4ZXBB

Structure of the human insulin receptor ectodomain, irdeltabeta construct, in complex with four fab molecules
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
218
structure length
218
Chain Sequence
DIVMSQSPSSLVVSVGEKVTMSCKSSQSLLYSSNQKNFLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYFRYRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Higher-Resolution Structure of the Human Insulin Receptor Ectodomain: Multi-Modal Inclusion of the Insert Domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hormone receptor/immune system
molecule keywords Fab 83-7 heavy chain
total genus 54
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2015-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbB01
4HGWB 2NW3B 2R0WL 1WAAF 4H0GA 1QRNA 1KIUA 2BSRB 1FL3B 1RULH 2ADGA 3MA9H 5FYJH 1R5WB 5LGJB 1G6VK 5TQ2H 3L95A 2FB4H 3ZE2F 2BDNL 5C0GA 1BOYA 1ZGLM 4KVCH 1QVOB 2CIKA 5EULV 5F9WB 1A3QA 1CDIA 3MROA 1MHPH 3PWPA 1BD2E 4HFWB 3QQ9D 1KJVA 2BHZA 2IANE 3HZMA 2DM7A 2ENSA 4BH8A 3VXRD 4HHAA 1WSST 2K7PA 2G60L 3JV5A 5I1LA 1DBMH 5EH1A 1DEDA 3I50H 1K85A 3QIUB 2FECI 2AEPL 5DEGB 5FYKU 3SDAD 3X11B 3VH8A 1A3LH 3CFIC 4LL9A 5T1LB 2HFEA 1LO5A 2DQJL 3QUYA 4RDQF 3V5KB 4EI5D 3D39B 5EU5A 5FUCE 1UM5H 1JHTA 5CJOL 4LLVA 3IGAA 2I5YL 3O11B 1KENH 3AU1A 2VERN 4LAQL 5DMJB 5FHBH 1Z2KA 2YPLA 4B7LA 1BFOA 3LEYH 1IVLA 4IOFC 1RUQH 5C86A 3VXSB 5ETUB 1KB5B 1M71A 1U8QA 3PHQB 2XQYK 5CBEA 4XVJH 5LQBL 3WNPA 1BZQK 1CU4L 2HRPL 5IIEA 4URTB 4BQ8A 1JGEA 1M7DB 5I15H 3DMMC 4HIEB 5GGSY 5EO0B 2H32H 4DVBA 4OBSA 5BCAA 2KPNA 4JKLA 1QPXA 43CAA 3B9KC 5BVPL 2BXZA 5CP7A 3VWKD 1H5BB 2XZQH 1BFVH 3MRPA 2BHYA 4EZMA 1IE5A 2EEBA 1VEPA 1I9JL 1UT9A 2F58L 4D9QD 1VFMA 3QWRA 5I17B 1K4CA 2PYFA 4I8DA 1AGCB 1NQBA 5D2LE 3WIIL 3U0TB 4HJ0D 1LDSA 4HCRA 4KI5F 1EJOL 1BBJA 1ZT7A 1CLYL 3B2UC 3ZKMD 3ZO0A 2PN5A 3HFMH 2DI9A 3WSQH 3P4OA 2OTWB 3I84A 4YDVB 3UTSB 3WLWC 4XP1H 1VCAA 4XPGL 1H15A 1NUFA 2J8OA 2XRAH 3Q6FA 5IFHH 2WUBH 3R1GH 3PIQA 4HK0B 1MFEL 5I75B 2Y9RT 4XMLL 1OAYL 2R29L 3SKNA 3FRPG 1MVUA 4JQVC 4TTDD 5LGHH 2J6EA 1KTKE 2AJZB 3OGOE 3QXWA 1MIEL 2D0GA 4M7ZC 1T0PB 1FNAA 3IKCB 4YNYB 1I3RB 5B39A 1LO4H 5JXEC 1EHAA 3SGJA 1ONQB 4OT1L 2QHLA 4FHBD 4G3YH 2GT9A 5JHDA 4O2FA 4WU5B 1CD9B 4OFYA 1K5NA 3FQNB 5T3XE 1JGEB 1M7DA 2X40A 1OAQH 1B3JA 3QSKB 5HGBB 5DDHA 1OCWH 4BFBD 5I18L 5I8EA 2Y72A 1OWRM 4Z7WB 3GFUA 1K8DB 1SY6L 1Z9OA 3GBMH 5INDA 2MCPH 5FYJD 5DQ9A 4KV5E 3C60B 43CAB 1I3VA 4QTIL 2CH8A 3DSFH 4GFTB 2ID5A 1UWXH 5DT1H 1NFDE 5KVMC 3MRMB 3QB7C 4F7MB 6CGTA 4PRAA 2RFXA 3LHPH 2EEDA 2FJHB 2ORBH 1C5DA 4Q9QL 2BVEA 1AE6L 3G5XA 4Q0XL 4MHHI 2VR9A 7FABL 2H6PA 3LN9A 3P77A 3FMGL 4DTGH 3LRGA 3SDXB 1T20A 4RQQA 2E7CA 4AL8H 4ELME 1OGAD 4AK1A 1HOCA 1ND0B 4OCWH 3QDAA 2NTFB 5KSBE 1FJ1B 1MJ8L 1OSPL 5AEAA 3O3EB 2X70B 1UKQA 4YH6A 2JJWA 4UZGA 1HK6A 3KYMB 4WUUD 3WUWA 4NO2B 4OT1H 1NEZA 5KAQG 3ARDA 2UYLB 4XBGA 5DQJA 3DIFB 5F44A 4R96A 2AK1H 5E7BA 2P44B 1TVHA 3L7EA 4LSTH 1K6QH 3BPOC 3LQAC 3MRFB 3F8UB 1A1MB 5D2NA 3PV6A 2FSEA 3TBWA 1ZHLB 3MCLH 1X5YA 2N7AA 1TCMA 4M6ML 4UU9B 4PTTB 5D1QC 4PJFA 1YC8A 4P3CL 3V4VL 3BKYH 1F2XK 5ALCL 3HMXH 4ZTOL 1CFSA 2MMXA 4NKDA 3AM8C 3QXVA 3HNVL 4WFFD 4CAGA 3B2UD 1R24B 3PP4L 4HIXL 4N8CL 4OZIA 1LHZA 3TT1L 2NQCA 3WHXB 3OXSA 4S1RL 5J06A 3UJTL 1FAIH 1MY5A 3RTQB 1YMMB 4G8GE 5D8JL 5HGAA 3KG5A 2ICEA 2GYSA 4WEMB 4QRTA 5GSRB 1PQZB 3BD5A 3GDBA 4JRXA 5DYOB 4OIIL 3BPOB 3U30B 4NBYB 3ZDZE 4OGYL 1CF8L 4F7TB 5B8CA 3GO1H 4POUB 3QZWA 2X5PA 5C8JB 3DI2B 3QCUH 3PGFL 4G8FB 3KXFB 4RSVA 5CILH 2Z8WC 4I3SH 4JFQA 5I1AA 4XX1G 2CDGB 3WS3A 4MNGB 4L3EB 4KK5D 1A64A 1TIUA 5FECB 3BSZH 1RZIA 3MLSL 1FVDA 2IPUK 5BOZG 2BVUA 3FN0L 4OBRA 4X5WB 3UYRL 4PGCB 1U36A 3QEGH 4WFHE 5EG6C 1UWGH 3RVXC 1JMXA 1ZS8A 4FXGA 4K8RL 3FFCA 1KJ3H 1ACZA 4Y16D 5FA4B 2YZ8A 1HKFA 1DQJB 2R15A 4FQQB 5IB1B 2DQHH 3BQUC 1EK3A 3G6AA 2IMNA 1CD8A 4L9LA 2GI7A 3OGCA 4KI1A 5ENWA 5JW4Q 4PTTA 1DE4B 3SGEI 5EORH 1WICA 4QLRA 3MLYL 1F8TH 1FFQA 1D5BA 5KANG 5HPMB 4XPHL 4X99B 3MOBH 5TFSH 5IROA 3MBXL 1UJTA 1JGLH 3KVQA 2M8XA 3MUHL 4L1HA 4BH8B 2MHAA 5JW4R 5SWSE 1I7TA 3VG0H 2W9DH 2IADA 5ID0A 1IL1A 4YXKL 5FIEA 5DJ6B 3LMJH 4NJ9L 1A1NB 2BMKA 4L4TA 4RMUA 1FL6A 2OJZL 2VDNL 1MJJA 2QSCL 5DMIL 3DUSB 1U3HA 2XY1A 2DJUA 2DQEL 3RIFF 4G6KL 3HZVB 2HFEB 4OGYH 4Z7OE 4MLIA 1MJUL 5FYLL 4FZEL 4P2RE 3WYRA 4G8FA 1C08B 2JB5L 2DD8L 1WWCA 3A6CH 4MSWB 5IG7B 2E9IA 2BDNH 5JNYB 3BESR 3CX5J 4YFLF 5HHNA 4QRUB 4G8EA 4NQDE 1BVLB 3RUGB 1S7SB 6FABH 5GS0L 1N2RB 1EFXD 1NBYB 3GK8L 1TZHB 3O6MH 5C0GB 1NBZA 1QSZA 3HLAA 1JNNL 2F8OA 4M00A 3K4ZA 4UTAH 3FRPA 4EI6B 3D9AL 4QYOA 1U41A 3C6LD 3QHZH 4KZDH 4NHCL 1IBGL 5L8LB 3L5JA 2VQ1A 1MOEA 4NPYA 4TOYH 1A7PL 5GRUH 2XKNA 2OSLB 1UVQA 3KPLB 3TCXA 1RHFA 5IB3B 4PRPA 1Q0XL 4PREB 4JANB 2BNRA 3N1MC 1EHNA 5DD3H 5IOPA 4LCUB 4IRZH 4U1JA 3VE0B 1MHEA 3F12A 1KFAH 1C5BL 2YSSB 3VXSE 4W4OC 4G7YL 1NSNH 4U3CA 5F7WC 1MFDL 2BOBB 3HHRB 4N8PA 5IB2B 3WNKA 3WKMH 2GHWB 2V6HA 3UTZA 2NY4B 1AGDB 1QRND 3EJYC 4QHUA 3PWNA 4B41A 4LSPL 3CCHB 5C0EA 3ARGC 5KTEH 1KN4L 3ZL4L 1IL1B 1YNLL 4X6DA 3LDBB 3ZE1F 2FR4A 4GW1A 4G6JL 4KJYB 1W0YT 4WGWB 5DQDH 5GGVL 5I8CA 5E8EB 1IGFH 4N1EA 3ROOB 1EHXA 1KCLA 4M5ZH 4LVOB 4JR9H 2IALA 4MXWH 3MFFA 1FC2D 3RRQA 3GRWL 3S36X 5KVEL 4XRCA 3H7LA 3T77A 4BH7A 4JY5H 1CI5A 5E4EB 4X7TB 2R0LL 1J05B 2GITA 3AS3A 1RUPL 1GGIH 3UZQA 1XCTA 1K4CB 1ZSDA 3RWDA 3G9AB 2WIIA 4TNWK 3FKUS 1ZLVK 1FVCA 5D1XB 4RFOL 3FQXB 3NABH 1IAIL 1JV5A 3UBXA 4UB0H 4L3EE 3RNKA 1GIGL 4JPKH 3UTQA 2NX5B 3F7QA 2OBGA 1Q0XH 2F5AH 3V79C 5LBSH 5GHWL 3MLZH 1A47A 5CP3H 3TPKA 4C59B 3U4BH 1HQ4A 1GIGH 4UBDD 3L1OH 3NTCH 3S37X 1ZANH 1U2CA 1N59B 1Q0YH 3U4BL 1NAKL 2D0FA 2H3NB 2IQAB 2FEEL 5EC1A 1LVEA 2R29H 4NWTH 5I0DA 4JFOB 3GSWB 2F53D 3QNZB 3DTXA 2BNUA 1D5IH 3VE0A 4ODSL 3HS0B 5HYJA 1KC5L 5FUCC 4IRJC 5ALBH 1SHMA 1K6QL 2E7HA 5DEZA 2DJSA 4YPJA 4YR6B 1A9EA 2QBWA 3V0AC 4J3SA 4LPWA 4GAFB 5T1KB 1MI5E 1JWSA 4XP4H 2FH6A 1IC7L 1SYSB 4L8BB 2RHEA 1EXUB 5DRNB 2B0SH 3ZYJA 3W39A 1NLDH 2UZIH 4PLOB 4X9GA 3DGGB 5ICYA 5A2KH 4FQHB 1NJ9A 3SJVB 4JFEA 3O6FD 3CC5A 4CKVX 1CFQA 2AVGA 5D7JB 5DVKA 2F54A 5FHAH 3IDMA 3T04D 5CZVL 1SBSL 4ZUUB 5BVJB 1DANT 2J88L 1EJOH 2EYSA 1I7RB 1U8LA 3C8KB 3RGVD 4H88L 3B5HA 3BRGC 4NYLB 3INUH 3RTQD 3T77B 4JY5L 3NA4A 4PJ7B 4KZEH 3MJ7A 2MJWA 2V5MA 5C0ND 3DVGA 3RBSA 2P5WA 2WANA 1AJ7L 1AH1A 2D4DA 3RU8L 1LE5B 4ZSOE 1ZSDB 4BELD 1QTYT 4NC1E 4X6CB 4N90D 2F8XC 2ZNWA 4U1MA 5DRXB 5ACLA 4K3DH 3RI5K 4JHWH 3CSGA 2L7JA 5D5MB 3EYOA 3PNWA 4K7PX 1FNSH 5AAMA 3NAAL 4LOUC 3MGOA 4DGVL 4P48A 3CXDL 5F9JA 2P24B 4OGXL 5E94A 3SDCD 3CGTA 2R2BB 3NCEB 3QXTA 4L8SA 4NUGH 3IKKA 3KWWA 4RX4A 2EDHA 3Q5TA 1OAZH 2IQAA 4WWKD 3UZEA 3EOAB 5HYJE 1Q72L 4XAWH 3WUWB 2CDEA 1YMMA 1T0NA 4WCYH 5FAAA 2R69L 5HYSB 4PJIB 1OAZL 5HYJB 1GPOL 3TO4B 2J4WH 3L5HA 4OZGB 3BH8A 5I30L 1Q9OB 4F7TA 5B8CB 3EO9H 3QI9B 1BAFH 3U1SL 3BZEB 3O4LA 4NNYA 3MLWL 2KBGA 4RGMC 4Y1AD 3OKLA 1ZHKA 1CE6B 3P9MB 4EQ3A 5JPNA 1A1MA 5D2NB 2FATL 3ULUL 2Z4QA 2ZUQB 5C0CA 3VFUB 1G6RL 4ZAKB 4NQTA 1FZMA 5GPRA 5JMRA 2Q6WA 4RISH 1T66D 4PJXF 3QUYC 4HKXA 3LZFL 4ONGL 1NDMB 4UBDC 2OK0H 5F7DB 1CFSB 4I0PA 4PJ9D 2DTSA 2R1YB 4X5WA 1UKTA 5E1AA 2YOCA 2GUOA 1A02N 3VG0L 4PJDF 2CXKA 3HZMB 4N8CH 3OAYH 1LEGA 3VI4F 3MNZA 4OFPA 4PLNC 3GI8L 3IAPA 4OUUA 2GTWB 2EDYA 1I1FB 1TNMA 2I07B 4XC1H 4PB0H 4H25B 2CO6B 3VRJB 4KH2A 1MVFA 4JKKA 25C8L 4GQ9H 4HWBH 3QIBB 2YD6A 3QZWB 4D8PB 1NDGA 2R69H 2ITDA 5GGUA 1RZ8A 2DF3A 4MNHA 3VGBA 3RTQC 5C0BE 1U6AL 4BZ1H 4R3SA 4KTEH 1I9IH 4DK3A 2YPLB 2V5TA 1Q9KA 4TSAL 3PJSA 3QEGL 2PYEB 3NFSL 3I3BA 2BVYA 3U1SH 1S9KC 3H7BA 1YYMH 1CDJA 3BW9A 2W38A 3Q6GH 4H26B 3EGSA 3DNKA 2FD6L 3MX0A 4KY1H 4XVTL 2XA8H 3O3BA 1O0VA 3UC0H 3IJYB 2H32A 4U1KA 3VXRB 2HN7A 5AZ2L 2A0LC 5HHQA 5LWYH 5DJ0A 1CR9H 2FX8H 2A9NL 2DN7A 3AM8A 3ILPA 2FL5B 5C0CB 3D0LA 4RFNB 1JZ7A 1A3LL 4S2SB 3GHEH 4KI5E 2YUWA 4GRLC 2FX9L 1BZ7B 1UWEL 4G9DA 1UCBH 4EI5B 2A6IA 4Q9QH 2EE6A 5CGTA 2QL1A 2WLYA 1JWUB 3D0VA 3FQRB 1VPOL 4DKFL 4OTXL 3U0WH 3T4AA 2VXVH 1FORL 1RIVH 1UJ3C 3FO0H 1MWAH 4KVNH 2ED8A 1LD9A 3BVNB 5BV7H 4LRIC 5JHLL 1HHIB 3NCMA 1OAXH 1SEBB 1ZLVH 3GBML 4P3DA 2XZAL 1MCWM 4G6FB 4FQJL 4X6BA 3SO5A 5JZ7D 1PJ9A 3HZVA 4W6YB 5FDYA 3K8MA 2VDRH 4E41B 4D8PA 4X7CC 3N06B 3T4YB 1XZ0B 4YHZL 5SWSA 3MRLA 2C7UA 5ID1A 2VLRA 2GSGB 3RWIA 1I3RA 1L0XA 1UZ6E 5C7XL 2I27N 4RGOL 4RA0C 2OR9H 3PWNB 1LMKA 4LF3A 4RFOH 2BY1A 4EXPX 3BKYL 4K71C 3U4EA 1NBYA 4N0CD 3HCVA 1E27B 4P5TA 4OFKA 4GUPA 4JN2B 2VTFA 3ALWA 3JWNC 4U1LA 4PJ5E 3LN4B 1Z3GH 3HC4L 1VEMA 1ZT1A 2DICA 5INDB 3D39D 5DJYA 1MHCB 2ITCA 4P46D 2CDFA 1E4KC 4HF5H 2ICCA 4Q6IC 2F5BL 2ZWLT 3FHAA 1RK1A 5C0BA 2W65A 4L3ED 5E99L 5JUEH 3SOBL 1F4HA 4DZBB 1J87A 4KHXH 1FLRL 1RZGA 2Y7QA 1N6UA 4MNQE 4KVNL 4FN0A 5DD5H 2CSPA 3QWOA 1F6AA 2A83B 4ONFH 5IHZA 5KTEL 2HFTA 5DJDB 1MFCL 5HI5D 3T1FA 3RNKB 1KN2L 4YXLH 1G7JB 2CIIB 4WHDA 1YN6A 5TPWL 5JTWA 4H5SA 4F57L 1F42A 2XZQL 4PJ9A 3UBXI 4ETYA 1AGFA 3BPNB 3RVVD 5D72L 3OKMB 5HYSG 1TJHH 1K3ZA 2V5SA 4FNLL 3H9YA 3ME0A 3ARFC 2QR0B 5GGRY 1JGVL 2DQFA 2Y25A 3QI9D 5T33H 4Z77B 1B90A 2V17L 2DYPB 1AC0A 4N9GB 3IETA 2A9MH 3BOVA 4ALAL 4JG1L 2M26A 1P84K 3LPGA 3P0GB 2IPKB 5DS8A 5FM5O 5D7SH 1CLZH 2C7UB 5F6HJ 2J8HA 5DRWB 3EDJA 3K2MC 1AD9A 3RKPA 5MENE 1CXIA 1M7XA 2R23B 3HNSH 1Q94A 3OX8A 1JTTA 3NVQA 1JYXA 3GJFH 4Q58C 1FIEA 4GMSH 2XTJD 1U8PB 3D1MC 2LTQC 2UVFA 3CLFL 5J1SC 4KGJA 4GBXD 4WW2F 3DVNB 5JXAL 3RIFK 4PJFB 4A2LA 1PW3A 3LSOB 3VFSB 1XGRB 2AI0H 3FN9A 4NQCB 1HQ4B 4JPWL 5BO1L 5KSBB 3CSPA 4HBCH 5IBLC 2VLKA 2DJ4A 3BKJH 1JPSH 2NZIA 2J8UA 1HKLH 4DZBA 1NCAL 5EC2B 4NO0A 3QIBD 4WI2A 5E2VL 4JFOA 1AFVL 4JDTH 5EU6D 3X14B 2ICEB 5BRZE 2I9TB 4Z76A 4DK6A 5DYOA 3HN3A 4MQTB 4X4ME 2KZ1B 1GOGA 1RMFH 4G8IA 4QO1A 3VFRB 1IM3B 4CRPA 3C6LB 3IU3B 5I1CH 1EHLL 5IV2B 3DV6A 1NCUA 1I8MB 3ES6A 2XN9B 4APQC 4DCQA 1XFPA 2QQKL 2EICA 5DI8B 1G6RB 2OI9C 4FQHA 4KU1A 3MRNB 2EC9T 2AK4E 1Z0MA 2P49B 3DUUB 3VFGH 2JJUA 4LCYA 1YYML 3BISA 4NBXB 1NKRA 3KR3H 4WFFE 1I7RA 3TVMB 3CVHA 2ADIB 3MV01 3F65A 1V3MA 5F1NA 1FCCA 3LQAH 1UM5L 1F4YL 4DUXA 3QI9A 4XXCC 3TP4A 3HAEH 1XGYH 1OD9A 4PG9A 1IC5H 5IBUG 2I25N 4M8QA 5B3JF 5DRZA 5MEPA 3VXPA 1DQJA 3T3PF 3EDFA 5CUSH 5CJBA 3TBSB 2HVJA 4ZAKA 3IRPX 3MR9A 4XBEH 3PG2A 4ZFFA 3MLPA 3S8WA 4JZNB 1TQBC 2R9HC 3RWCB 4D9RE 3MV8E 5F93C 3ZTNL 4KROD 4YGAB 3KXFD 2W0LA 3QH3A 3M1BB 2BVPB 3VRIB 4PP1C 5DO2D 4KHTL 1X5IA 3UO1H 3SY0A 2AKRB 4PY8I 3QWQB 4HHAB 5ACZA 3MZGB 2PF6A 2E8ZA 5C71A 3VXUA 1V5JA 2YN5A 4G5ZH 4GKSB 3GEWB 5GS1A 1ZKAA 4PJIA 1RPQA 1A1NA 2BMKB 1BJ1J 3PHOA 2DBLH 3GNML 2GSIA 3UDWA 1KEMH 3THML 2D7TH 4JFFB 4WFGD 1D7FA 3CK0L 3D39A 4MA8L 3TN0D 4OCRL 3D5OF 3VJ6B 1JHTB 2BRRL 3WJJC 3ZT6A 4P9ML 5CKAA 5KW9L 5MI0B 1A6WH 1HHJB 5CHNA 1XR8A 5E6IA 4KXZH 3WL9A 5GRVK 3W0WE 1F58L 1IAMA 3RIAK 2X4SB 2V2WB 5DI8A 2DL2A 1BVLA 3RUGA 5KSAD 1ZEAL 3VFNA 5C9KA 1GOFA 2ZP0T 3MRNA 1FO0L 4U0QB 1KTLA 4R7NA 1DFBL 3ZSSA 3P11H 4BSWA 5JQ6L 4M1CC 4OIBA 1J1OL 1T4KB 3IDNA 3SPVA 2A73A 5CSZA 2PO6D 4LCIH 1TPXB 4M6NH 5F88A 1E6JL 1M4KA 4TVPE 4XWOC 2ZUYA 1JP5A 5E9DE 4PB9L 1BMGA 1G9NL 5JPMB 5C6WH 1I7ZB 2HT3D 3D25A 2BFVL 4QTHB 3PE9A 1S78C 2F5BH 3LEXA 5E7FA 3SDXF 2VZ1A 3RZCA 4P2QD 5HHVL 3ILPB 5D7JD 3Q1SH 4PRPB 1M6OA 2BHUA 1CICD 3HE6A 4ZUWA 4TUJB 4P2QE 1E0OB 1Y0LA 4P5KB 4PRPE 5CEZD 5HVHC 5IJKA 1IEHA 4ENEC 4LVNC 2B1AH 3I2CL 1NLBL 4Q9RH 1Y6NR 5TJWK 4CDGC 3G5VB 4FNLH 2DBJA 2DQTL 2AXGA 3K1KC 4GSDH 4PLKD 4HZAA 2VLJB 4HK3N 5SWZD 5GQBA 5LKNA 1WUNT 1M7IA 3QDGD 4EDXB 4LMQI 3J8F7 4GKSA 3VMPA 2F19H 3GMPA 5L2JB 5H35B 4U6HB 3ARTA 3HRZB 2XPGB 1AO7D 3RI5F 4MAUH 1DQLH 3V6OE 3RDTC 5IF0A 4O51A 2WINB 1AE6H 2R2HA 1Q0YL 3B8SA 4YDKH 5HY9A 4HUWB 2BK8A 2VC2L 5D6CB 3V4PL 4U0RB 4U1GC 3MLZL 2GSGA 4N0UE 3P4NB 2WM0A 4WEBL 4NRZA 4Q6IA 5GGRA 1X3DA 4UTAL 4PGBA 5JQHC 4LF3B 5KZCB 3PABA 2EXYD 3ARSA 1GOHA 2FLRT 3K7UA 2V7NA 1FAKT 2IH1B 1IGIL 1JF5A 3BT2L 2VLLA 5IW3A 1E4XI 5J89A 1RIHH 2JCCB 4DN3L 2Q3ZA 1T83A 4Z7VF 1DVFD 1QFWL 3DX8B 2OMNA 5JPMA 1LD9B 4UDTB 3WJLC 4G6MH 3I6LD 2B1AL 4JE4B 2NY0B 2W65B 1K3IA 4D0DB 3BWUC 3RVXD 1TENA 5BOPA 5K9KA 1RZGB 1U58A 5L88H 2E27H 4YBLB 2R56L 5IVXB 1IAOB 1VDGA 3C2AL 2FZ3B 5EPMB 4UDUB 4Y16A 2FD6H 3QDMD 1I1AC 2K9UA 4X4YB 5EOTA 1WEJH 3G5VA 1N3NA 4WI5A 2RCSH 1XIWB 1UM4L 1GH7A 3BDYH 4OSUH 4OZFG 1X7QB 2VOTA 3SO3C 4NHCH 1JGUH 5FFLA 3I3EA 3PQYE 5JIHA 1Z9LA 5EOCH 4JFYB 4Z7UA 2A6JA 4XMPH 2R8SL 3WFCL 1EXUA 5F7UA 12E8H 4IS6A 4L4JA 3HCVB 1PEZA 3DX9A 3K8LA 1HHKB 4NQCD 1J1PH 2CJUH 4FQ2L 2W60B 4JJ5A 3K4AA 4XI5D 5GS2D 2FYYB 5DUPL 3HG1D 1JFQL 3P9LA 4JG0H 1NCNA 4O4YH 5F21B 5ERWA 2I9LB 3CZFA 4KK8C 3VWJD 4O2EB 1KENL 1FV1A 1LE9A 2NY6D 1DBKL 4E41E 1BQSA 4LLMA 3KLHC 1JWMA 1NCCL 1CLOH 3QG7L 2Z9TA 4FMFA 1W72A 4RX4D 4OFIA 4OZGE 4D9LL 3RWEB 3ZKMC 2O61B 3NCCB 2OJZH 2VDNH 4PLJD 1A0QH 5D5MA 3KPRB 4OCXL 3VGAC 5AAWA 3U46B 1VGEH 1S3KH 5DD6A 1BVZA 4NQCA 3TESA 2JB5H 3A6CL 4P2YA 1IARB 4FQLH 3EFDH 2DLGA 4LPCA 3EOTH 1S7QA 3KPQB 3QXAA 1N0XL 3OKKB 5K93A 1L7TH 2VXTL 2ZPKH 2D03H 1SJHB 3SJVD 4L4VB 4F2MB 1KIQB 1BM3H 5DK2A 3P4LA 4OLZL 1LILA 3QCVL 5IMOA 5B38G 3VXUE 3W0WB 5IESH 3REWA 2UY6A 1ZWIB 2AEIT 4MXVE 5T5NG 3ARGA 4OV5B 4XPAH 4GAJH 1IZJA 3WO4B 4IRSB 4EDWL 1JFQH 5IV2A 2B8OT 1XF5A 5GSVA 3ZSTA 2PETA 4TOYL 4XH2A 1P5UA 3ZTJH 1HILB 2A2QT 4FA8A 2FJFB 4KUCD 5EWIH 5CBEB 1N5YH 1MNUH 2H2PD 3O6LL 3MRDA 4JFHD 3VFSA 3P9LB 2Q3AA 1A6AB 1WTGT 3IFLL 2DTML 5FHBL 3TH4T 5KSBA 1OAKL 3JTTA 5DHVA 4GXVL 1OP9A 1G7HB 1WWAX 2YXMA 3MV9D 4DW2L 1UZ8B 1WZ1H 1U3HC 2BSTB 4JHAL 1E28B 3FQUB 1EAJA 1T89C 3X3GL 3TZVA 3S98A 2KDGA 3ARPA 3UJIH 3IYLW 3IFOA 5D2NC 3QUXC 4OLUL 4LP4A 2VLJD 4ALAH 1BAFL 3MA9L 2FECL 1KEGL 4J8RA 3RBGA 3TV3L 4OI9A 4R8WH 3JSSA 1X4YA 4M6MH 5F8RC 3HAEG 4H0IA 4HMEA 3CSBA 2JB6A 3GMOB 1AP2A 3P4OB 3EZJB 4YFDB 3ARFD 5ALCH 1SBBA 1J5OL 5SWZA 1F3JA 3GSOB 2VMFA 3CLFH 3QDJD 3FB8B 2NNAA 4NBZB 5E5MB 3H0TB 3UJTH 1MCLA 3O3AA 4JFFA 2GEEA 3PDGA 3B5TA 1RUML 4OF8A 1EUTA 4KRPD 1I85A 4WO4C 1INEL 3TYGH 4Z7NF 4NQSB 5IGXL 5CKGA 3WL9B 3UZVB 4KMTL 5CLWA 1RIHL 1GGCL 3D0LB 3RNQA 4WEBH 1XF1A 4CGTA 4LDLB 5C9JB 4L29B 1S9XA 4M48L 4JY4B 1QR1B 1F2QA 1RSFA 4MX7A 4GSDL 5IBTH 2D7NA 3QH3B 4NM8L 4J3XA 4MXWL 4F8TA 1CXHA 3N1QC 2UWEE 2VYRE 2YC1B 4PUBL 5KSAA 4M9OA 3Q6FB 3MRHB 1AIFA 2AV1B 4RGOH 4M9PA 3BPNC 4Y5VC 5T1DH 1WBZB 1FC1A 1WWWX 1NGZB 1UENA 4OJFL 1PX4A 4IEFB 5L88L 4W6XB 1ERNA 1J1XH 4U4BA 1JIBA 3T4YA 1FRGH 3ISWA 2AQ2A 5D7SL 2AXGB 5C09D 2Q20A 1HHGA 2AW2A 5EBGA 1D5IL 3ZE2E 2ZSWA 1KLUB 4S1RH 5D1QA 5EZIH 4ACPA 2I26N 3H9ZA 4PJAE 3W2DL 2IF7A 2XZCL 3QEUB 1IGMH 3I3DA 3B9VA 4JFXA 1K2DB 3ROOA 4RBPH 3ULVL 3KAAA 1QR4A 1XR9A 4LIQL 3LPFA 1IGML 2UYLA 4OD1L 4XBGB 3DETD 3CIQA 4WHCA 1RUMH 1L7IH 4HJGA 3WFBL 2ZG1A 4H8WC 5J8OA 4AIXA 3SQBA 2NY3B 1EEUA 2NXYB 3NPZB 5IGXH 1CCZA 5GJTH 3NA9H 4Q9BA 2P7TA 5D7KD 2Z35A 1WZKA 4TULL 5K9QG 4P5KA 2QSVA 4XVUD 1EIBA 5JO5B 3MRCB 3N9GL 4Z8FH 4OZGF 1BWMA 5FYKL 1I4FA 5IFJB 3AB0C 2BNQE 4H5SB 1WFUA 3KHQA 3PWPD 1HZHL 3HNTL 4JKPL 4DJMA 5ILTH 1XGTA 3OXRB 1FYTB 4KK6D 3CMGA 2W1NA 4C56E 1S7WA 4P57A 3TBVB 4MJ2A 5L2JA 4JRYE 3RAJH 5EC1B 4KKAC 4NFBA 1UWEH 1KF9B 1IGCL 5E6IC 3RL2A 3VWJB 2D03L 1OAUH 4CMMA 1JE6A 5J6HA 4J2XA 4ZPTA 1UGNA 1QO3A 5TF1L 1LEKB 1XGUB 1A9EB 4B5EA 2YRLA 3QPQC 2ZKHL 4NQEA 5B8CC 1F90L 3FT3A 1UWXK 3EHBC 1KLGA 2BCKB 2AV7A 2VDOL 1IM9D 4NKOB 3GI8H 5L0QC 1JZ4A 4NN7B 2CLRB 1R3LA 2C26A 3L3KA 2WLZA 1WLHA 4HAGA 2VLLB 4XP6L 3E3QC 4O58H 2BZDA 1A6TB 5BS0B 4HWBL 1URLA 4WENB 3T0XA 4NKDB 3HE7D 5I16A 3C9NA 4TNVF 4U1NA 3ZYIA 4F7EA 3RGVB 1S7TA 2OXGA 4LHUB 3WXVL 2VAAA 4KKCD 2X44D 4M3KB 3BSZL 1X6NA 1MLBB 2EIZB 3AAZA 3BRDA 2H1PL 4OCRH 1EVTC 4JY6B 1HQRA 3ZKQD 5GS0H 4NWUL 3WLWD 4RZCA 2XNAA 4XPAL 5DUBB 2CRYA 5ENWB 1BZ9A 4A6YA 3CXHJ 3M8OH 3OJDA 2F74A 2O5ZL 1J5OH 1BJ8A 2XQBL 3BJLA 5E8DL 4QGTA 5L2KD 3MRJB 3GIZH 3QDJB 4Z95L 4PRIA 4R2GC 4WGVB 3S97C 3D2UA 5C08B 4XNXL 5JW4N 2DQJH 1JTOA 1BJ1H 3NCBB 1CICB 5EU4A 3V0WL 1CGSL 5MEQA 4I0PC 3X12B 1F8TL 4ODTH 1FO0H 5J6HB 4JG0L 1XEDA 2Z31A 4AT6B 1CWVA 5CEZL 1BLNB 1FV1B 1LE9B 2XA3A 3QFJA 2WWMC 5ESVA 3SE3A 4U1GB 1CFTA 4ZUTB 4FABH 1DN2A 3CFJB 1FGVH 1AY1H 5IFAH 4EIGB 1H0DB 4KRLB 2C9AA 4J3VA 5DRZB 2VITB 1EO7A 3K4DA 3RDTB 1OGAA 1CK0L 4NC0B 5D96C 2WWKT 2PKDA 1S9WA 2VDLL 1KXTB 3X3FH 1NGWA 1D5BB 3ULUE 2AJXH 3MODH 5GJSH 4OLZH 3QJHA 3ZKND 4JFPB 2HFGH 1OY3B 4HBQA 4YWGL 5EIQA 5I1IH 3O2DH 4HPOL 1DN0A 3U9UB 3WFHA 3RU8H 2A6KB 2LU4A 2X9XA 4G9FA 3HPLB 4Q2ZA 4IIQB 3QQ3A 2XTJB 3OPZH 3BN9D 1NC4D 3P0YL 3DETC 1WBXB 4MNQB 3TEUA 1ZT4A 4JFDA 2EC9U 5DJZB 3CH1B 3KLAA 4GW4B 5D8JH 2BOBA 4YXHH 1KB5L 4K07A 5IBUB 2EEAA 1U8KB 2AXHA 5C0JA 1TQBB 1MREH 2ZUXA 1GJIA 1E4XH 3H9HB 4DN4H 2M2DA 1KPVB 5EUOE 4A6YH 1TFHA 4Y19B 4JLRB 4C83A 2CKNA 4G7VH 5DDHB 2P5WE 4YBHA 3C08H 1KC5H 1DDHB 2PUQT 2NXYD 3FB5B 3U36B 1R3JB 4TVPH 3SCMC 3QIWD 1YY8A 4UI2A 1RJYB 3VI3E 3LD8C 3C5ZB 3MXWH 3RPKA 1A7BA 3JV4A 1WAAA 1ORSA 5IW6B 5T3ZH 2YD9A 4HJJH 3LS4L 4K23H 1T89A 2ZSVA 2ZG3A 1RZJL 3PP3H 4CVZA 1H3PH 3FQUA 4X7TA 2F54E 2YWYA 5IHLB 1T1WA 4X9FA 2WK2A 3TBYA 5C0NC 3MOQA 4MDJA 1OGAB 2MCPL 1IGYB 5FF6B 2X4QB 5F1SA 2O5YH 3CNKA 3VMOA 5GIRA 2Y6SC 1T21B 5KS9F 2H6PB 2YD4A 4KGLA 4I3RH 4FTVB 4HFWA 1SJEB 3INUL 5F70A 3CAFA 3EYFB 5DD5L 1X5XA 4J3UA 3WFHB 3G6DH 1IGIH 3Q3GB 4NDMB 1IGTA 5KSAB 4JM2B 3DVIA 1RV6X 1BQHA 2PW2B 3NABL 3SOBH 5L6YL 4P3WA 4KZDL 3LY6A 4GRWE 5H8DA 5E2JA 5CCKL 5HSFA 5LWYL 4ORZC 1MCIA 1WBZA 1C16B 3O8XC 2G5BA 5F8QC 5EU5B 3CH1A 3KLAB 5HGHA 2R0ZL 4I2XA 1YQVH 2APWA 4KHTH 3UO1L 4IRZL 1UCBL 5F71A 1P2CA 1T1XB 3LS5L 4R2GD 3QRFM 5C2BH 2UZXB 4HMCA 4YHPB 1RVFL 2YR3A 3JTSB 4XHJD 4NRZB 4Q6IB 1BQLL 3KPSB 4Y4HA 3S5LG 1AR2A 3EZ8A 5D1XA 3PABB 5KVDH 2FLBT 5ICYB 4Q9CA 1F11A 5BJTB 4Y4KD 1KJMB 3CK0H 3VXTA 1KN4H 2NLJB 5A40E 5JOPD 4GRMB 2C4FU 5E8NA 5SWZE 3CFDB 3QDMA 4ZFZB 4NC1C 4DOHE 3QUYD 1N5AB 1IKNA 1FNFA 3WIHH 3JWOC 5DHVH 3RVTC 1K8IA 1OF2A 3HI1B 1MEXH 1R24A 2AJSH 1YY9C 4N0FB 2YK1L 4Z0XA 5FO8B 4PP2B 4D0DA 5GZNC 4Z9KB 4MDJB 3O4LD 2EE9A 3GSWA 1YPZE 4X6DE 5C7XH 3EO1B 3EYUH 3N85L 3B9DA 2X42A 4O00A 2FBJH 5CMAA 4ZOBA 1OVZA 5J56B 4YR6A 1ZT7B 2CIIA 5EOTB 4FTVA 2F19L 5M95B 1YUHB 1AQDB 1JPGA 3MV9B 4M1GH 5CSBA 2ERJB 2K7QA 3L5WA 3BH9A 3UMTA 5LGHL 4DVRH 4PTUA 4JZJA 3EYVB 3GMRA 1KFAL 2L4OA 3NH7L 2ADJB 4GRLD 1AKJD 2EE2A 2XXMB 2APFA 2Q86A 3VRLE 1CDUA 5BS0D 5F96L 1T22A 4OQ1A 5JORB 3KDMA 3REVA 4PRHE 3FO1B 1HNFA 2VRAA 1MVUB 4PRHD 2DYPD 1DUYA 4WW1B 2IFFL 5KVGL 4OM0L 4M61A 1QLRA 2DWDA 4LLUA 3BP4A 2P5WB 1L6XA 1FN4A 2OI9B 1QSVA 5J3HC 3SE4C 4D94A 1T1YB 3RVUD 4AZ8A 1AO7B 5AD0A 4PJCE 5LVEA 3UTTA 4UMGA 4MCYA 5I2IA 5JO5A 5BW7C 2BVTA 2NY5H 5BJTA 5IVZA 3L3KB 4HPOH 5FUZH 3AC0A 2DDQL 4KDVA 1KEML 5E8NB 4Z7WF 1SEQL 4LAJH 3HB3C 4HKXB 1NH6A 5MEOA 1WFTA 2XXCB 3OKOB 1HHHA 1A6TA 5IKCA 4ORGB 3C60A 1KLFA 3LKQA 3O6FA 4LQ1A 3OJMB 1T5WA 3V8CA 5D7JC 4P2RD 2DQHL 3NIGF 1T04A 1ZTXL 3LEVL 4NQCE 1YECL 1QQDA 2YK1H 1TCRB 4AEEA 3NZ8B 3NCFB 1DJSA 2EIZA 2HVKB 4FG6C 3PP4H 4HIXH 4L4TE 4L8CA 4KKNA 3LMJL 4NJ9H 2HFFA 1FL6B 4G42B 1QO3B 4P0DA 4JFDD 3VRJA 4OZGA 1IEAB 4FZ8H 1TITA 3S35H 5EZLA 3OJDB 2CLZB 2EC8A 5A3IC 4IRJB 3WCYA 3SDYL 1A5FL 4S1QH 4HH9B 3DYPA 5DJ8A 4O58L 3L5WB 4NO5A 3MYZA 4PGJA 3MREA 2DMCA 4G9FD 4ISVA 3ZHLA 3AROA 2X4NA 4Y89A 3SGKC 3D2UB 3RGVC 4I3SL 2WBKA 1I3UA 3GIVA 3O3DA 4PS4H 2X4TB 4XP4L 4HC1H 2D9QB 5F7DA 3KPOB 4X7FC 3WIHA 1UWGL 4M7KH 4YO0A 5KVGH 4QF1B 3RX5A 4X7SH 1JGDA 5GISL 2CGRL 4U2YA 2DWDB 4XHQA 5IJVA 3BRFA 1AQKL 4LASL 3D18A 3QNYB 3HNTH 3FONB 1KT2A 2UUDK 1S5HB 3QULA 4PFEA 1FH5L 1QA9A 2HTKD 1ZVYA 4QHLA 4R0LA 1EHLH 4OGAD 2GY5A 3TBSA 3IS0X 4H8WL 3TZVB 1QRNB 3LRSA 3FT2B 5GS3A 4HUUB 1R5WA 1NCWH 3EBAA 1MCQA 4P9HC 3RWHA 5KS9A 4MA1B 4RNRB 3MACL 1NDGB 2ITDB 5GGUB 3HG1B 3ZT7A 4ZS7L 3GSVB 2Q8AL 1ZVHA 5HVGB 4ZFOB 2NXYC 3RVTD 3QP3A 5DD0L 4OZHA 4ZOEA 2VWEE 2EH8H 3IJSA 2C3XA 1Y6KR 4M6AA 1QQDB 4N0RA 5C08A 5F1IA 1UKSA 4GS7C 4OD1H 3VDAA 1I8IB 3RVWC 1EEYA 1UACL 4G8GA 3M45A 4JQXC 5IMKB 4X0KB 1I3GL 3FB8A 3KPNB 3STLB 5F7LB 3IRZA 3NZHH 4M1DL 4LKXB 1WBXA 4U1HB 4V1DA 3ZKSD 1F4WL 3L5IA 3V0VA 5E2VH 5C8JA 4HT1H 3V4UL 4X5XB 3S4SA 5DJ0B 3SDDC 5AG9A 1U91B 5I30H 1SM3L 4P23B 5F7EL 4HX1B 5J9PB 5T1LD 4YHZH 1BQLH 5HVWA 3ZYZA 1MWAA 5H37H 5CJ5A 4MX7B 2XWBB 2NX5A 1TVBB 1AXIB 1QFOA 5FYKD 5EBWB 5DGQA 3CZJA 2VXQL 3B3IB 5DA0B 3D18B 3QNYA 1PKQB 2WUBL 3R1GL 4UNUA 4E0RA 5CEYB 3SDCC 5DD3L 5DWUH 5E9DB 5IHUL 3C8HA 4U7SA 3MRPB 3CD4A 1B0GB 4P3DB 2ICWJ 5D7LD 1AIFB 2AV1A 4PRHA 3PXHA 1NCDL 1A14L 3I9GH 3D6GA 3UTPD 4N5UA 3FT2A 1CXKA 1MCWW 3MV11 2BNUB 4M43L 1VHPA 4J7RA 3QAZB 4K9EH 1L9MA 1WBYA 4Y2DB 3MV7B 4RGNC 4ZS7H 1P4BL 3E6HA 3T1FB 4LGRB 2MOVA 1KB5H 4LIQH 1A1OB 2OQJA 4GBXA 4KHXL 2BC4A 5JDSA 1A2YA 4NKMB 3IFPB 4Z7QE 1AY1L 5F1IB 3U4EB 2DLHA 4XWGH 5DHXB 3S96A 3QDGB 4UINL 5ISZB 4YDVA 1RIVL 5E2TH 5INCB 1YPZA 2IC2A 2MPAH 4C83B 1IC4L 4UAOC 3GMMB 5KG9A 2FIKA 3FZUD 3KPNA 3STLA 5IF0B 3WO4C 5E2TL 2APTA 4Z77A 1NFDA 2UVEA 1OGTB 5DJYB 3C5ZA 4FZEH 1UEMA 2JTDA 2W0PA 3TA3B 5IMLA 2C1OB 1ORSB 2CUMA 2XWJB 4PJ8D 4B7IA 4IBLT 3MRIA 3UTSD 3RKDD 4PJ5B 1B4RA 1T0MB 4Q0XH 5GGSA 3OX8B 4LSQH 4C56D 3D39E 4O5LH 1GC1L 4L8SC 4U1IA 2R0LH 4CVXB 5DO2C 1AGCA 4WU5A 1D9KD 4FQIL 3S88H 5DSCA 3LH2H 3NPSC 4WWKB 4J6RH 35C8L 2ARWA 2VZOA 4Y5XA 1SJVA 2X41A 3CDCA 3VFPB 3EYFA 2P24A 3BZ4B 2E7LC 3VFOA 2IAND 3LV3A 1T6VN 4HKJA 4OQTA 3WFDL 5JZ7C 5D1QD 4MB4A 4JM2A 4L8SB 3EJZC 1JMZA 5F9AC 4GAYA 4Y1AE 2YMXL 3KLSA 4PRHB 2WBWB 4HK0A 3PIQB 4QWWD 3S35L 4Z0XB 5FO8A 4HW6A 3HMWL 3SKNB 2OL3A 3S5LB 4S0TD 4OD2A 2JJSA 4N5ED 1ZOXA 3O6LH 3WIFB 3JV0A 4B53A 3MUJA 3K8KA 1FGVL 1SJXA 4S1SH 4PRBB 5EBMA 1EGJH 2OJEA 1MFDH 2XICA 4BZ2H 4ONHB 2XZAH 2V2TB 5K9OA 1ZLWH 5DTFA 3STZA 4HKZB 5GGTA 1M1SA 5HDQL 2IH3A 3GMNA 1XIWD 4ETQB 4MJIE 1A2YB 4WHTB 1CG9B 4ZAKC 1I8MA 3P30L 2PR4L 4FQLL 2B2XL 1AHWA 5D2LA 2MCG1 4KQ3L 3S96B 3B9KA 3QQ4A 4HIJB 1ZLUK 5DEFA 1SEQH 2CKBA 3O3EA 1XCQA 1DUZB 1G6RH 4PJ9C 5KG9B 2VLRD 2IFGA 1T2JA 2AK4A 1OARH 2ZCLH 1UG9A 1JN6B 3BP7A 2VDLH 5DQ9B 3O4OB 1TVDA 1ZA3A 3MLVL 5M7QA 3TA3A 5IMLB 4QRRD 3C9NB 3H3KA 2EIEA 3TH2T 1IC1A 2DI7A 2VSCA 1F4YH 2O5ZH 1TVHB 4X6EA 2E9JA 2YD7A 3H9SA 1IC5L 1J8HD 3G5YB 4ODWA 3MRFA 3H2WA 4JO1H 5HD8D 4RZCB 3ZDXE 5BRZA 3MBXH 4HUMB 3S37L 3DXAA 2HVJB 2PYED 25C8H 3LEYL 1V3LA 3QUZA 2YPLE 1FFRA 2HA1A 4K3DL 1YQVL 4P99A 1KCVH 1F90H 2J8UE 1OTSD 5E95B 5HHME 1CDBA 3W5MA 4NC2B 3OKDA 1CGUA 1KJ2L 1P1ZA 2Z91B 1N59A 4JFDE 4AEHL 4ZFGL 3DI3B 2Q86B 2EECA 4P23C 4YGVB 4NFDA 4L4VA 1NC2A 2AJUL 5KOVC 2I24N 3F62A 1S9VB 4NFCA 3TJHC 4ZTPL 4GKNB 4PJEF 4DQOL 4D0BB 4Y4HC 3MOAH 3QJFB 4QCIA 2JKXA 2GK0B 2V2TA 1QFWI 1KJ3L 4LHUD 3EDEA 4LK4A 1C5CL 1BD2D 2M1KA 3TZVD 5MENA 5EOCL 4WEUD 1IC7H 1XR8B 2H41A 4AIOA 1CXLA 4KAQH 1YEGL 4BK5A 4PJEE 1BQUA 5IB4B 2Y1VA 4CUCA 4LVOC 1ED3A 1HN1A 1WISA 2X4RA 3EFDL 3QXDA 3GIVB 3R06B 4O9HH 3QCTH 5CSZB 4U49A 1BPVA 1KCKA 2ADFL 3QFJE 2BVPA 4L3AA 4DTGL 5FYJE 3VRLF 4G6FD 4RMQA 3KYOB 4M7LH 2BSSB 4LSRL 5CCKH 5ACZB 4OZIB 3NAAH 3PUCA 1TCRA 3AGVA 5IROC 3PGFH 1NFKA 3MJ8A 2HVKA 1HHIA 4J3OC 4JO2H 2R0ZH 2DLTA 4MD5B 3VXNA 1VA9A 1MCRA 3FB6B 2YZ1A 5BRZB 4GRWB 2VAJA 4PG2C 1CGXA 4PRIE 3H9SD 4MNQA 2YS4A 3QUYB 2EIBA 3BQUD 3PL6A 3M17A 4M5YH 4TSBL 3GSVA 5E94B 4B0MM 5T5FL 3MUGA 4X99A 1L7IL 3HZYA 4JO4H 3SCMA 2Q7YA 4YHLL 1JCKA 4R4BB 1FFPA 2D0HA 4GH7B 2ZOKA 2GTZB 2Y06H 2GJZA 1LNUB 2XY2A 3SE9L 1F3JB 3GSOA 2X4TA 5IWLC 3VMNA 4GUPB 4JN2A 3MRQB 5LCVH 4UOJA 2FX7H 3V6OC 4P4RA 5EU3B 2QEJA 3GKWH 3HMXL 5MHSD 4U6VL 4KMLB 4YDKL 4V1DB 5L2KB 2VH5H 2XKSA 3ARBD 4HFUL 1S7VA 4WJ5B 1IQDA 2G5RA 1MH5B 2C3VA 3LKSA 5F1KC 3OKLB 4FQIH 2H9GA 1YEIL 3HI5L 3LDBC 4L3CB 3L3JA 1Z3GL 4GW5A 5EFIA 1JZ3A 1LO0L 1I1AA 5FYKE 4PGBB 5HYQB 4OZHF 1Y0LB 1X6LA 5LGKA 4HIHB 5CGYD 1FNGA 1R3KB 4QHKJ 3HG1A 4AG4H 4LCWD 5IT2L 3P2TA 4ZFOA 1C8PA 2ZUTA 2DMKA 4NQEE 5DD0H 1P9MC 5J3HD 2O5XL 1GGYA 1MREL 1VENA 1FFOB 3V6FB 3B3IA 4EDXA 3MNZB 4YHNB 2EKSA 3QEQB 4KXZI 4N8VB 5D72H 4HT1L 3V4UH 2X7LA 3G04B 4MAYB 1B0GA 3FQTA 1NGQL 1HCFX 4C56A 2WNGA 5I1JL 1PZ5A 3TJHD 4EI5C 4HUWA 3IETB 4XNQA 2D4FA 5HGHB 5H2BA 4UTBH 4PJ8A 1DQTA 5GS2H 1IAII 3SDXE 3OB0K 3ALPA 3E0GA 3E2HB 3GKWL 2Q7YB 4NZTH 2BC4B 3K74B 3QIUC 3V9FA 3D69A 4WI3A 5FCUH 4HX1A 1I1YB 1N2RA 3VGEA 3T2OA 3QHZL 1DVFA 4K94H 3V6ZA 3MUZ1 5JLZB 2BJML 1X5HA 3VFVB 5E6YA 3CDYA 3F7PC 3BMWA 2ZNXA 3LSOA 5I1DA 3FO2A 1K9TA 2Y36L 1EEZB 3RHWF 1DP0A 4AEIH 5EIIA 2NW2A 1HDMB 1KELH 1NMAL 5FK9A 3DURB 4XRCB 2APBA 3KPTA 5CEYA 1LO3L 3P40A 2DKSA 3N1FC 1JYNA 3FO9B 4OCLC 2A9NH 1KJ2B 2YA2A 5FO9A 4WO4A 4ZDHB 5GGTH 3FO0L 4FFVD 1LO2H 4WUUB 3RWDB 4D3CL 1VFBB 3CVHL 3GGWA 3S7GA 1HIML 3WDHA 1HE7A 1YEJL 3ARDC 1ZV5A 3I6LE 5BMFL 3T8XA 1SYVB 1FVEB 5EU7E 4NHUB 4XPGH 5IFJA 3UTQB 2R1WA 3P77B 5EZJA 5CEZH 5TQ0L 1J10A 3QIWB 5T3ZL 5C0AD 5DZNA 3LKPA 5KSVA 2DQIL 1KG0B 4NKMA 5DFVC 2EDJA 3L5XL 2CRMA 3S34L 5DJXA 4NJAL 5GZOC 1ND0A 4N8VA 4CU8A 3ZDXF 2W0KA 2EDOA 4AEHH 4E9LA 1TZIA 2CXGA 1AXSA 4FG6D 4NCC2 2FH8A 2ED9A 4JDZB 1IQWH 4WVRA 4QRSB 1Q72H 2OL3B 4KQ4L 2D2OA 4UUJA 1KCRL 3ARQA 2IALB 4PJCF 4FFZL 1CLYH 1BWWA 1CZ8H 1H8OA 2ADIA 5I1GL 2UWEA 1DUYB 5TDOA 2P8LB 3F7VA 2OTUB 2KZWA 5KBNC 1FLTX 2C4FT 5DTFB 3S3JA 1OTSC 4YIQB 3P3YA 2AEWA 1HXYA 4EUPG 5IVNA 2H2PC 4QGYA 1HNGA 4ONGH 2HRLA 5ESAB 2AJ3B 3RWEA 3VXPB 3U6RA 4G8GD 1JI1A 3DGGA 2FJFA 3OPZL 4HUVB 3HUJF 5DC9B 4CVUA 5I76B 4UILH 4F58H 1ZT1B 3FO2B 5MEOB 3ZTNH 4F3FA 3VFOB 3LKRA 2CDFB 4MXQD 4D9QE 3QRGH 2AJYL 4Z0BH 2CUIA 3CU1A 4O4YL 3IDGA 4XC3L 4X6EB 4PJHB 4E5XB 3OXSB 5E6ID 2YXFA 3H9SB 4ODXB 1RUQL 1P6FA 5FYLH 5H94A 4RDQG 2CR3A 4PJGA 5D6DA 1DQQA 2FWOA 3ARED 4LSSH 3JV6B 1P6AB 2P5ED 3GUTB 4Z7VA 5A2LH 3SGDH 4I18A 1BIIA 3TPUB 3PNWB 4NHUA 3VD3A 5KJRL 2CO7B 1JGVH 2GJJA 3FCTA 3LAFA 1MRFH 1MCJA 1MAML 4ONOA 3S34H 4WFHD 1A6ZA 5BVPH 3DJ9A 5CIPH 5F9DC 3AXLB 4XNYL 3GJEB 5B38B 3WS3B 3O2DA 4MB3A 3TJEL 3SKUD 2CPCA 3GBLA 1U92B 5EUOA 2AK1L 4RGND 4JFEB 1OHQA 5IBLD 1INDL 3EOAA 3P73B 5FHAL 2IAMA 2VKWA 2QQQA 5IQ9A 3O3DB 2EKJA 1KPUB 3ARFB 2A73B 2H1PH 2R8SH 5FB8B 2FIRT 5HVFB 5DHVB 1BLNA 1KBGH 1RZKL 3O3AB 1FBIL 4YK4B 5CP3A 1WC7B 3NTCL 1PAMA 4U7KA 1CLOL 3QG7H 1JPFA 5FUZL 4RIRB 3FONA 3EJJX 4Y4KC 2E6JA 4QTHA 4XVSL 1PG7L 5DJAA 4NOBA 5L6YH 3ARBA 4ZMAT 1FGNL 3EYOB 4IMKA 3RDTD 4HUVA 1P4IL 3MFGB 3QHFL 3QXDB 2VDOH 1AFVH 3QJHB 1A6VH 4M43H 3BGMA 4P49A 3UCRA 3MLRL 4GQPH 4XB7A 2PNDA 2XOTA 4OZHB 3MV8D 5FDWA 3WE6B 1GHFL 2KQNA 1S8DA 3LRHA 2A6KA 2DLFH 4I48A 3SEPA 4MDIA 1MFBL 3DROA 3OR7B 4UV7H 5FM5M 3WDJA 1KTRL 4I1NB 1I7UA 3GMPB 3VXNB 3UYPA 1G9MC 4KKAD 1CGVA 1BIIB 3BH8B 2R0WH 4MNQD 2OYPA 3OKNA 4P2RB 1N0LA 1B88A 2NY0C 3QUXA 1OPGH 1RZ8B 2EDTA 4MNHB 3ROLA 3AMLA 3F58H 3ES6B 4R3SB 5J7CC 5D5ME 4K94C 5ETUA 1DQLL 3H9HA 2VLKD 1F6FB 3TO2A 5I19H 5IIEB 3L1OL 2OZ4H 3BWAA 4BSJA 1OD7A 2BY2A 4GRLA 1XF4B 3CJJA 2HT2D 2JELL 4S1DC 3T0WA 5C0DB 1LEGB 4Y4FB 3WKML 1R5VB 2AQ3A 4HUKB 1NCBL 2NZ9C 1LEIB 4Y8DC 4JANA 2NCMA 3G08B 1U93A 1XGQB 4PJXA 3NFNB 4PYGA 3WFEH 4Z7UE 3PL6B 1YEEH 2XN9D 4HZLA 4M5YL 4TSBH 1EA9C 1N7MH 4KUCF 5T1MA 1JVKA 1EMTL 5IMMA 3NCJH 4HDIB 4EN3D 3MLUL 2A74A 1GGTA 4P23D 2XG4A 3OXRA 4YHNA 1QSFA 4EBQH 5AG8A 1QP1A 2R1XA 3FMGH 5I8KL 5INCA 1SEBA 4GW1B 5D1XD 1CR9L 3EGSB 1AXTH 5I8CB 3T0AA 1IKFL 5DMKA 1PLGL 5J11C 5DMYA 1WZMA 3T08A 1QYGL 2VN7A 3EDKA 5SWSB 1B2WH 1P2CB 1T1XA 3N50A 1QBBA 2VABA 1W0VB 5SWQA 1E6JH 4CADA 4L3CA 1FRGL 3MMEA 1JNNH 1LO0H 4YAQB 5BQ7B 2GT9B 2Y5EA 5LAXB 3MYJB 4RMVA 4LFHD 4U1IB 3KPSD 4BSWB 4JRYA 3C08L 1CDGA 1OL0A 1FVCB 1DLFL 5JLZA 3MA7A 4G7YH 2QQNL 5F88B 3IF1B 4XNMB 2CLVB 4OV6F 1N6VA 2P42B 4U1NB 3QO1B 4OM0H 3ULUC 3WNMA 2YD5A 3RJQB 5HDOA 5FOBB 4KQ4H 1VKXB 5DC4B 1JPSL 1WCQA 3MRBB 3BGFB 3TT3H 3U82B 4V2CB 1FCGA 5FO9B 4N1HB 2YPKB 4P46B 1MCSA 3S5LA 1JNHA 4F15B 5D1ZC 4PJCB 4PP1D 2NR6D 4PRBA 1FVEA 3O9WA 4ZG1A 4PJ8B 2F74B 3FT3B 3GSNH 5EZJB 1J86A 4H1LA 4UT9H 4NUJB 3BHBA 2AV7B 3QIWA 3RX8A 3H3BC 4X6DF 2P8PA 1CTOA 4PJHF 3QQ9C 3G5ZB 1L0QA 3G6JA 5EBLB 4IOIB 5C0FA 5E0QA 2FATH 3KDMB 1FBIH 3REVB 5I73C 2V5RA 2IAMD 1T03H 1CICA 5EU4B 3VFVA 5MEQB 4O2CA 4JGUA 4LKCA 1RUKL 4JO3L 1J9CT 1N6QL 5D7JA 4OFVA 1A7RH 3RZCD 2PYEE 1JN6A 4M4PA 3QUMH 2NW2B 4WW2B 5AUMB 3SDCB 3SBWC 4CMHB 1DANU 1TJGH 3ZDZF 2YHGA 4LLUB 1A5FH 1RK1B 1UQSB 5C0BB 4PJ7A 5C92A 3PWVA 3DHJA 2RGSA 3NACH 5TE6L 2WIMA 4H1LH 1E28A 3S3PA 1SVZA 4KC3B 4GT7A 4X6CA 2NY5C 3AREA 3SDAC 3VDBA 3RUGE 5GXBB 2KQMA 2NZ9D 1EFXB 5BMFH 5C6PB 1MJ7H 5D6DC 1YY9D 1ACYH 1SY6A 2H8PA 1NGWB 1A22B 4CJ0A 4MGXA 3PQYB 1L4IA 4PBWD 1AP2B 4QRPE 4HS8L 2RCSL 1VACB 2X1PA 3PWLB 5I1LB 2NY5L 1OW0A 1HYRC 2ZUUA 1S9VA 1VFAA 1DQQB 2FWOB 3A67L 3NGBB 4GKNA 3MC0A 1QFUH 4OI7A 3T0EB 2W9EL 1M05B 3WNOA 1ZT4B 4JFDB 3EJZD 1T5XA 5ESQA 3MNWB 1G7QB 2IANB 3QFJD 1NGXA 4NUJA 4TNVK 3AUVA 1HXYB 4JFQB 5I1AB 5J12C 5J0BA 4DAGL 1TPXC 1N26A 4C57C 4MAYD 4AG4L 3VXOB 4N0YL 3G5ZA 3MZTA 3HA0A 1DQML 1YJDL 3T0EC 4R4NC 3C5JA 3KJ4C 3V7MA 3GO1L 5DJCA 3CFCH 1I3GH 4HIEA 4JZJC 1ODAA 5ERWB 1KJVB 2R1YA 5E1AB 3IJHB 1RJYA 1ORQA 1EGJA 1KT2B 1VGEL 3BZFB 3MRHA 4PG9B 3QUKB 4QXTB 4OB5H 1VESA 2LU7A 2WUCL 3ETBF 4HXAH 3J7HA 2P8MA 4CW1A 3V4VH 2ZOLB 2JJTA 1CFVH 3C87A 4AMKH 5EUKB 3U46A 5BV7C 3AY4A 3ZDYF 3C5ZC 3LD8B 3QG6A 1ZGLB 4YHIB 4DGIL 3HZYB 1BFOB 5E5RB 2DKUA 3I75B 2JF1A 1FAIL 2OR8A 1J8HB 1I7TB 1Q9KB 4GKOA 5HDBE 5T3ZD 4DGIH 1A6UH 4HXBL 1R3HA 4X5LA 3MLUH 5DJ6A 1NL0L 5IHUH 3PWUA 4JLRA 1GCFA 5IQ9B 3N1GC 2H2SD 3HNVH 4POZC 4HWZB 1OM3L 3V4PH 1UM6L 2L7UA 5EU7C 1ZWIA 1L9NA 1DDHA 3QUZC 2Z8VC 3ARVA 1W0WB 1OP5H 1RZKH 1P7QB 2CK0L 1C12B 4M7LL 3W11C 3QPXH 4XP9H 2E7MA 2BNQD 4KK6C 2X1WL 1IGFL 4XTRC 1XF5B 4JO2L 3MLRH 1Z0NA 2Z93B 5I1JH 5FO7B 4OCWL 3BMVA 3KPRD 1XF2A 2VDML 1B0RB 5K9JL 5J9PA 2X4QA 4PJDB 2Z35B 1CGYA 4IIQC 3LQMA 2ZG2A 1BZ7A 1QHPA 1S9YB 2DQTH 1JHKL 4KDTC 1S7RB 2OP4L 4EN3B 1KYOJ 1I4FB 4GRMA 4WTZG 4UAOB 4HUXB 1BD2B 5C0IB 4AJ0A 1V3KA 4RWYH 2WSKA 4LPYA 4KRMB 1BQHB 2PW2A 2BSTA 5ABDE 4G5ZL 2X7LB 3EUUA 5LBSL 4X7EC 5GGQH 4R26L 4WI9A 4P5TC 5JOFB 4MJ5B 2VXSH 3EYSL 4U6YB 4ZXBA 1LK2A 2KL6A 4CMMB 4J3WA 4PJAB 1KPRA 1WBYB 4TSAH 2YKLL 4JVWA 4E41A 4FQPA 3BDBA 5CMAB 3HMXA 4AY0A 5C6TH 5EZOL 3LQZB 1KEGH 4EJ1C 3ZLQC 1HI6B 3P0YH 1CDCA 1BF8A 4M7LT 1OLLA 3IDIA 3FOLA 5SV4A 3LHPL 1E4XL 3I75A 3BH9B 5J1AB 1PYWA 3OQ3B 2Q8AH 1QBML 2FX9H 1IGJA 4XPHH 5I9QB 3WN5C 4PB0L 1E27A 1LP9B 1UM6H 3BKJL 1CT8A 4GRLB 3JWDL 4LBEB 1NFDB 3CFDA 2VZ3A 1F4WH 3LN4A 4P4KA 1IZKA 1ZA6A 1Q8MA 1GVIA 5C09A 1K8IB 1G9NH 1A6PA 2RQ8A 3B9EA 1GSMA 1NMCB 1INEH 3TYGL 4JZOB 1RU9H 3OR6A 1IT9L 5I8OL 1I1RA 4PJ5A 4WNQB 1OARL 2ZCLL 3F7YA 4K71B 1K4DB 3IXAA 4OD3H 4YHML 4JY6A 4UV4H 1GGCH 2XIDA 1LO4L 3EO1A 1T1YA 3FQXA 4UU9A 3MLSH 1D9KB 2VR5A 1ADQH 3D9AH 1S7XA 2VLRE 4XNMA 2X9YA 1H3TA 4XCEB 3X13A 4F9LA 1UXWB 3EYVA 5KZCD 4JQVA 1MAKA 2OLDA 4XTRD 1TQCB 1F4XH 4UDTA 4JO3H 3PWPE 2C5DC 3GHEL 3E8UH 2QQKH 2ATPA 3BE1H 3CDFA 3GB7A 1R0AL 3P11L 5JQ6H 1L6ZA 3WIFA 1F3RB 3K2UL 4N0UA 1BOGA 3QCVH 3RWGA 1KV3A 4XC3H 2NY0D 1CDHA 3OSKA 1QSEE 2BNRD 4MS8D 2J6EL 1J0HA 1CD1B 2LVCA 3UPRB 1QOKA 1CL7H 4B50A 3W11D 1JYWA 35C8H 1PBYA 1CS6A 4P59L 1CDYA 4Z7UB 3CVIL 3UTTB 5EDXA 2CKBB 2Q7NA 3QA3B 4QKXB 4IMLB 5FA3B 4LNRB 3ULSB 3QEUA 3W9DB 4M4RA 1QSFE 1WV7T 5EU6E 4IRSC 4S1QL 1S9WB 2B7DT 5BVJA 1I9EA 5GJTL 3BP7B 3DBXB 1ZA6B 4L5FH 1MQKL 4AM0A 4HWUA 1DL7H 1S78D 4PJ7E 5DHYB 3OR6B 1E4WL 3IDGB 2G60H 1U8NA 2MKWA 2DM2A 4NO0B 3O0RL 1IQWL 3S36H 2BJMH 5HYIA 3DXAB 4J6RL 4U6TA 4F7PB 3W9EA 2F5AL 3TVMD 1NUDA 4PJ7F 4KKBC 5FYKH 1U3HD 3MCLL 5L9DL 4QWWC 1UH2A 4NO5B 1OAUL 1U8OA 1YEDA 4GG6E 2YUZA 3OKDB 1I1AD 2P8PB 1F4XL 3DPBA 1JNLL 4DKEH 1XF3A 1DQDL 1AGEA 5JMOC 1AR1D 4O2CB 3CVHH 2J2ZA 4PJ8C 4TTDC 3P73A 3U9PH 1N6QH 4NCC1 4KWUA 3RY6C 4ZPTB 4OLXL 3W0WA 3ORJA 3REWB 4K9EL 2PXYA 4NP4H 1HXMB 3RL1B 1LEKA 2I9LA 4YE4H 2W0FA 2VKXA 3R4DA 2ZKHH 1A6VL 2H26A 4OIIH 4OCXH 1NGXB 1YEKL 4GLRI 5IW6A 1BECA 4IRSA 3I6GA 3I02B 3HUJB 4G6ML 1CL7I 4ZS6D 5F7MC 1CE6A 5ALBL 4NKOA 3BO8B 4GOSA 3PHSA 5C2UB 5I17A 2X4UB 3AREB 4PJIE 4JN1L 3W9DA 4Z7NE 4I5BB 1FNLA 4TUKH 4ELKA 5K9JH 1OB1A 2QADD 4ZFFB 1U42A 3VXME 3TN0B 1NDMA 4JN1H 1KXVC 1G7IB 4U05A 3BGMB 4IRSD 5CS7A 1S7TB 4EI6A 2WQ8A 3TT1H 5HD8C 3MV8A 5TGBA 5FDWB 2VH5L 3PGCB 2VAAB 1CXFA 3UEZA 5IHBA 4ENED 4PV9B 2PXYD 4NZDA 3O2DL 3OZ9H 1ZK9A 1UB6B 2GTWA 4P2OC 4MD5A 4LVNB 1YMME 3GRWA 4G8GB 4X98A 3U83A 2HKHH 2P47B 5ANMB 3DV4A 2EDFA 1FDLL 1T5XB 4U1JB 5ESQB 3PDDA 3OBAA 4LGSB 1OAXL 5DLML 2HJKA 5IG7A 5JNYA 4PR5A 3UJJH 4J8RB 1NGQH 4JHBA 3TFKD 4HF5L 2OTPA 2XFXA 3HAEB 1T7WA 5FGCE 5E6IB 3VXOA 4PY7A 1FFPB 5IW1A 2AEQH 4ODUA 4P46C 2GJZB 3W82A 1AGEB 1NLBH 2P5EB 3KLDA 4Q9RL 1XMWA 1TZHA 4G6JH 4KJYA 5IVXE 2IBBA 5FGBA 3MXWL 5I8EB 4X9HA 1OT1A 1F3DH 1FL5B 2ATKA 2VXUL 4LASH 4DUVA 2QSCH 1H3PL 3MFFB 5D93C 4DN3H 7CGTA 3TNMB 5D71L 1I9JH 1NC2D 2F58H 2D31A 4E0RB 2X9WA 3QHFH 1QBLL 2X1OA 3CFJA 4YDJB 2VQTA 1CFNA 3RWFB 4N0FA 3RPIB 4UT6L 1RY7B 4F7MA 5FO7A 4N90E 4ZS6C 4PJGE 4EUPH 5JA8B 3IFOB 4LCUA 3RNQB 2OR7A 2Y07H 4PJDA 2YWZA 4JFED 4NN5B 6FABL 4U6VH 2OMBA 5EUKA 2Q76A 1MI5A 2HLAB 4NN7C 5KW9H 2EH8L 4YWGH 4LEOB 2JIXB 1JPGB 5EOQH 1DEEA 2ESVA 3LKNA 4ZO9A 4ZD3L 3BZ4A 4NGHH 4PV9A 1GAFH 1R3HB 2NTFA 2V9TA 2YPVL 4MA3A 3PWUB 4JAMA 2I5YH 4JB9L 2Z31C 3BPCA 1D3CA 1T22B 2VWEC 3VA6A 3C6SA 1KIPB 5T1LA 2X4PB 4PJBA 4U6YA 4ZXBB 3HRPA 3IFLH 4BK4A 2UY7A 1T2QL 4BQ9A 4FFYL 4XPTL 4ONHA 1BIHA 3BKMH 1QLRB 2EZ0D 4KK9D 4OQTL 2X4OB 3BDXA 3NFPA 4JDVA 1JWSB 8FABA 1TXKA 3GKZA 3Q1SL 4YAQA 2C3WA 3B9KB 1ADQL 1AO7A 5AD0B 2A77L 4YFEA 3MYJA 2LABA 1A7NH 1IGJB 2N7BA 2DL9A 1NJ9B 1ROWA 2XTLA 3QR2A 4KJWD 3MA7B 3KPPA 4JPVH 3IF1A 1FIGH 3DMMD 5C09B 1BM3L 1C5CH 3MLWH 4XCCH 4MB5A 4P4KD 4QT5A 3RPIA 1CIDA 3RWJB 4YDLB 3IXAB 3L3GB 3V5DB 3QNZA 1U58B 4EDWH 3GHBL 4LPXA 5HJ3B 3WIIH 3I6KA 2AJYH 4KDWA 2E9WA 4NCDA 2OJEB 4LHQB 5B22A 3NACL 5TE6H 4DVRL 1D9KA 4MNGE 5CWSB 4DFHA 2GCYB 4NQDD 4DGVH 4DWHA 3M8OL 4MVBD 3IU4L 2NY6B 2EDNA 4WU7A 4X8JB 4D9LH 4XCEA 1PKOA 1EX0A 1QEWA 2XQBH 1W8OA 1GAFL 1IGTB 3P0VH 3OHXB 3G9VA 2PO6A 4RAUB 1FYTA 3UTSA 3WFBH 4MZ2A 3KWWB 2BNRE 5I1CL 1RU9L 4HPYL 1B2WL 3DX9B 2HG5B 4PBVC 3C5ZD 1IJ9A 1TTUA 4XXDB 3B6SB 2FYYA 2QJDA 3R0MA 5DS8B 2J4WL 3GM0A 4NYLA 1LP9F 5DRWA 3MJ7B 4JREB 5MENB 1CD1A 3UPRA 4XAWL 4H0HB 1AD0A 4NSKB 2RB8A 5TQ0H 4NRXB 3FFDB 4UOW0 3TGXA 3S88L 2CLRA 2DB8A 5DZLA 1OTTD 1S5IH 2JE8A 4X80H 4IMLA 4J23A 4YFLI 4R97B 4OJFH 4J4PA 1EFXA 1V8HA 3VXQB 3KPRA 3RWHB 3MJ9A 2NY7H 4NQXA 1IGCH 3OMZA 1KELL 3JWOH 4NKIL 4K94L 3D85B 4GJTB 3R0NA 1J11A 4NQVB 1RAMA 2E27L 1DVFC 3FT4B 5B4MD 5BV7B 3KYOA 1OM3H 5HHOA 4N5EC 2JK5B 1UZ6F 2AJSL 4OCSL 3GMQA 2V9RA 5KOMC 1LO2L 4XCFL 5DK0B 3IFNL 3P9WB 1EEYB 5F7FA 4OF7A 1JRHI 1V7NH 4KKCC 3GSQA 3T0BA 4QCIB 4KUZL 1MJ8H 1OSPH 3IXTA 5E8PB 5E99H 5JUEL 3A6BH 1YQ2A 3O9WD 1XGUA 1U3JA 1G7MA 3OV6A 3MCG1 2CQVA 3V0VB 3UROR 1G84A 5EB9A 3TN0C 4M1CD 1RJZB 1HKLL 1T20B 2R0KL 3EAKA 2X10A 1VFUA 5TE7H 4XPBL 4FQXB 3SCMB 4JPWH 5CZKA 5F96H 3BEWB 3KYMA 4LCYB 3ALXA 4S0SD 4X8XA 1WITA 3FFCE 5D7LB 2NXZD 3W81A 5BS0A 4H26A 3HLAB 2Q8BL 2PXYB 4HWNA 3RL1A 1I8KA 4PJAF 5GRWA 3FFCD 1FNEA 3B8YA 4YUEL 2BSSA 5ITFB 4TVPL 3HNSL 4FMKA 4NRYB 5MP6H 5JDJA 3KYNA 5C08D 2P43B 5TH2A 4K3GA 5T3ZE 4QXTA 3T0EE 1T3FA 3ARBB 2VITA 4OLWL 3CFEB 1G7LB 4ZSOB 2GAZA 5E56A 3QIBA 4A2MA 2C4XA 5ICXB 5LGJA 5ISZD 1MI5D 4NQXB 3DECA 5A16B 1X9QA 1NSNL 4P2CG 3TYFA 1YEDB 5DWUL 1J1XL 3O6FB 4UT7L 1VPOH 3SY0B 4BM7A 4WDIA 1WJ3A 3ULVD 1ZGLA 3QDJA 3T09A 3WXWL 5JOPE 3MV8B 4DKEL 4PGZA 3ULVE 4YHOL 3DROB 1H8NA 4HLJA 5DXWA 3VFWA 1GC1C 3X12A 5A2JH 1IFHH 4IIQA 5D96B 3OF6D 3KPMA 3U2SA 5GSRA 1GZPA 4IHOA 4PJEA 5FKPB 3TVMC 1B0WA 4ZFGH 2Z8RA 3QI9C 4C56B 5C2BL 3LS4H 4YBQC 1IRAY 3O4LE 3PV7A 1QFWM 1U8IA 1FP5A 5CD3A 2ZUWA 1CFTB 4ZUTA 3HUJA 1FFNB 3CX2A 3MREB 4ISVB 3LS5H 5SX5H 2IPTH 3O2VL 1NAML 4L1DA 3T2QA 1R5IA 5MP6L 3JXAA 4HCRL 5D2NE 4K8RH 4C58B 2X2YA 5F9WC 4WV1C 5F7EH 4Z78A 1T7YA 1QVOA 1MFBH 2F53E 3EOYG 3KPOA 4AH2A 3NIFE 3DRQA 3GMLA 4DVBB 2LV4A 4LEXH 1AI1L 3QULB 3RY5A 1DBML 4Y88A 5B39G 3EOBA 4BUGA 4QHLB 4R0LB 2H3NA 3ARDD 1KJ2A 1FGNH 1IBGH 5DR5H 1A6WL 5ANMA 3C60D 4ZSOA 4WUUA 3U7YL 3QUXD 2J3SA 1DE4A 1U95A 3V8OA 2ICWI 3SGEH 1W8NA 1YEHH 1MRCL 1FZKA 5J11B 4LLVB 3IGAB 2VLRB 3O11A 2FDBP 3C8DA 1DFBH 1RFDL 4N8VG 1I9RH 1EEQA 3H8NA 3HE7C 5KSVB 1G7PA 4ODBD 5IW1B 4PJ9B 4MD4B 5EO9A 4QRRA 1OAQL 4WFEE 5AYQA 3U0WL 2P1YA 2VSDA 4HIJA 1EBAA 5IVOA 8CGTA 2K1MA 2WW8A 4JAMB 4UNTA 4CJ1A 4YZFE 2QR0A 2YRZA 5BV7L 1U3HB 5TE4L 3IDMB 4M7JL 4UUJB 1EEZA 1MPAH 2XKUA 4K2UH 3VD4A 1YY8B 2AGJL 4P4KB 1UJ3B 1U8LB 4L5FL 4XNZC 4NWUH 2VISB 5F1OB 5DMGC 2VABB 3BJ91 5SWSD 1D6EA 4HKBB 3V6BR 1AKJA 3DWTA 1LP9E 3K2UH 4MA8H 2J8UF 4WO4B 5BQ7A 4HS8H 3KLHD 4OM1L 4WY7H 1W2KT 4Z7OF 3KPSA 5DRXA 4S1DD 2V9QA 3FL7A 2IH1A 4GXUN 4PGDA 3S37H 1T03L 1CL7L 2HLAA 4OAWA 5LXGH 3LKOA 1WF5A 1MRDL 1GZQA 4LEOA 4F33A 5F9JB 4K3JL 5JW3L 2BNQB 5HGGS 1CGSH 4DKDC 2NPLX 3VXRE 2PCPB 1XT5A 2X1XR 4MWFA 5C3TA 1KIRB 1S7WB 2OSLA 3KPLA 1X4XA 1ZGLP 1CF8H 1H3UA 4JQIL 3GBNL 1JUFA 2DQCL 5K9KB 2FCBA 2XZZA 3Q2CA 3RWJA 1KSRA 2E7BA 5J4MA 4GLRH 2OP4H 2AJZA 2DQCH 4Y0GA 1BVKB 4YDIL 4Y4FC 4JJHA 4I18B 3TPUA 3L9RB 2VXTH 4BUHA 4HLZG 4QRPB 2GCYA 3ULVC 1F4AA 5I6XC 4NQEB 5DF0A 2R23A 3O4LB 4NNYB 4WU7B 2YA0A 1Q94B 1ONQA 1A6ZB 4IMKC 3C2SA 2XN9A 2HYMA 1JNJA 3D3VE 3WUWG 4IS6B 3WXVH 2DDQH 1AHWC 5ISZA 5IQ7L 2HT2C 3RX7A 1WIUA 3SKMB 5ADOL 2PR4H 5HGBA 5ITBH 1JL8A 5TE4H 2IAMB 4Z7WA 3GIZL 1QLEH 3E3QE 4TVPD 2HJFB 4F3FB 4EUPB 2AERT 3CZFB 3H9SE 1PKQE 4CMHC 4BFIA 1AXTL 4P2OB 5C07A 2XV6B 1P4LA 1AKJB 4OKVA 2HH0L 3LB6C 1JK8B 3VI3F 3ARXA 4O5LL 1ETZA 4CVXA 5MEPB 4QXGL 5DUPH 5E2WL 4Z7VB 3GM8A 5B21A 3BYTA 4M02A 3UBXB 5KSAC 5IVZB 4OLWH 1BZ9B 4A6YB 2H8PB 3FQWA 1AQDA 3ZE1E 3SO3B 2X09A 4APQA 2WWKO 1MFNA 5AWNL 4D0CB 2PO6C 3IDXH 3UJJL 1T5WB 3BT2H 3QIWC 1QPPA 1S7QB 4RRPA 3WDIA 4LVEA 2XWTA 3PJSB 5DVOA 1UXSA 4UV7L 1CFBA 4EN3C 3VG9B 4UIMB 1JI2A 3C60C 5F6IB 3NCYP 5D2LF 5D70H 1NEZB 4KTDL 4JG1H 4QOKE 3PHOB 4ODSH 5ECJE 4G42A 1M05A 5E8PA 1NMBL 3L3DA 4Y1AA 2IANA 3ULUD 1G7MB 4ZQKA 4LCWE 3QPQD 3JVGC 3VXRA 5T1KA 3QFJB 4HH9A 5DJ8B 3CPLB 3F6IA 2C3VB 3LKSB 2A9ML 3MSPA 3FFDA 4EBQL 2IBZX 5LCVL 2VDQL 3TBWB 4HGWA 1P69B 4PBXA 1NC4B 4N68A 4NT6A 4U1SB 3ULUF 1QRNE 5FECA 2FRGP 1FG2B 3MRDB 4G9DB 4FFVC 4HIHA 2JJSC 1A6AA 5KAQF 4IRJD 1Q9LB 3O2WH 4ODVH 2DIJA 3D0VB 4WTZA 3WHE1 4NNXB 3T4AB 2O5XH 1FNEB 5HHOB 2EDBA 1IEBA 5ITFA 4HQQH 3FOMA 4FQCH 4LSVL 3U9UA 4K55A 2VXQH 5JR1L 3G5YA 1MIML 3TM6A 1LEIA 4Y4FD 1LDPH 2P8MB 4L9LB 4CW1B 2CUHA 4XMLH 4JFZL 1KOAA 2GK2A 4DGYL 4YE4L 5DMGD 4ERSL 4X6CF 2YBRB 3RP1A 2HJKB 3IDJA 1NFDF 4OF3A 2CDGA 3RWIB 2JB6B 4CU6A 4BKLB 2XFXB 5CD5C 2RBLA 4FQ1L 2OR9L 3GK8H 4HXAL 3T3ME 5DUML 1YPZF 3MRKA 5EA0L 4UIKH 1I8IA 4AYFA 4MS8C 5D7LA 5IMKA 3OL2A 1JZ8A 3BEVB 2B4CL 2R9HD 1W0WA 5F89A 2NY4D 4PD4J 5L9DH 5HI5C 1RQ5A 3WJLA 1P7QA 3MO1A 4ELMB 3HR5A 2WUCH 4K8RC 3CFBB 5EIIB 4NRYA 4NN5C 3TNMA 4F9LC 1T83C 4QRQA 1QFUL 5HHPA 2GJ6A 1LGVA 2IMMA 4W81A 3MV7E 4G6AC 5IB4A 4P9MH 4HFUH 1MNUL 2F53A 2Y7QB 1FZMB 4LARH 3CFEA 3OGCB 4OM1H 4WY7L 3K3QA 3L3HB 4KUZH 5GIRB 4XCNA 1MWAB 3IVKB 3SDDA 2NR6C 1T21A 2VZTA 3RIAF 4QHMB 1V3JA 5HPOA 5EWIL 2AAVA 4QYOB 4HDIA 1YNKL 5EBWA 3KS0H 1B6UA 1KG0A 1WZ1L 3DX8A 4BYHA 3CH8A 3ARYA 5TF0A 4P59H 4V1DE 4MA3B 1H15B 4TUKL 2IGFL 2VL5A 2YEZB 4FP8L 1KULA 1C16A 2R2HB 3O3UN 3SN6N 2DQDL 1MHPL 3NN8A 4PRNA 1P9MA 2UWEB 3MV7A 5CEXB 5E2UH 2FBOJ 4JPVL 4NM4H 2HRPH 1R0AH 3DLQR 4L8DB 1FPTH 5I66B 5IM7A 2LQRA 4OZHE 3QNXB 3N85H 2NMSA 1G7PB 4JPIB 5HI3D 5BZDA 3KNBB 3WEXB 4EIZC 3TBTA 3MRKB 4JFXB 4K3JH 4HWEH 1K5NB 3FQNA 3U0PA 4IDLA 4LKCB 3FRUA 1NMAH 3IAQA 5JA9A 1X5FA 3MO1B 4ELMA 3EYQD 1AJ7H 4U3XA 4GG6F 4TTGA 5IEHA 1O5DT 3WSQL 2CK2A 1J1OH 3MLVH 4HS6A 3HMWH 1BJMA 2VQ1B 4H88H 3EOBB 1YYLL 4MQXD 2ZCHL 3F7YB 4Q97A 2CKBL 3MRIB 4AEIL 4AENA 1D5MA 3L3JB 5EFIB 1J05A 2GITB 3ABZA 1OQOA 2P7TB 3UBXG 2Y23A 4S2SA 3HC0B 5HGDA 5BS0E 1CU4H 4OGXH 3NIDF 4LSSL 2HLFD 1MHEB 1OLZA 3GZKA 3G5XB 4QXUL 2SEBA 4PJFF 1RMFL 3TFKC 1IM3A 1I9RL 3C6LA 3IU3A 4GXVH 3MV9A 3C6LC 5JDSB 2MQ0A 4JFYA 3IFPA 2EKSB 3QEQA 1OTUD 2DWEA 1G9MH 4M7KL 2HT4D 2ATPB 4MD0A 4PY8J 4LPUA 3BPLB 4Y4KA 4HCRH 1MCFA 4J12A 5E8DH 3FO1A 1ITCA 1HWHB 4OQTH 4M7JH 4P2OD 4OF0A 2FO1A 5C6TL 3B43A 1CQYA 2DMBA 1XZ0A 2UUDH 4F9PA 3DIFA 3QUZD 5F1NB 2Z8SA 5ADPL 3T2NH 5HI4D 1I75A 4P3CH 4G6AD 4LLMB 5IM7B 5I66A 2XACC 4YX2H 1PLGH 2GKIA 2OM5A 1TJIL 2HT3C 3BPLC 2PTTB 4LCWA 2W9LA 4XT1C 3ARGD 5GSVB 4F37F 1DVFB 3V6ZB 4PGEA 3LOWA 1HILA 3UTTD 4L4TD 2R4RL 5I2IB 4I0KA 4OCMC 2DKMA 4UOW1 1EO5A 3SJVA 3FZUC 3ZE0E 1MCPL 3UTTE 3VXQA 3ECBB 3FAXA 4YHOH 4JZNA 2YN3A 3RAJL 5D4QA 3WO3B 4NUGL 2Y5TA 2Y36H 4OGAC 1YZZA 1MHCA 2ITCB 2QHRH 1HIMH 1P5VA 2VLMD 2IQ9L 2VUYA 3ZKXB 4UT7H 5DD1L 4JGJA 3AS0A 4Z6AT 2ENYA 3MUY1 4R90L 4GAYB 5TF1H 5CILL 5I1EL 3B9KD 1SJHA 2MKLC 1U8MB 4JREC 1FLRH 4ZDHA 3RQ3A 5JR1H 3PP3K 1WCBA 3DTXB 1QZ1A 2EDLA 2YD8A 3TNNB 4LU5H 3DX7B 1SYVA 1T66C 2Q1EA 2BP3A 4QXWA 5IBTL 1QD0A 1WAAE 4KI5D 5FUOL 3U7WH 4HSQA 2IPUG 4FTVD 4Q7DA 2P45B 3WD5H 4MJIB 4PRIB 1SYSA 4L8BA 1NGYA 4LPVA 2YUVA 1QFHA 1RUPH 4FTVE 1YN7A 3GSXA 2WBJA 4MNGA 2R4SL 4LLDA 3SKMA 3DYOA 5I19L 4Z7WE 3O2VH 1MFAH 2IPTL 1KTLB 1DLHA 5DVNA 2Y07L 4K7PY 3PGDB 5AZEL 5I1KH 2NNAB 1FVDB 4NQDB 2EH7L 1KNOB 4DKAA 4OLEA 1D5ZA 4U6XA 3CX5K 2IPKA 4LRIA 3U7AA 2P8LA 2FX7L 3F7VB 4P2OA 5C07B 4Y5VA 1PG7H 3RJDA 1NL0H 4XBPB 4ZYKA 1I7ZA 3D25B 3OTTA 3BUYA 4F15C 2BVQB 5IVXF 2QLVB 4NQSA 1ZHKB 1QA9B 3QDME 2VXUH 4FXLA 4U1MB 5D7KE 3WFZA 3I85A 3HI5H 1B0RA 1VADB 1BGXH 4NWTL 2VB5A 1QUNA 3DRTB 1NC4A 4OIAA 3G08A 2B1HH 2Q6WB 1MWAL 5E08H 3ECBA 1CGTA 2ZUQC 2QADB 1GHFH 4TUOA 1U3ZA 2G9HA 4ZNEE 4YHIA 4LLWA 3S4SG </