 2GIYA 1CL7H 3TCXA 4NDMA 4IIQC 3JVGA 2IFFH 5LGKA 1KJ3L 3GMOB 4WHYH 1EFXB 1ZA6B 4HCRL 1MREL 4DCQA 3NGBB 3LB6D 1A6AA 1IQWH 3MV7E 4JFZL 4Y7MA 4TSAL 4LBEB 2HYMA 1RZ8B 1U3ZA 2HP4A 2MKLC 4BQ9A 3WV0A 1RIHL 4OGXL 4JFFD 1D5ZB 2DLGA 3JTSB 1OAZL 1BVZA 1ZEAH 1UCTA 4S1DC 1SVZA 3AU1A 1I9RL 4PGDB 3OF6D 4JFDB 4OD3H 1ED3A 1NGWA 5BV7B 4AJ0A 3HI5H 3P9MA 3P11L 2H2SC 3MV8E 1A6VL 5C0BB 1KTLA 3OL2A 1IM3B 4QRPA 1KCVL 4Z7VA 3UTTA 4RISH 3IXTB 5KVGH 4YDVB 3TZVC 3TLRA 2AJXL 2HJKA 2XWTA 3KPMA 4FQQA 2DD8H 4JHAH 4K7PY 4IRSA 1G7PA 4LOUD 5E08H 3UTOA 1FGNH 5A1AA 3BIKB 1PX3A 4QRPD 1DBBH 4HXBH 1CFNA 3U48A 4N1EA 4M8VA 3IGAA 3UTTD 2VC2L 2D4FA 2YWZA 4GG6F 3VXPA 1WJ3A 1VFAA 4XMPH 4BSJA 1P7QB 3LN5A 5F1OB 1S7VA 5ICZB 3HI1B 5BW7C 3CK0H 1OPGH 4PJGA 5JIIA 3HUJB 4N0UE 4UNUA 1SY6A 1FO0A 3DTXA 5BV7L 3RWDB 1G7HB 2ARJQ 3VWKD 5E9DA 1J88A 1SY6H 1KFAL 1JK8A 5GS0H 4HS6A 3LOWA 1HQRB 1T7YA 2EXYC 1F2XK 1B0GB 3P40A 5ID1A 5JA9A 1JMZA 2Z8VC 5DZLA 1KXVC 1WWCA 1X5LA 4H26A 4PIRF 4PY8J 4L4TA 1C16A 2QQLH 3HZVA 1G7QB 4UT7L 3QEGL 4RRPG 3MXVL 3N9GL 2DQCH 5GS0D 3OXRA 3FQUB 1RULH 2J8UA 1G9EA 2FATH 5E9DD 4YBLB 5I1IH 3VU2A 2O61A 5LGJA 5I18L 5M7QA 5LAXA 5ISZB 2NY0B 4LLMB 3Q1SL 5TDPA 3U7WL 2NZIA 1MCLA 3SGDI 2NY2D 4PJXB 1TZGH 6CGTA 4GRLD 5EU3B 4WHDA 1SYSB 5K9KA 4KI1A 3U6RB 1D5MB 2A77L 4TUKL 3THMH 5DDHB 4ZUUB 2R23A 4DGVL 1J5OL 4NO5A 4MJ6B 4C58B 2HFEA 4PRIE 4IMKA 1QD0A 4FQ2H 1EZVX 5CJOL 3OX8B 2NY0C 3RIFF 3N1FC 2PO6D 3GSWB 5F3BB 1XGUB 4ENEC 4JVPA 1GXEA 1WEJH 3MJ8A 4ONFH 1QBLL 1I8LC 5IMOB 1XIWA 4HDIA 4GMSL 1XF3B 4PJ5E 5CZKA 2AP2A 1JF6A 3QULA 2X4NB 2RAMA 2K7QA 3OAYK 5JHLL 3L9RB 4PLKC 4I13B 5FYKE 2W9EL 3WLBA 1MQKL 2R2HA 43CAA 3GUTA 3BAEH 3CC5A 3PDGA 5CUSL 1RZ7H 1X5JA 4TRPL 3G5YB 1A7OH 5DJ0A 5CJ5A 3VD9A 5B8CB 1M7DA 4BFBD 4YXLL 4Y1AB 5E5MA 5KSBF 5IVXB 1FCGA 5E8DH 5DC9B 1U8OA 2APBA 1LP9B 1J8HA 3U83A 4MXVE 3CCHB 2ICWA 1WFNA 2C3XA 3LKSA 4XAWL 1IE5A 3BGAA 5IG7B 1P2CB 5DJYB 1DR9A 2UUDK 2G75A 4M1CD 2VQTA 4IHOA 3QHZH 2KQMA 4ZAKA 1OAYL 1MCWW 1KEGL 4PJDE 1EH9A 2CPCA 5TF0A 2CRMA 2J8OA 1J8HD 2DAVA 1A1OA 5CLWA 3QH3A 1FORH 4WVRA 2C3VA 2YPKA 4F7PA 3I3EA 5HJ3A 3BP7B 3TWCH 1DLFH 3IFLL 1ZVHA 3PABB 3KXFD 4NBXB 4YPGB 4LAQH 4PG2C 3BJ91 4WFHD 5DD1H 5SX4H 4R97B 1L4IA 4ZAKD 4EDWL 5TF1L 5CSZB 1TZIA 1I8IB 1PSKL 2J2ZA 3B43A 1QHPA 3NOIA 5DJXB 5FOJA 3T0EC 1IAKB 5I1JL 2C3HA 3H2WA 2P5ED 3P9WB 3MMEB 2GEEA 1IEAB 4ZUSB 3VG0H 3K0WA 3MLPA 3KR3H 5C7XL 5KG9B 4X6FA 3AS2A 4HEPG 2ICEA 3JV6A 4R97C 1NBVH 4X6DA 5IMMA 1HSAB 3RX8A 3O0RL 2F58L 3TO2B 3IKCA 1DQLL 3AC0A 1TZHA 4Y2DB 4GRMA 3BPNB 4BQ6A 2NY3D 1FG2B 2NPLX 5KVFH 1LO4L 5D7LD 3GBNH 4J8RB 4E41A 5MEND 2VOTA 1XF2A 3HMWH 4X8JA 3PP3K 2F5BL 4XH2B 3TIDA 5C0JB 1VDGA 3DROA 3C9NB 3EOAA 3SGJA 5D6CA 3LQAC 3TBYB 4UINH 3GJEA 4HWBL 4GUPA 2ADGB 4LPTA 1IEBB 1B90A 1B0WA 4E41D 5LWYH 1KEMH 5DUMH 2B4CC 3ZL4H 3Q6GL 2ESVE 4HUXA 3HMXL 4RMUA 4X4XB 4G7YL 4G5ZL 3LQAL 5DD6B 4JFPA 5J57B 1F4WH 4UDTA 3TJHC 1G7LA 3U46B 2AK1L 4TULH 3PL6D 1NCWL 4HS8L 2ITDB 5DJCB 4GG6E 4XP5L 3RWJA 1M6OA 2XPGA 4JZJB 2B4CL 3RVUC 4YHIA 4QRRE 2B1HH 4XXDA 5T5NF 4JQIH 5LQBL 2HTKC 4Z7NF 1KXQE 1U8IB 5IIEA 3NAAL 3BE1H 4I1NB 4NOFA 4L9LB 1QEWA 4JRYA 4Z7WA 1N59B 4LPXA 5JXEC 3DMMC 4PB0L 3V52L 4LPYA 4YDKH 5HYSA 4FHBD 5KSAB 1IM9B 4QHKJ 4LGRB 3QIWC 3RVWD 3ARFA 5E8OB 2ZUQB 1RZGB 4M43H 5ABDE 3QFJE 5EOTB 1Z0MA 2V17H 1WIPA 4FXKA 1UYWL 2FX8L 3TA3B 4JRYD 4G8FB 1RJYA 3LPFA 5I16B 4YXKH 5F7EL 3C09B 5TQ0L 3V5HA 4L9LC 1DFBH 5FO8A 3H42L 4HFUL 1QKZH 4U2YA 5AD0B 3ARFD 3P0VL 4XMLH 1FN4A 4G6AD 1MY7A 1XF5B 3DX8A 3BMVA 2RIKA 2P24B 2QV2A 4LNRA 1FC2D 1G7MB 3HR5A 2ZUQC 4OGYL 4LNVA 5DMYA 4JJHA 2OL3B 1KT2B 2EYRA 1WVZA 3TC9A 2QADD 3EFDL 4G8GA 4HKJB 3MLSL 3TA3C 4ZFZB 5I1CL 4GSDL 3MOBL 1MCRA 2P49B 5F71A 1T04B 1WIUA 3C09C 1Q72H 1BBJB 3PWNB 4Q58C 4C55A 3OKKA 3MV9E 3BHBB 4PYHA 4GFTB 1UB5B 5L8JB 5CIPA 1IEHA 3DV6B 4G8GD 1JNNH 2Y5TB 5CIPH 4WJ5A 4NFBA 3T0VA 3E1F1 1KLUA 3EJZD 3K1DA 3QP3A 2OSLA 3F6LA 2L0DA 2RQ8A 2BJML 2EE3A 3EDJA 1RJLA 3GJFH 3S37H 4F9PC 1T4KB 4MXWL 4HW6A 5ECJE 4EI6B 2A6JA 2VYRE 4FQPA 5CP7A 3HFML 1XAUA 2OL3L 2AV7B 2KZ1B 2R39A 4I5BA 1YYML 2N56A 5KSBE 2YPLA 4MQ7B 5DQJB 3SCMB 1J11A 1F6LL 3CFJB 4EN3D 2X05A 4Y4HC 3JUYA 3QR2A 4KMTL 1AJ7H 3FQXA 1IQDA 3FZUC 4PGEB 5EH1A 2EH7L 2JCCF 3IS0X 1ZS8B 1I3VA 5GISH 2XWBB 3UPCA 3H3BC 3GIVB 1DQMH 5INCB 1INQA 2P8PB 3VW3L 1CGVA 2FNBA 2VO5A 3OKDA 4MSWB 3IXAB 1BGXH 1EJOL 3OKEA 1HE7A 4MX7A 1P9MC 3TN0B 4CADB 4ZYKB 3V6FB 4C59B 1WBZB 4OAWA 1L9MA 1AXSB 2X7LB 4PGZA 5CEZL 4K7FA 1KUMA 3VFUB 4TQEL 4XI5C 3T4YA 1KENH 2W1NA 1BECA 3MRJA 2YUXA 4JVWA 2QSCH 3EAKA 3QHTC 5BO1H 3DGGB 5DJAB 4JZNA 5KSVA 1D5IH 3IDJB 4LFHG 3SGKA 5F7FA 2XXCB 2EKSB 4PLNC 3TFKD 4UBDD 1S9VB 3TN0C 1M05A 1CI5A 1Y6NR 3C60A 1D5XA 4ELMA 2AEIT 1FJ1A 3HNSH 3RY4A 4G9FA 1NAKH 4OZFB 5HDQH 3D3VA 4NCC2 4H20L 4Y2OA 3I9GH 1IILE 4ONGL 2WANA 4QRTB 5TE7H 3MBEC 5CGYC 3CLFH 1ITBB 3ZHLA 1OTTD 1IGMH 3RVTD 1FFNA 2Z93B 1KCSL 1VFBA 1QVOA 2F15A 2AV1A 3SE9H 4G9FD 5IK3B 4DN3H 5BZDB 2YZ1A 3D3VD 1FDLL 3WNLA 1MFEL 1GHFH 2NNAA 4OZIB 1FYTE 1U8NA 5ACZA 4PJ9A 2EDEA 5GHWL 1C5DB 5D71L 2WINA 4KJPD 1VPOL 4M7LL 5IBUB 5KZCB 2G5BB 1PW3A 3BWAA 4X7SH 2OMBA 3ZE2F 1ADQA 4DTGH 3LH2H 1ITCA 4Y4KA 2DQFB 1ADQH 2IGFH 4WI9A 4JDZB 3QNXB 3VXTA 3ILQC 1NLDL 4YE4L 1S9WB 3QUYA 4PJ9D 3TNMA 4OLXH 1E4XL 4DOHB 5F88A 1QLEL 4FQCL 2F74B 4OZFG 5CMAA 2VR9A 3UZVB 2D7PA 5F9JB 1WQVT 4Y8AA 3SEPA 1IGCL 3KWWB 4JGMA 1MIMH 1BLNA 1R3IL 3WEXA 5E2TL 4TVPH 5HGDB 4NSKB 3RWIA 3PHQA 4Y4KD 3G08A 1JMXA 1GOHA 2R69L 1R5IB 2ZKHH 1T03L 4I3SH 2B1AH 4X8XA 2P8MA 3WJLA 3RZCC 4Z7NE 1F00I 3DSFL 4KQ3L 1KG0A 4TVPD 4KJYA 1X5HA 3QUZB 5I1EL 1DSFL 5JW3L 5KTEH 1ACYL 3A6OA 3SE4C 5I1DA 5IBUG 4IOFC 2P5WB 4L4VA 1WBXA 3PGDA 1JJUA 3A67L 1GC1H 1JWUA 3MLRH 4JFHE 5DVNA 3VXNB 2HFGH 4XHJC 2GY7B 5F44A 1HINH 1AP2B 2B2XL 1FGVH 1XEDA 2QR0B 1YEGH 3U1SH 3QUZC 3NCCB 1NGQH 4L4VD 1S7UB 4X9GA 4YZFF 4QRUB 3MRIB 3T2QA 1CIUA 1TPXC 4AG4H 3UPRB 5KAQG 2JJSC 2P7TA 4R4ND 1C8PA 3HZKA 3O6KH 4M1DH 3V5KA 4NO3A 3OGOE 4GXVH 2X4SB 4OCXH 4Y88A 4Z6AT 2VXSH 5IFAL 3WFBL 4GBXA 3QNYA 1K6QH 4MNHA 5BZWA 3SKMA 2QHLA 1JHLH 5E8PB 5T3XE 1FZOB 3HS0B 1CR9L 4JM2B 1NFDB 5E03A 3JTTA 1GPOH 3MGTA 3WKML 4M61A 5IJVB 2JJTA 1KNOB 3EZJB 3LRGA 1IC4L 1IBGL 2J4WH 3GSXB 4CVZA 4GBXD 5FYJU 2BVYA 3H9HB 4D8PB 4ZO6A 1OCWL 1BQLH 3K7UA 5JW4M 3ELAT 2Z35B 1JYWA 4JM2C 3AAZB 4HWEH 2MNUA 5LCVH 4OCSH 5FFLA 2Q8BL 5ESVB 2Q8AH 2EDNA 1ORQA 1U3HA 4U2ZA 4UT6H 4QHNA 2OR9L 4PJCA 3S3SA 2ZUXA 1QSFA 3L1OH 4M8QA 4L8BB 4TSBH 4POZD 4S0TD 2YD7A 2AABL 1JV5B 1TFHA 2H26A 1LQSR 5J1TC 4X9IA 2IPUG 1EMTH 3Q5OA 4QRSA 2EC9U 2JCCE 3RY6C 5J6GA 3VXSE 4OB5H 4DKDC 4N0CD 4ELKA 5L2KE 4MQSB 4NQSA 2BCKB 1J86A 4PP2A 4UNVA 3O3DB 1I1FA 1LE9B 3TPUB 3CZJA 3VFTA 1AO7D 4G3YH 4XVTL 4O2FA 1IAII 5IMKB 2W0FA 4OF0A 2DDQL 2BNRA 4IDLA 3ARRA 3O3AB 2Z8SA 3V95A 1SYVA 1T0NB 1TCRA 1WISA 2X6MA 2YSSB 3DUUB 3UTQA 4KROB 4D2NA 2XRAH 3QO1A 1CGWA 1GZQB 1H3VA 2ITCA 5E1AB 5FA4B 1S3KL 1DTUA 4KQ4L 2AQ1A 2CGRH 3I2CH 4X5XA 3RNKB 3SDAA 4LSUH 1CGYA 2ICWJ 4QXGH 1ZT4B 3OPZH 1OP3H 4FQHA 1MCHA 1OAXH 3VXMB 4XNXL 4WDIA 3L3JB 3QJFB 1UB6A 3SQOL 4R90L 4FTVA 4D0CA 1MIEH 4HAGA 4DGYL 5C0AA 1S5HB 3RHWK 4ZQKB 5HHOA 1FH5H 1FFRA 4HWNA 4AL8L 2X1XR 4Z76A 2WBJB 1JF1A 4NQCB 4W81A 3UTZB 3WSQL 3SJVE 4HUMB 5F97E 4N90E 5J12C 1JGVL 2Z4QA 1HZHL 3FO1B 4TN9A 5DLML 5ENWA 4YQXH 5F9WB 2ATPA 2CRZA 4TYUA 5C0AD 4Z8FH 5KJRH 5JOFA 2F19L 2EDWA 2IAMB 4JQXA 4K07A 4OCLC 4X6BB 1LEKB 2BVOA 5F3HB 5C0EA 3AFLA 3E6FB 3HB3D 3HE6B 4KAQL 3ZE2E 3KPRE 4MA1C 3OJ2C 4LLVB 3U30B 2H32A 1RIUL 3JV4B 2VKWA 4GW1B 4JO3L 4W4NA 2H32H 1BP3B 5T3ZD 1VHPA 4X80H 3P30H 3L3KB 4F3FB 1FLRH 3PQYB 4ZD3L 3QQ4B 4LRNL 3VFMA 1AIFB 2MCPH 3SGEH 2R0ZH 5C0CD 4WUKH 5AYUH 3EJJX 4AK1A 2IAMC 1KIRB 2BNUA 1QBBA 5GS2H 1AI1L 5D2LF 3HE6C 3GI8H 5JZ7C 2UYLA 2CXGA 2DLHA 4GAJH 4U6VL 5EU5B 1BZQK 4MD0B 1YECH 3E3QE 2X70B 3KJ6H 3MBXH 1BMGA 4LPCA 3QT2A 3GMMB 4M62H 4ODTL 5DF0A 5GRUL 1HI6B 5GS2D 1HQ4B 3B6SB 3DUSA 4NHUA 3TBWB 3D39B 4LP5A 2IANB 1UM6H 3P77A 1NEZB 3EYVB 1DE4B 1UZ6F 5CINL 1A6TA 4GRWB 5E8NB 3MV7A 1N3NB 4D0BA 5TQ2L 1SBBA 4FA8A 3C5ZB 4PJFF 4XGZA 5IWLA 3EYQC 3V7AE 3WUWA 3MNWB 4P2RB 1NGZB 3QCUL 5EN2A 5L7XH 2GUOB 2C3GA 1DQQA 5EU6D 1FG9C 4JEGB 3FN0H 4CUCA 1MAMH 5BJTB 3KPLA 4HUVB 3MV7D 2C1OB 4M7JH 4X0KB 1MHPH 2F54D 3P9LA 4P48A 1EEQA 2DYPB 2H6PB 1R3JA 4OF5A 3MV8A 2VXUH 1D9KC 2KL6A 1S7SB 2QL1A 3C5ZC 4LLAA 1T20A 4XPBL 3BUYB 4MD4A 2PYEB 2V7HB 3QG7H 4F7TB 3FT2A 1FAIL 4WI5A 3MQIA 2EEBA 5MHSD 2VDQH 2P8LB 3CZFA 5L88L 4JFQB 1NEZG 1UA6H 2D2OA 5IJKC 4LLWA 5C2BL 1Q0YH 3MV8D 5TPWH 1SHMA 1DN2A 1EEZA 1FPTH 4RGNB 5J7CC 3BKCH 3NABL 5D6DA 2XYCA 5DYOB 3QG6A 3MRLA 1YEFH 5CJ8A 3MA7A 2AQ3A 1VADA 4I0KA 2VXVH 4MNGE 2X89A 5E7BA 4P49A 2K3TA 1KIQA 1L6XA 2PXYC 2FL5A 1ZGLM 2EH8L 4PJBE 1BQHB 4N0UA 1LILA 5BRZE 1CDGA 5JXAL 3RIAF 4ERSH 3H9SE 3O9WA 1DBML 1DDHA 1TQCC 2Q76B 4XNMA 1YNKH 4QCIA 4K3JL 4R26L 2PW1B 1OW0A 3QCVL 1JRHH 4UQ3A 4RGNC 3RFZC 3KNBA 4EVNB 5IFJA 1A14H 2X89D 3WMSA 4OKDA 1ORSB 4X98A 4P4KC 4PRPE 4JN1H 4I2XE 1F42A 1KC5L 2NXYC 3CFCH 1LHZA 3FB5A 1MOEA 3NIDF 4N8PA 4XPAL 1ZLSH 3KDMA 5L9DH 2JKXA 4XP4H 1U3YA 1BOGB 2APXA 2VR5A 3VFGL 3S4SB 1NCCL 3IDNA 4U1HA 4LSSH 2ENSA 2DLIA 3PWJB 4QHUA 2EECA 2P42B 2VQ1B 4NUJB 1IT9H 5GGQL 3L7EA 5JHDD 2BZDA 5CCKL 3MRDB 3ILPB 4HIHA 4K2UL 3IDIA 1T89A 2R4SH 1K8DA 3STZB 4HKZB 1F58L 4PRIA 2NY1C 5C09E 3CPLA 3ARGB 5I1LB 1QHOA 5F7YC 1CDIA 1LO3H 4FQ1H 1JTOA 3MSPA 1AKJA 4AQOA 1NCUA 4KGJA 3EUUA 4NT6A 2OMNA 1NL0L 2FLBT 5GGVL 5SWZB 1BIHA 4JPVH 3ARDC 3NCJL 3TT1L 2W07A 3C8HA 1K85A 4PJ5A 4WGVB 3UTSB 1V7NL 2XZAH 4M7ZB 3NCFB 4PRID 3AROA 3BVNA 2OZ4L 3S4SG 4JKMA 5L2JA 4HWZB 4OCYL 3C6LA 3SY0B 3Q6FA 5F7KC 4D3CL 5FYKH 3KG5A 4NBYB 3Q2CA 4LSVL 4O58H 4QHLB 35C8L 4M4RA 5C1MB 3QA3B 4RIRA 3VDBA 3BDYH 3U9PH 1A1MB 4N9GA 1INDH 5ICXB 5BCAA 1VCAA 3QJHB 5SWQB 5CJXC 4DVRL 4M7ZC 4ZPTA 1PJ9A 5FYKD 2VE6B 1I4FA 3K80A 4NQXB 3MYJA 2ADFH 4X5WA 3H3PH 1T1WB 4DZBA 1T80A 5GGVY 2A38A 3BKJH 1JNLH 5IHZA 1RK1A 4KGLA 4PJDA 2NX5A 1FP5A 1K4CA 1UT9A 3RL1B 2HVKB 4PJ8C 2FBOJ 1DBJL 3EIFA 4R0LC 3T0DA 5DC4B 4LCCA 1OP5H 2YD8A 3STLA 2EDQA 3L6FB 3GSUA 5D2LE 4G6JH 3EJYC 4DN4H 2VZSA 4ORGA 3CNKA 5DMKB 2G60H 4MJIB 4GOSA 5GS1B 5DI8B 3QI9D 3UYRH 1D3CA 4M03A 1T6WA 3HTLX 4XPFH 4RMRA 2O5XL 3W9EA 4PJ7B 4YFEA 3RU8L 3QUXB 1I3RB 3GRWA 3MTRA 1KPRB 2WBKA 1IVLA 5CD3A 1BAFL 3IJHA 3QPXH 4UV4L 4EUPA 3S35H 1FFOB 1UZ6E 3E2HC 4JZOB 4HK3J 3UDWA 4HIJA 4EUPH 5GS1C 4J2XA 3CUPB 4PJFE 1QFPA 3V6ZB 1A6PA 3PV6B 4QXUH 4NFCA 1CD0A 4DQOL 4UIKH 3NA9L 4LSPL 3BEVB 1N4XL 4MMZC 5FGRA 3QUXC 1NBZA 3OJDA 5CILH 5B3NA 4PY8I 3OKLB 4M02A 4PY7A 1K9TA 3QO0B 4U1NB 1XH3A 4M48L 5C07E 4LDEB 3MRCA 1Y0LB 5CZVL 3BH8A 5F8QC 2AXHA 2N7AA 4UUJA 3DURB 4EJ1C 1KELH 2H8PB 3QXAB 5CZXC 2IPUK 1N6UA 3SKNA 4NC1E 5K9JL 1Q0XH 2HVJB 2ESVA 4LMQI 5E2VL 1WFOA 4M3JA 4U1LB 4FQJH 5D7JB 3HZMB 4PR5A 5JIKA 2B39A 4F33A 1MFBH 1W72A 4G80A 3T8XB 1WT5A 4J3UA 3MCKB 1WAAF 3NZ8A 4GG6A 5IM7A 5EBMA 3A6CH 4YX2H 4TNVF 1YEHH 2Q7YA 2VDRH 5CBAA 5A2LH 2ESVD 4QRRA 1NCBL 4Y4FA 5I8EB 1JGUH 5FUOH 4MAYA 4GS7B 1MFCL 5HYJA 3OXSA 4MNQB 1K8IB 1F3JB 4MDJA 1F4AA 3O6LL 3PWUA 5GSVB 5D7JC 4XCFH 3QEQE 5ESQB 4HWUA 4TOYH 4PJIF 1SVCP 2EEAA 3TBVB 3CFEB 1EXUB 2AEWA 5H35A 1QRNE 4U7MA 4QRRD 3WL9A 4Y4FD 3LSOA 2QKIA 4P59H 4MAYD 3QFJA 5JLZB 5DVLA 5C9KA 5EUOF 4JRXE 5DK2B 4DGIL 4LLQB 4GS7C 3NIDE 1CWVA 3B2UC 3I3BA 2DQEL 5FM8A 3MJ9H 4P5KB 3BZFA 1JPSH 2OR7A 4LVEA 2N7BA 3ARBB 3W5MA 3WIHA 3QFJD 1ZT7A 5GGTA 1KIUA 2WIIA 3MNZA 3KAAA 3WIHH 4HAFA 1WC7B 1IKNC 5GGTH 3IJSA 4CVXA 4NQEE 3NN8B 1YEJL 5EU4B 1OSZA 2DKMA 2VDMH 4W70A 4HGWA 1WWAX 2BSTA 1R3HA 3T2PA 1CICA 4HC1A 5FB8A 2QSQA 4MCZA 3ARZA 4HC1H 3SKOB 2GI7A 4P3CH 1U3JA 3LEXB 3FN3A 2AXFB 3MV9A 5KS9F 5I75B 2FZ3A 4PD4K 2ED7A 3KYMA 2GSIB 5DD5L 1SMOA 4M6AA 4O5LL 5DD0L 5IESL 1SBSH 1CICD 2HTLD 1FBIL 3LRSB 3G6JF 1ZANL 4OLWH 3FRPG 5I15L 4N8CH 2ED9A 4PG9B 2Q7NA 3MV9D 2O5YL 4XP9H 3EYUL 2CRYA 3M1BA 5IB4B 4WRLA 1WBYB 2A9MH 1NPUA 3FOLA 4RGMB 2DJSA 4OKVA 1XGQB 4MA7L 3ZLQC 3DOSA 3RTQB 2EZ0C 3OGCB 5HPOA 1NCAH 4JFXA 3ZDXF 2E27H 5KSBA 1AE6L 5D1XA 3EO9H 3TPKA 4ZUTB 1TQBB 1V05A 3HNVL 2GHWB 4DZ8B 4CNIA 3MZTA 2NW2A 1RAMA 5GGUB 4RWYH 5SWSE 2BMKB 1KJMB 1YMME 1R5VB 3OKNA 5ISZE 3PP4L 1KPUA 1WGOA 4RGMC 5JPMA 2Y1VA 5I19L 1UJ3C 1IZJA 1YEDA 5ANMB 3WN5B 4GMTH 4O51B 5D1XD 3T65B 1X5IA 1A8JH 2CKBA 2CLZA 5I8CA 1UACL 5JOPD 5DHYB 2CKBH 3BP4B 4LHUB 2APFA 2Y25A 4JM4L 5JO5B 1TQBC 4HK0B 5DGQA 1Q1JL 3HC3H 5DMGC 3W81A 2PUQT 4M6MH 3X13A 4L8SB 4YHZH 3JWNC 3SGDH 1F4YH 3LQZA 4BZ1L 1U58B 3WXWL 2GFBA 3WN5C 2C5DC 1U91A 4EBQH 3F65A 1U95B 5FGSA 4MLSA 5HHQB 3L3HA 4QNPF 2E7CA 5EB9A 3TESA 5FO9A 5I1GL 4GKOA 4JO1L 4Y19B 5HDBF 3MLVH 4APQB 5DJ6A 2AJVH 1ZLWK 3KPSB 5C0NC 1MHCA 2OTUA 3AM8C 3CSPA 5D93C 1MUJA 2OTWA 4O00A 1CE6B 5ILTH 1YEEL 43C9B 3QIBB 3OZ9H 4LHUG 1NDMB 4H0IA 5HHXL 4LSTL 3K2UH 3VGAC 4HJ0D 3RDTA 2GK0A 5D7IF 2LTQB 1ZGLA 4HF5H 4ODVL 1AGDA 4RWHA 4HFWB 1NKRA 1R5WB 1OAQL 1IL1A 3A6BH 4KI5F 3BH9A 4APQC 4JANA 3EOBB 3WCYA 2XKUA 5E2JA 1RURL 5EDXA 5IUSA 3T0EE 4HV8A 2VLRB 2JB5H 3SBWA 1C1EL 4OFYA 3ZE0F 4NZRL 3QIBC 5C8JA 3IVKB 1SJEB 3I3DA 4U0RB 4YXHL 2OI9B 1FYTD 1GZPB 1WZKA 1HKFA 4LARL 2E3VA 3GMLA 4PRNA 5IQ7H 4NZJA 3CSBA 1U8LB 1V8HA 1REIA 3QQNA 2E9IA 2LTQC 3WDJA 2ERJB 3MRMB 1IGIL 4XC1L 1MWAL 4OD1H 3GSVA 2BSRA 3GHBH 1DZBA 1WAAE 2VDKH 4R7NA 3WJJC 1F90H 4OV5A 2VXTH 1CK0H 5HI4D 4OFYD 2VDLH 1I7TA 3L3GA 3OSKA 5HI3D 2V2XB 4Y5YB 4HH9A 4OLZL 1B4JH 3LMJH 5ESAA 1CD1A 2AKRB 4S1RH 1F02I 1ZVSB 5LXGL 4U0RC 1FIGL 3FO9A 4PBXA 1J0KA 2CLRA 1QLFA 2APWA 5E6YA 3V0WL 5D7SH 3TNNB 1MJ8H 4PJIE 1RZKC 2ERJC 4ZFGL 2NZ9C 5DHVA 5A16A 4YHKL 2C7UB 2IQAA 5D72L 4JFOB 5DHVH 4XCEA 5T33L 5DO2D 3NFSH 2YXMA 4JKPL 1XCQA 1KLGA 3FTGB 1FYHB 1MFNA 4L3EE 4N8VA 5EUOE 5B39A 3VH8A 4KZEH 2ZUTA 4LCWB 4I77H 1RZKL 1ZE3C 3NFPB 1YJDH 5CFHA 4L3AA 4UTBH 1DBKH 3V7MA 3HC0B 4HBCL 2ZUVA 3MCG1 3PDOA 1S7XA 3QEUB 4PRHB 1ETZB 3QRGH 4OZIF 3FN9A 5CD5C 3VD4A 1FVCB 2PCPA 1KN4L 3TGXA 3X3GL 5HYQA 4OUOA 3HG1A 1YMHA 1IZKA 2I5YH 4MA8L 4QGTA 2FHBA 1TVBB 4X4ZA 4FP8L 5IEKB 3VXUB 1H3PH 5GGRA 2X10A 4POUB 1RQ5A 1S8DB 1IC5H 5DSCB 3SDDC 2DIAA 3VWJB 1JN6A 3RKPA 5TDOB 5KS9E 2F53B 4OLUL 1BEYL 4DKFH 2WLZA 5T3XH 5CBEB 4Q6IA 2OCFD 3GFUA 4HKXA 3TCLA 4ISVA 3X14B 5HXMA 1MFDL 4GW5A 3BI9X 3G6JE 4NIKB 4RGOL 3CX2A 5KAQF 4LMQE 4WHTB 5ADPH 1MCBA 4JO4L 3FO2B 3D85B 5T3XD 2VISB 4R4FL 5M94B 3U0TB 2DICA 5MEOB 5INDB 5C92A 3PXJA 3DVFA 2EDDA 2NYYD 5GRVL 2AI0H 3PWPE 3LKRB 4WUUE 1E27B 4M7KH 1R3LB 3GSOB 3I6KB 3BD3A 4HMEA 4H0GA 4X6CB 3T1FB 5I66B 3GBLA 1T1ZA 5D8JL 2OP4H 2Q3ZA 4RBPH 2EICA 4Z95H 1D6VL 3ZDXE 2GCYA 4ZUWA 4GLRH 4YHPA 4IRJD 3SO3B 1FQ9C 2XQBL 3L95B 4QHMB 1A4JA 1S7QA 5ALBH 5C0GB 5IW6A 4NCDA 5B21A 4CVWA 3HKFA 3UJIL 1XFPA 2CR6A 3DGCR 1VENA 4XCYB 4KKCC 3QISA 3DYOA 1N6VA 3JWDC 4OSUL 2JCCA 4JREB 4H88L 3VXSA 1NUNB 4BSVB 3RGVA 5IEHA 1QSEA 5A40E 3RJDA 4MA3A 3BEWA 1AR1D 5L2KA 1Q8MA 3U0PA 1FSKB 3AY4C 3V4VH 3ARUA 3D69B 4WFFE 3CXHJ 4XPGL 2YPVL 3WIFB 2JK5A 1I9JH 1Q9LA 4KMQA 5M95B 1MCSA 1ZXQA 4V1DE 3JWDL 3VXSD 3DPBA 1BFTA 2A9NL 3D6GA 4K9EH 1G6RA 1BD2E 4QY8A 3SQBA 1TJGH 3KJ4B 5L2KD 1G6RH 1GVIA 3JV0A 4JREC 4P57A 3HPLA 1U8JA 5DFVC 3BRGC 4K3DH 5CEXA 4QXWA 3VXRB 3EFFB 1A7RH 1FSKC 4YWGL 5BVPH 4S11A 5I6XC 3OR6B 3PNWB 1U8HB 1EO8L 4U1KA 2VZTA 4OM1H 1MI5A 2CIKA 1RUPH 2O5ZL 4QNPE 4URTB 1I1AD 3RJQB 1BIIA 2ZCLL 3ZTJG 1YEIH 3NFNA 4HIIB 2D03L 5HDBE 2PETA 2EIZA 1Q9KA 2MTPA 1TJHH 3FQRB 3MRPB 5JTWA 4MD5B 4NWUL 1LDPH 2XTJE 3SJVA 2IPKB 1OAUH 2JB6A 5ITFB 3T0BA 5D7IE 3F12B 2E7LA 3T4AB 2XV6B 5T1LB 2CJUL 3MO1B 4GQPH 3O6ML 5IT2L 3JUZA 3V6OC 3KYNB 3GSNA 3ZYZA 4LCUB 1IC7L 2D31A 5FECB 3NCBB 1CU4L 1MCOH 2RCSL 5ADOH 3DX6A 2Z31A 4P46B 4KI5E 2YD9A 1G0YR 2DS4A 3WYRA 4HPYH 4KK9C 3KPRA 3TVMA 2XZZA 1HHJA 3ZE0E 2VZUA 4MCYB 4N90D 1BFOA 3QEHB 4OCMC 5DJDA 1RV6X 1X4XA 4Z5RB 3CFBB 5T5FH 1M7IA 4I0PA 3BSZL 5D5MF 1HYSC 5AG9A 1MVFA 4F7CA 2OXHA 1MCEA 1HXYA 4Z7UB 2ZZUT 4NKOA 2Z31D 3GNML 1J1XH 3CH8A 2A83A 4AEEA 4RFOL 1CBVL 2GTZA 1VGEL 3TVMD 1V3KA 1P4BH 3OQ3B 4RFEA 4P46C 3HE7C 3SDXB 1RVFH 2MQ0A 3T77A 3U36A 4KHXH 2EYSA 3BISA 2IBZY 3MREB 2DJ4A 3LEVL 3IYLW 4GKZA 4JKWA 4XZUB 2NY4B 4P23B 4FQIL 5A2IH 4OIBA 4IRZH 5FM5O 5CWSB 2PF6A 4ZXBB 1IKFH 4OF8A 4NZUL 2Y5EA 1UWEL 5ICYA 3LZFH 2BNQB 2R1WB 1PY9A 2BXYA 2Y6SD 5HGBA 2RHEA 1A6UL 1L0YA 3F8UB 4HBQA 4J1UB 4LVNC 2JIXB 3KGRA 3ZT5A 4PLOB 4KVNL 3O3BA 2WUBL 3UJTH 3N1GC 3IJYA 2EDFA 1GIGL 1NMAH 3SDCB 1OTUD 3OAYH 4G42A 1I8KA 1OB1A 1YYLL 4ZXBC 2PR4L 5IVOA 3PIQA 5IGXL 1SM3L 5HY9A 2YBRA 5DK0B 3OKOA 5GPRA 5J06A 4Y16C 4O2EB 4GAYB 1JWSB 2A73B 1FL6A 1G84A 4LEOA 4OZIE 5GRJL 1SJXA 1UXWA 5JW5B 5FO7B 1WFUA 3BP5A 5DD3H 1PZ5A 4WW2B 4AEHH 3SDCC 1OD7A 5ACMA 1AD0B 2JLLA 4BFEA 2ORBL 4PGBB 4OZHB 4C56B 1N5AB 2DQTL 3VRJA 5HI5C 5IP4A 3O6FB 3MLXL 4XNYH 2UUDH 5H37H 1H15B 4NO2A 4P5TD 3FHQA 1MSPA 1H8NA 3IETB 3NZHL 5FGCB 3B9KC 4U1IA 4MJ4A 4WU5B 2BVPA 4DWHA 3F7YA 4AIZB 4QO1A 1F6AB 4X99B 3KLSA 1CE1L 1OL0A 1ND0B 4NN7B 2BSED 4YDJB 4HX1A 4MNGA 3O6FC 1T5XB 4YHML 2PYFA 4O4YL 4RDQG 1CFVL 1B9ZA 1A21A 1DP0A 3GZKA 5HSFA 2DQDH 1KJVA 1O7SA 4NQUA 4PJBA 2AEQL 3QDJE 5BRZA 3D0VA 2BFVH 3H9SA 3GMPA 5IR1A 4AEIH 3GBMH 4JVUA 4BQCA 4DUWA 1UM5L 5IF0A 4MAUL 4NBZB 1KGCE 3E8UH 4ONOA 1TTFA 3U2SA 1CG9A 4NYLA 4WFGD 4Q9RL 2XXMB 3MCLH 4LRIC 4PTUB 2J8UF 5DEFA 1JHTB 4JHBA 3ULUC 3BGFB 3ESVF 3U4BH 4PRPA 3G5ZA 4I2XA 4YDIH 5BRZD 1INEL 4WWKC 1K5NA 5CAYB 1NC4A 1JTPA 1VACB 4WNQA 5J11B 4MWFB 5K9QG 5DEZA 2XA3A 3S35X 3UJJL 5ALCL 4BZ2H 3SPVB 3ULUL 2VTFA 3MFFA 1T3FA 4PRPD 1FL3B 5L0QB 2R2BB 3CFKA 2UZIH 4YDLB 4OQTA 3P4NA 4LF3A 1MCNA 5C9JA 2VKXA 4LDOB 4L8CB 1ZHBA 3U9UA 4JFFB 4M1GH 3MOAL 5GGSB 4WI3A 5KBNC 1NAMH 4NDMB 2LU4A 1RUKL 2BP3A 3SKJL 3EOTL 3GMRA 5B4MC 1CLZH 1PEWA 4DCQB 5AZ2H 4OI8A 1J1PH 5IBTH 4U6HB 5L0QC 3BZ4B 2OJZH 3IDYB 5D1QA 2R0KL 1MCFA 3HC4H 2EO1A 1KTKE 1FV1B 5C09D 1MLBA 1CFQB 2NTFA 4GG8A 4PB9L 1C5BL 3KPOA 3AU1B 5GZOD 4Y89A 4I48A 1P69B 4MZ3A 1SMAA 4EKXA 4OM0H 2FGWL 3ZO0A 1MHEA 4PJHB 1NGWB 5T1KA 2C1PB 5D1QD 2YK1H 5HGHA 3P9MB 5JQHC 1JI1A 3G5VB 2VR4A 1KTLB 4QRPB 3BN3B 1QR4A 1CL7L 3UTTB 2IFFL 1UKSA 2ZSVA 4BQBA 3CFDA 4XAKE 2X42A 4WHYG 4S0SD 2AEPH 2XWTB 4ODUB 4FQQB 4EDXB 5DRXA 1IQWL 1FZMA 2BY2A 1ZHKA 2FEDC 1B0RA 2R8SH 3TH3T 1XR9A 1G9MC 2FSEB 3P73A 5D5ME 1CFNB 4CN6A 5HPMA 2HT2C 3VWKB 3IGAB 1X7QB 3WUZA 3VXPB 1ZEAL 3LN5B 1FZJA 4U1SA 2QHRH 2DMBA 1T0MA 1RFDH 1S7VB 1CLOH 4S1SH 4G6KH 4OD3L 4KDWA 2HT3D 1KCRH 1GH7A 4PJGB 2X1PA 3FFCA 2Z91A 3VI4F 4UI2A 12E8H 3PWLA 1MEXH 4OBSA 5E9DB 2YEZA 4HS6B 3MRBA 3LV3B 4RISL 5ID1B 4Q7DA 5IW1A 1UH4A 5KVGL 3VWKC 1CTOA 2Y07H 3ARXA 2VLLA 3F58H 3HLAA 5GJSH 2DD8L 4H26B 2NY2B 1EUTA 2MHAA 4X6DF 4GRLB 3HZVB 4ODSL 1NCDH 1FGNL 2DQIH 4HUWB 3SHSA 1VA9A 1DBBL 2V5SA 1JPFA 4HXBL 2O61B 5LGJB 4PREA 5LAXB 3NA4A 5HGAB 3OBAA 2B20A 3ES6B 4XMPL 5TDPB 3RKDD 1RZIB 3L5WA 3IDXL 2PO6B 3CK0L 4NO0A 2VQUA 1OPGL 4IOIA 5K9KB 2NY2C 1LK3H 1PZUB 4F57H 3WHXA 5GRVK 3U0WH 4GRLC 2R23B 1NUGA 1PKQB 1SY6L 1ACZA 3AVEA 1HHHA 1WV7T 5C07A 1A5FH 3MRNA 3MNVA 4FZEL 4KK8D 1A3LH 3CH1A 4HCRA 1KJ3H 4NO0D 2QQLL 4HCRH 4K7PH 1MCQA 3MJ8B 1W0VA 2DQCL 2PO6C 2FATL 4PLJD 4G9DA 5I1IL 4TSAH 4GW4A 2YC1B 2GT9A 4U3CA 5C07D 4R2GD 2VLME 4IIQA 2PTTA 3QULB 4M6NH 1OAZH 2R9HD 2WWKO 3GGWA 5TH2A 3KYOA 4O02L 43CAB 3WLBB 2R2HB 1KF9B 4JY5H 4Q0XH 4B53A 3MLYH 5DQ9A 3V0VA 5GZND 1QFOA 5L6YL 3MRGA 1NBQA 4I4WA 3QXDA 4UAOC 5DJ0B 3K81A 1M7DB 3SE8H 4QKXB 1AGEA 4FFZH 4HGKC 3LVEA 1KCVH 1U8OB 3GIZH 3GM0A 4FQ2L 1J8HB 3QEQA 1ZTXH 3NCEB 1YQVL 1I7RA 2ICWB 4L4TE 3WDIA 3GMOA 5EZOH 1EFXA 3LKSB 5K9OA 1QRNA 2WWMC 4JGJA 4ONFL 5CP3A 2J8UE 3KXFB 3FKUS 2G75B 4TVSa 5EIIA 4ZAKB 2JJVA 5GRZA 4TSCH 2FR4A 4JRXA 4M1CC 2W92A 4ZO7A 3JTSA 3QEQD 1A1OB 4L1HA 3QH3B 2VC2H 4FG6D 3TZVA 1OF2B 4P2QE 2C3VB 2YPKB 5HJ3B 1ES0A 2ATKA 2HJFA 3O3EA 2P5EB 1QRND 3BAEL 1RZ7L 1YQ2A 1A7OL 3QWRA 1TZIB 3HA0A 3IRPX 4JRXD 3CFIC 2AK4E 3WNPA 4EI5D 4NQEA 5C6WH 5IFHH 3TZVD 4ZOBA 4XNUH 1MY5A 4FMFA 3VXQA 3CU1A 3IXTA 1TIUA 3EDFA 4YDVA 2AJUH 1EBPA 5BW7A 1F5WA 1JF5A 2NY3B 3LIZL 3CVIH 1KTDB 4X6FB 1ZLUH 1K2DA 1XGTA 5D7LB 3QHZL 3QEGH 5MENB 4WU7A 5TE4L 2ICEB 3JV6B 3HRPA 4NQED 4CDHA 5IMMB 4CN1A 2ZG3A 1I7ZB 4H8WC 1FORL 1P1ZA 1PY4A 4QRQB 1TZHB 1P7QA 2BXZA 3AMLA 3U7WH 1UM4H 4GRMB 1DLFL 2O26U 4ZUVB 3D2UD 5AUMB 5ICZA 4LAQL 5J13B 1A02N 3HI1A 5DD1L 4E41B 2YKLH 1XF2B 2NXZC 4X8JB 3HUJA 2J7LA 1FNFA 3TIDB 2A77H 2EXYD 3EOAB 4L8DB 5D6CB 4XXCC 1J5OH 3CDFA 5D2NC 4QLRA 3ZYJA 1B0GA 2H3NA 5FAAA 1U36A 3PL6B 5CJOH 3L3IB 1N6QL 2ZP0T 1YNTA 1G7QA 3BQUD 3TO4D 1R6VA 5SWSA 4POYA 2WP3O 1YMMA 2GJZA 3IT8D 3N1QC 5ISZA 2MMXA 1ZLVK 5JHLH 5KVFL 3RWJB 3UX9B 2XPGB 4S2SA 5EU3A 1I8LA 3ULVC 4YHIB 3PL6C 4HEME 3QIUA 3AS1A 2GTWA 3WXVH 3HMWL 1SYSA 3U6RA 4OIIL 5SWSD 3B3IB 5DDHA 2XNAB 4ZUUA 3FCTB 1S7WB 1YMMD 4NKDA 5IIEB 3VI4E 3MUY1 4JRYB 4Z7WB 3GO1H 3M17B 5IKCA 4XP6H 1OHQA 5LWYL 2UY6A 5F3BA 3QIUD 3BPCB 3ARFB 4ELMF 2PNDA 5SWZE 3VE0B 1NANI 4X6DE 1K4DB 1OGTA 3VGBA 2H9GB 1XF3A 3TH2T 4FXKB 3MLWH 1KEGH 4J3TA 4LHQB 1PYWA 2QADB 4NQDE 2Z8WC 2X4NA 1R24A 4TULL 1YY9D 5FO8B 2HN7B 1NLBH 2NY6C 4YAQA 4JO2H 5AG8A 1I75A 4KDTC 1FN4B 3FT4A 3UMTA 3KPNB 2B1HL 1F6FB 1CXIA 4LNRB 1FRGH 3OWEA 3HR5B 2CIIA 5TF1H 3MX0A 1PSKH 4LAJH 2EYRB 3BE1L 1YPZF 1FNLA 4NN6C 4Y1AA 1TCMA 4G8GB 5DJ8A 2DM3A 3IDGB 5DUBB 4YDKL 3OB0K 4WY7H 4WTXA 2X1QA 1A7PH 4PG2A 3RGHA 3BX7C 4M43L 3OKKB 4UV7L 5IG7A 1P2CA 1J8KA 5C7XH 2V17L 3NPSB 3T0EA 5CIPB 4N0YH 4O2CB 5T1DH 3ARWA 1GJIA 4YXKL 4LLDA 2J5LB 2BK8A 1JPGB 3FOMB 4WJ5B 3RX5A 3MROA 1DFBL 1DQLH 3R8BB 5E6ID 1QKZL 4U0QB 4IEFB 3BP7A 4XMLL 3GJFB 2OSLB 2UVEA 4JDVA 1Q9OA 3PABA 4NNXB 3S96B 1RJLB 4U4BA 3EJZC 1WAAA 1UVQA 4EN3B 3T0ED 3LS4H 5I71B 1I8IA 2F5BH 5CP7B 1MRDH 1N2RA 1Y18A 3NPSC 2FJFA 4RCAA 4MXQD 5D1ZD 1IAKA 3W0WE 2DL2A 3HHRB 2BY3A 1P53A 2NY7L 2J5LC 4PRDA 3BXNA 4WI2A 5GQBA 1Q72L 2VABB 4YHNA 4NKIH 4PJIA 1HEZA 2DBJA 4NC2B 1IQDB 3HMXA 3V8CA 3Q6GH 3BZEA 4JY4A 4EN3C 1JNNL 3HMXH 4G7YH 1RMFH 3DVNB 5JW4R 1INQB 3ARVA 4WENB 3TO2A 3OKDB 3BPLB 1A64A 2AK1H 3T1WA 4HK3N 1SEQL 2AGJH 2YD5A 4NJ9L 1NCWH 1TJIH 3OKEB 1FG2A 2QTEA 3S37L 3DI3B 3KPQB 4J8RA 4OAWB 4KH2A 3BDXA 4K7FB 3B5GA 3LAFA 4XH2A 2A2QT 5F9OL 5C0JA 3AXLA 3C9NA 5ID0B 4UU9A 4MS8C 4L3ED 2VZOA 3MRJB 2EDXA 4WFEE 3DBXB 2R56L 1D6EA 1DVFD 4N5ED 2D7MA 5KSVB 4PB0H 1T0PB 1IEBA 2FB4L 2AJ3B 2E7MA 1M05B 4TNWK 2OK0H 1D5XB 5GISL 1PAMA 5KS9A 4X4XA 3MUZ1 1FJ1B 4NOBA 3ZKXB 5DD6A 4ZTOL 4G9FB 4BJLA 5JXEA 3DMMA 3D3VB 3LRHA 1BGXL 4J3VA 5F89A 3C87A 3QIWA 5DJCA 4F7MA 8FABA 4LASL 4FFWC 3P0VH 3G6JA 2VLRD 2HTKD 2XWJA 4L4JA 2YD4A 1KYOJ 1HYRC 3T08A 3RI5K 1FNSH 1VFBB 5JIHA 4RX4A 1U8IA 1KENL 4HUKB 3BKML 3DMMD 3PWPA 3RVTC 4WUUA 4P2OD 4L9LA 1KACB 1XCTA 2P4AB 2QSCL 2YPLE 3EFDH 4PJCF 3QIWD 3MLSH 4PJ9B 5BO1L 3ZKXC 5ACZB 3GKZA 1D5IL 5C6PB 1X9QA 5I1CH 4GSDH 1T21A 3TBTB 5KW9H 3BWAB 3BZDA 2MWCA 3EBAA 1RZGA 4KJPC 3UP1A 2W59A 4FNLL 4OIAA 5EOTA 4JRWA 3CMOL 4I9WD 4Y4KB 4HT1H 3HNSL 1WUNT 3PWPD 4WUUD 1NAKL 4HJGA 3TA3A 4F58H 4TUJA 5HDQL 2I60H 3I9GL 1LGVA 5F88B 1FVEA 1F13A 5CMAB 1BOYA 1OARH 5TE7L 4PJ9C 5AD0A 3BO8A 3CLFL 1H5BB 3RPKA 3WEXB 2VRAA 4NNPL 1IGML 2SEBB 3PHQB 3G08B 1YC7A 3SE9L 2MQ3A 2OL3A 2XG4A 3O8XC 4TUOA 2P48B 1M71B 5BQ7A 4L1DA 4V1DA 1AQKL 1GHFL 2OL3H 4HKJA 1CFSB 2DQGH 2L7JA 4AT6A 3H7LA 3C08H 4KJYB 3C2AH 3ISWA 4BQ8A 1KB5H 1T04A 2IMNA 1U92A 4WFFD 4F9PA 1BBJA 5I1DB 4WIQA 3D9AH 5FHAH 1H5BC 3BHBA 4DTGL 3QFDB 5I73B 4KMTH 4L4VB 3LH2L 1WBXB 4ELME 4D9RD 3PGDB 2AQ2A 2IGFL 4V1DD 1E4WH 2HH0H 2B0SL 1JWUB 2Y5TA 4GAGH 1BZ9B 1BD2D 4A2LA 3QUKB 3VDCA 5D70H 5GXBB 2R1XA 3DHMA 3ZT6A 4MVBD 1MIML 4Y4HA 4FQLL 5KVDL 5IMLA 4TVPL 3VJ6B 3UCRA 3GKWH 3O41B 5F1NB 1E6JL 4PJEB 5HD8D 1CD9B 1G9NC 1T4KA 3GMQA 1FNEA 4I3SL 4EI6A 2B1AL 2P7TB 2AV7A 2ZNXA 7FABH 1YPZE 2QQQA 3LKPA 1P9MA 4Y4HD 4LQFL 4R4NC 3TH4T 1QBMH 5D7IA 5KTEL 1L7TH 4GBXB 4WV1C 3QNYB 4MNHB 1HDMB 3DRTB 5BZWB 1ZKAA 1T83C 5I30H 4PGEA 1PG7X 1ZS8A 5HHNA 3MLRL 2XWBA 2XTJD 4RFNB 4WW1A 3GIVA 2HFGL 4LEXL 4NQVB 1HINL 1C12B 1FGVL 2M8XA 4H20H 2ADIA 3P3YA 1H3XA 1YEGL 3U1SL 4JPWH 3TN0A 1HHKA 1NGQL 1A6ZA 4KK5D 4CADA 4ZYKA 4KI5D 2X7LA 1AXSA 4ODWA 4D94A 1JIBA 3KPPB 4Y0GA 3MACL 1YZZA 4L5FH 4PS4L 1BM3H 4UTAL 1NGPH 3TV3L 3O6KL 4M1DL 5F6IB 2D0GA 1H3UA 4RFNC 2VXSL 4LVOB 3G5XA 3MBEA 2HKFL 3DGGA 1ORQB 5GHWH 2NMSA 3ZT7A 1K6QL 3IDJA 1YN6A 1JHLL 2EKSA 1F4XH 5EZLA 1AO7B 2YN3A 1GPOL 1I3GH 25C8L 1TVDA 3T04D 2JTDA 5J6GB 1MHHA 1TDQA 3O2WL 3ZYIA 3MBED 2J4WL 4ELKB 6FABH 1WIOA 4NQSB 4FQCH 3BP6B 4XBEH 5FF6A 4KVCH 3B8YA 4LVOC 4XX1G 4N0CC 4KTEL 1JI2A 2XQYG 4O2FB 2UV3A 2R0LH 2W0FB 4LCYA 1BQLL 4AMKH 1GOGA 2NY5H 2YRZA 2ARJB 3VGDA 3QHFH 4LDLB 4WTZG 1QTYT 5DHXB 4JB9H 4FQXC 4HWEL 5LCVL 4OCSL 3UTQB 2Q8AL 3H7BB 4OZIA 3DSFH 1L7IH 3T2NH 4C57C 1C5DA 5LBSL 4P4RA 3MRKB 3REVA 5IOPA 1DSFH 3L1OL 5JW3H 2WSKA 4TSBL 3WKNA 5A3ID 1LK2B 1NJ9A 1EGJH 4X5XB 3ILQD 2J12B 1WTGT 1G1CA 4AYFA 1EMTL 3RZCA 4FQHB 3AB0B 3PWVB 3A67H 1G0XA 1S9WA 4OB5L 5F1IA 2R4RL 4AY0A 1UB6B 1Y6MR 5F9JA 3S5LG 2B2XH 1NC2D 4D0CB 3KWWA 1C7SA 5C0AB 1BJMA 1MCDA 3RZCD 1R5IA 2E7HA 2GITB 4X9BA 3T3PF 3S88H 3LKQB 2XRAL 1FE8H 2XN9D 5ENWB 1IAOA 3LHPL 4PJCE 1QSFE 1YN7B 3UZEA 3QDJA 3WFBH 2Z9TA 3DX9A 4Z0XA 2CGRL 3I2CL 2VWEC 2BVOB 2P5WA 5C0CB 3HR6A 5C0EB 5JQ6L 4QXGL 2JJSA 2IQ9H 3OPZL 3OKMB 4XHJD 1CR9H 2R0WL 2H32B 3CVHA 3VFSA 3WS3A 1FCCA 3HB3C 1UC6A 3FAWA 3CVHH 4UZGA 3MOQA 3I6GB 4KKAD 1NGXB 2F5AH 1AP2A 4X5LA 3QDJD 2VDOH 5FV1L 2QR0A 3VFMB 3GEWB 4FABH 2BNRE 4XNZC 1KGCD 3MRIA 4HLZH 4RDQF 2BNUB 2G9HA 5J6HA 3UPRA 3BOVA 1S9KC 4FS0A 4KHTH 2YD3A 4YQXL 3E6HA 1VB9A 5T3ZL 4Z8FL 1CZ8H 3R0NA 2GAZA 1HOCB 2VDNH 4I18B 5HHPB 3DUSB 4NHUB 5E4EC 5E8PA 4CMHB 1FZOA 4JM2A 3TF7C 1QA9B 2J1KA 5I9QC 5EU6B 1E28A 5C0IA 4X80L 3CMGA 4FTVE 4KRPD 4XMKH 3GSXA 3MV7B 5DVMA 2QJDA 2MCPL 4XGZB 5KANI 2R0ZL 3WUWB 3DV4A 2HWZH 2AJSH 2FYYA 4WUKL 4K7PX 1T5WB 5AYUL 4NZTL 4IS6A 2Y06H 4X9HA 2OLDA 1Q94A 4I18C 1H8OA 4M5YL 3RY6A 1DQQB 4KJQC 4CMHC 3EZ8A 4U1MB 1MH5A 4GAJL 3ARED 1SJHA 1AQDB 4YGVA 1YECL 1Z9SA 1JHKH 2BY1A 3P9LB 1PG7W 3KJ6L 3MBXL 4JG1H 5EC1A 4M62L 3MV8B 2ZOKA 5D96B 4JFEE 5CSBA 4MD4B 5E7FA 4IOSD 3QWOA 4HGMA 1JYXA 3C6SA 5SV3A 2ZSWA 3FT2B 4M6OH 1DEEB 4OCRL 4J3SA 1X3DA 4HG4K 4PJDF 4GKSB 2VB5A 4H25A 4LLWB 4S10A 4R90H 5E2WH 2CQVA 3X12A 3TPUA 3ZKQD 4DGYH 4YR6A 3FB8A 5L7XL 2RR3A 1U8MA 3OR7A 3VMPA 4LPVA 2N4IA 4AL8H 3GJFK 3MRLB 4XAKD 3O3AA 1EDQA 3FN0L 1WCQA 4YNYA 3MA7B 1MAML 1QO3A 1RZFL 1K3IA 1JL8A 1VADB 1T0NA 2YSSA 1KIQB 4LPUA 3H0TB 1MHPL 5IROC 1JGVH 3S6CA 4Z77A 4N0UB 1T2QH 2VXUL 5E1AA 4U6XA 1DDHB 3V5DA 4XNMB 2F19H 5IB2B 2VL5B 4JQVC 3QG7L 2AERT 3KNBB 5DJZA 5IFJB 4PJAF 2VDQL 3VD7A 1RIUH 4L3CA 1AHWB 3ZTNH 4ZNEE 3ZKSD 2XG5A 1UA6L 4IJ3B 3U4EA 3L3JA 1PDKA 4L29A 1Q0YL 1V5JA 3FB5B 5JHDB 5TPWL 4XP1L 3BKCL 3RI5F 1JZ2A 1YEFL 3IDNB 4PJHF 4U1HB 1AI1H 2VXVL 8CGTA 3RA7L 4JGUA 2LVCA 4QHUB 2DJUA 3L7EB 4MYWB 1FL5B 1AHWC 3FO1A 3NGBC 4ETYA 4ERSL 2GK2A 4HIHB 3FO0H 1QRKA 2DWEB 3IDIB 2IAMA 4X6BA 1K8DB 3NH7L 1YNKL 1LEKA 1XGYL 4PRIB 3CSYA 1PVHA 3CPLB 1BFVL 2CK0H 1A14L 2B7DT 4LKXA 1HHIB 3JV4A 4GW1A 4R8WL 4ZO8A 4JN1L 4PP1C 1ZWIB 1HH9B 3CFCL 3L3KA 5BV7C 1ZLSL 2VSDA 3PQYA 2IALB 2MSPA 4XVUD 3RWGB 5TQ2H 1AIFA 1RZJH 1C7TA 5AAMA 4XP4L 1BWWA 4OLEA 4HUUA 5JZ7D 3QCUH 1JBJA 5EU7C 3SO5A 4IRSD 5C0RH 5L2JB 3GB7A 1CF8H 3T3PE 3FQWA 3VCLA 4OFIA 1IT9L 1UCBL 5EU5A 4MD0A 1V7ML 2X70A 2VIRB 4RIRB 1FO0H 2R4SL 1A9BA 2DL9A 3EGSB 4N9GB 1UKQA 2V2TA 2V5YA 4M5ZH 5AZEH 5JW4N 5EOQH 3RX7A 4ZPTB 2DQJH 4FQ1L 5SX5K 3DECA 1GGCL 3Q5TA 4X5WB 4MDIA 2DWDA 4G6MH 4DZBB 1NFIB 3EYQD 5L88H 4YIQA 5E8NA 2F9BT 3R4DA 1D9KA 1ERNA 5C2BH 1WZLA 3C5ZA 4U3XA 1RK1B 1N8ZA 2Y4SA 1K4CB 2XZAL 3QI9B 1CFTB 5JDSA 5F6HI 1ZLWH 5T1MA 1J7VR 1I7UA 3D0LB 5F7NC 3HPJB 5FKPA 5HVHB 2GUOA 4L4TD 4P2QA 4LCCB 3STLB 3GSUB 5IJKA 1H8SA 2CK2A 3ROLA 5FYKL 4HUVA 4O58L 2C1OA 1D9KD 4X0KA 3CX5J 3O45A 2W9DH 3QUMA 3BWUC 3LKNA 3U9PL 2BOBA 1INDL 4BFGA 4YBLC 2AK4A 3QUMH 1R0AH 1DBMH 3UBXB 1VKXB 4MB4A 1GOFA 3QI9C 4P2QD 2PYEA 2V7HA 3QQ9D 4R26H 4UB0H 4F7TA 4LQ1A 2ADFL 2FRGP 2PXYA 3H3PL 5HVHC 3K8MA 5CD3B 2D7TH 2WIMA 3BKJL 2P47B 3DYPA 2FJHA 2J8HA 2FWOA 1JNLL 4EUPB 1KC5H 2CXKA 2AK4D 3ZE1F 4XPAH 3WNKA 5HHME 5FDWA 3U82B 3VXOA 3VD3A 3TP4A 2FJGA 5EC2A 1NCCH 2PXYD 4P4KA 3OJDB 1URLA 3L3OA 1XIWD 4G6JL 3WIIL 4DN4L 2G60L 4PY7B 3MODH 1DEDA 3P4LA 4UIMB 3UYRL 1LNUB 1XH3B 1IGYB 3TJEH 2LAAA 3MRCB 3UBXG 4P4KD 1DUZA 4EVNA 4ESKA 1XT5A 2NXYD 2X4UA 4KUCF 4UUJB 1G6VK 3QPXL 1Z9OA 3QXUA 3SKNB 3S35L 3EO0A 3MZGB 5GGVH 2ESVB 2BX5A 2FECI 2NX5E 5C0FA 3NCJH 2ZNWA 3OMZA 5D7KE 1LWRA 5B8CC 5DQDL 4KPHL 4F33B 4U7KA 2VLKE 2XZQH 1BOGA 4G80B 2OZ4A 4UIKL 3NZ8B 4GG6B 2OZ4H 2A1WH 2XQYK 5IM7B 2Q7YB 3GDBA 2VQ1A 3ARDA 1LO0H 3K8KA 4QRRB 4QF1A 4D3CH 4Y4FB 4MAYB 2KZWA 5CS7A 35C8H 3OXSB 1S5IL 2NY1D 2XICA 4MDJB 3PWUB 4YHOH 4JFFE 4QT5A 4HKZA 5IVZA 4RNRB 2Q86A 4XBGB 5I1LA 5BS0E 3QQ3B 3ARDD 3A0OA 5H35B 1WT5C 2OTPA 3L5XH 1GL4B 3LSOB 2QKIB 4PJAE 1I9IH 1Q0XL 5SWZA 2CUIA 2W91A 3QFJB 2RFXB 1ZGLP 1NEUA 4EQ3A 4FQJL 3X11B 2UZXB 5CJXA 4I8DA 5DJ2A 4ZFOB 1J0HA 4ODHL 5L8KB 5IHUH 4K3GA 4NQDA 3BZFB 3MLUH 4RAVA 1N7MH 1K3ZA 3L7FB 1YEHL 3S3PA 5FKAA 2VDRL 1FNGA 1YNLH 4KJWC 4PJHE 1UXSA 2P44B 1ZT7B 1OWRM 1JGUL 5FUOL 2WIIB 1L0QA 3S97C 3QA3A 3PDDA 3ALPA 1WTLA 3IJSB 1D7FA 3B9VA 4NJAL 4PJ8A 2CLVA 1Y6KR 5D9SA 2DLEA 4R0LA 4XCFL 5ICXA 2W0PA 3ULVF 1LDSA 1EBAA 3QJHA 1OSZB 4TOYL 5SWQA 4HGWB 3O4LE 2BSTB 3G9VA 5IB5A 1JZ8A 1CICB 4Y2DC 5FB8B 2WWKT 3OG6B 3BPNC 4MCZB 1KJ2A 3ECBA 1JGEA 5I1HH 2W38A 4P59L 3SOBH 1T1WA 5CJBA 1KJ2H 3MV9B 1OP3K 1L0XA 5IBLD 4L9DA 4XBPA 3Q3GA 1F4HA 3QYCA 4PJ8D 5J0BA 2H41A 1T1XA 2EEDA 3RL1A 4QXTA 3MJ9L 4ZFOL 1JPSL 2B8OT 4GLRI 4OQ1A 4KZDH 3ZYOA 3L6FA 4LSPH 1N4XH 4OZ4A 1CLYH 2R15A 3NCMA 5HYJE 3WIHL 5KVEH 5GGTL 5DI8A 5CJQH 2A6KA 2VL4A 3W0WA 5J1AA 1EAPB 2VDML 4F2MB 4JFXB 1HKLH 3UZQA 1BWMA 3QUXA 1I3RA 3FMGL 5KSBB 2FEEI 1CLCA 4JR9L 4HC1L 3VFOB 5D1XB 2M26A 5HGGS 2X4RA 4JZJC 2E9WA 2NLJA 2Q6WA 2XACC 5I2IA 5K9JH 4CNIB 2NW2B 5SV4A 1MPAH 5E2VH 1CDYA 1BF8A 3W0WD 3OKNB 4OGAD 4WEBH 1SBSL 2ZJSH 4XVSH 5EORH 1GAFH 5JPMB 4OLWL 1YEDB 3PV6A 5KSAC 5I8CB 3L5IA 4ZS6D 2CLZB 2CKBB 4XP9L 3VRIB 1J12A 2EDJA 4U6YB 5D1XC 3DIFB 1Q38A 2A9ML 3QO0A 3EDKA 3UTPE 5KSUA 1NCAL 2YUVA 2JJUA 1Y0LA 2E27L 4HIXL 3ZMRA 5CZXD 5E00B 1QOKA 2XIDA 5C0DB 5FM4A 3QBTB 4RMSA 2VH5H 2GFBB 3EO9L 4U1GB 5EBWB 3NIFF 1U91B 2H8PA 5C3LD 2ENYA 2ZOLB 3MUGB 4G7VH 3ZHKA 4RWYL 3SE3C 4XCCH 4U1LA 1OOAA 1UKTA 3MLTA 3ZE1E 3MJ7B 4BH8A 5FO9B 4WFED 1JWMA 3T8XA 5DJ6B 4GMTL 3MCKA 1MHCB 1MUJB 3MRHA 4CN4A 3BUTA 4U1GC 4KY1L 3M07A 1BPVA 2ZG1A 3HC3L 1K8IA 1PKOA 2YRPA 2GK0B 1Z3GH 5GSVA 1ZGLB 2WP3T 1FYTB 2VZVA 1IRAY 5ESQA 4AM0B 4YHZL 4HJ0C 3V79C 1I8MA 2UZYB 1F4YL 2ZCHL 3CFEA 1EXUA 1HIML 4WO4A 1IL1B 4BYHA 4EBQL 3CXDH 4HIEA 1UJTA 3KXFE 2X4QA 1IKNA 1HN1A 1S9YA 3IFPA 4WFHE 4HZLA 3B2UD 2FO1A 4HV8B 5C08E 1HWGB 4LLYB 3O11A 2CH8A 3MR9B 1NMBL 4XT1C 4P9ML 4Y8DC 3BD4A 2M2DA 2YPLD 3CDYA 5DD5H 2DI7A 3BESR 3MLVL 3FRPA 2DLFH 4WO4D 1B6DA 1ZANH 3SCMC 5B38B 2GYSA 3GSVB 2BSRB 3U7YH 4R7NB 4OV5B 2E6PA 3OZ9L 3W5NA 3I84A 1I7TB 2CO6B 3K2UL 4KMLB 5HI4C 3S7GA 4HH9B 4HF5L 1NDGB 1CD1B 3DLQR 3O4OB 5HI3C 4IDJH 5TGBB 5JW4Q 2CLRB 1QLFB 3LN4A 1IFHL 2X09A 1F3RB 3A6BL 4XWGH 1EHLH 3G04A 3SKOA 5DHVB 5A16B 3LEXA 3IFOA 5D7LE 2IQAB 4IM8A 5FHBH 2JB5L 4XCEB 3PJSA 1QFWI 5D2NE 2DLTA 2GSIA 3W2DH 2XT1B 1KLGB 5CEYA 5B39B 4N8VB 1LEIB 5IQ7L 4QEGA 3VH8B 5FOBA 3LRSA 3MLZL 3H9ZA 4X7DC 4HLJA 3O4OC 1FFQA 4OD1L 1P84J 2VN4A 3GHBL 4OZGF 4NCC1 5B22A 2VDKL 1F90L 1UACH 2VXTL 2Y9RT 3C60D 1CK0L 5B38G 5FUZL 2VDLL 3PDOB 5FDYA 1CGSH 1Q1JH 1B4JL 1XGQA 3LMJL 3OGCA 2PCPB 1UJ3A 4ZSOE 4ODXB 4S1RL 1YMHB 5T5NG 1YPZA 2GW5A 4JG0H 2M1KA 3ULVE 1MVUB 4M4PA 1MJ8L 5GGRB 1Z5LA 5DS8B 1YJDC 5EG6C 1HH6A 5FYLE 1YEKH 4DZ8A 3F62A 1JN6B 5GGUA 3RY5A 4K55A 3D25A 1VEPA 2BMKA 1G7JA 3BYTA 4YFDB 2BY0A 4HKXB 3TCLB 4ISVB 4KZEL 4GW5B 5B39G 1KPVB 4N8VG 5ANMA 4B41A 2HFTA 4Q2ZA 3WN5A 4B0MM 1YJDL 4O51A 3T65A 4UTBL 4H1LB 3CXHK 5DHYA 2QQNH 4OLVH 4IRJB 3N50A 3TT3L 4LHUA 3QUYD 3OTTA 3UO1L 4HK0A 4HXAL 3VFNB 1MJUL 5JR1L 4F15B 2I5YL 1T1ZB 4ETQA 2MQCA 3AM8A 2MPAL 2XOTA 3NCYS 2W9LA 1H3PL 3IAPA 4JY6A 4U1JA 1U58A 4WHCA 5EO1A 4YHPB 3OV6A 1IC5L 1OAQH 3DO7B 5LGHH 2FBJL 2WBWB 5IW6B 2AW2A 1U95A 4IRJC 5T3XL 1C1EH 3EYSL 3I6LD 4X7TB 3WE6A 4PV9A 1FFPA 1ZMYA 2JCCB 3VXSB 5IEHB 2BC4B 4F15C 2COQA 1MWAA 4Y19A 5L2KB 4DK3A 1P7HL 3KPSA 4XPHH 1WCBB 4XC1H 1MWAH 5ADPL 1MRFL 4H1LG 1OP5K 2JE8A 1NANH 1F8TH 2JK5B 3QIBA 5EBGA 1NDMA 3V4UL 2EYTB 2AI0L 3HG1E 1T6VN 4MQXD 4O9HH 1G6RB 4HKBB 1I85C 1XR8B 4Z78A 4F80A 1I1AB 2IPTL 4Z95L 1FIGH 4P57B 2HRPL 1H3WM 3W82A 1U8JB 1UZ8B 3WJJA 3S8WA 1EEUA 4KK6D 2CDEB 3LS5H 1UH2A 3NIFE 5C70A 4OFVA 4U33A 3IVKA 5E6ZA 1C08A 2W60B 2CIKB 1GZPA 4QOKE 2O93L 3V4VL 3NFNB 4PTTA 1I1AC 1RZKH 2AJZA 2X4OA 1FLTX 1S78D 1TTUA 3B9DA 1Z6JT 3TYFA 3STBA 2R1YB 1X5AA 4K9EL 3QPQC 4DJMA 1R3KA 2V2XA 4PJBF 4S1QL 3SJVB 4OUUB 4U6TA 1TJGL 4CU7A 1KN4H 2AKRA 2JB6B 4XC3H 1ZVSA 5DWUH 2V9TA 5JA8B 4Z0BL 1A3QA 3S36H 4X4YB 4FP8H 4K3DL 3V8OA 1VEMA 2ICES 3BGMB 2D31B 4YO0A 5BVPL 3DX6B 4HHAA 3BT2H 2Z31B 4MHHI 2C7UA 3DO3A 4JFOA 2XKNB 2FD6L 5EBLA 5GIRA 4R3SB 1VEOA 3KPRB 3TVMB 1BEYH 1J0ZA 1HHJB 4OM1L 2NW3A 1QSEE 2VITB 1U3HD 3FTGA 1BFOB 3DXAE 4MZ2A 1CXEA 3IKKA 1QSFD 4UOW1 1M7IB 1YEIL 2C4XA 3CD4A 4OGZA 1HXYB 1A3RH 1MJJB 4NKOB 1RJZA 3IU4H 3SDDA 4RGOH 3PGCA 5AWNH 3HC0A 1TJHL 2YUWA 4JO4H 5CD5D 4R4FH 1N5YH 1LDPL 2VDPL 4DAGH 2PTVA 1OTSC 3T77B 3G9AB 3U36B 5FUCC 2EYSB 1C5CL 2GSGB 4GKZB 1IGFH 1SEBB 5D8JH 3MFGB 1JGDA 2IADB 4PRBA 3BIBX 3SDDD 5F93C 1D6VH 5C6TH 5ADOL 1SJVA 2BNRD 1DQJB 4RZCA 15C8H 2ZG2A 2XQBH 2EC8A 1LD9A 5DSCA 4EOWH 3I02B 4BH7A 5TDOA 3QDGE 2F53A 1MI5E 3UJIH 5CBEA 2Z0BA 2B5IB 3O3BB