4ZXBB

Structure of the human insulin receptor ectodomain, irdeltabeta construct, in complex with four fab molecules
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
218
structure length
218
Chain Sequence
DIVMSQSPSSLVVSVGEKVTMSCKSSQSLLYSSNQKNFLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYFRYRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 83-7 heavy chain
publication title Higher-Resolution Structure of the Human Insulin Receptor Ectodomain: Multi-Modal Inclusion of the Insert Domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hormone receptor/immune system
total genus 54
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2015-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbB01
2WWMD 5A2FA 5DC0A 1E0OB 4JDVA 4Y4HC 1NFIA 3EYUL 3S36L 1A21A 1NKOA 4JFQA 2VXUH 4AEHH 5TQ0L 1P1ZB 4Z0XB 2I07B 4OGYH 1GXEA 1LK2B 2X4PA 4MD4B 4KU1A 4U1KA 4YK4C 3B3IB 1T5WB 5TFSL 1FZMA 2BNRD 4L8SA 4HWBH 3SDXA 5I1GL 3M45A 2Y7QB 4R4ND 3QO1A 5E5MB 3TN0D 3MUGB 1A5FH 3O3AA 5L2KA 3K4AA 5EBLB 3P0VH 2HT3D 3MLXH 2YXMA 4I0KA 1PZ5B 2CQVA 2OYPA 3SO3C 4FQCH 3LKQB 3WO4B 1MCWW 8FABA 5CHNA 1CD1A 1CFQA 1KV3A 4ZFOB 1JWSA 1RZFH 1YEDB 3V5HB 1ZA3B 4PRDA 1VFAB 1T89C 4OKVA 2XZQH 1MFAH 4CVZB 3O3EA 1H8OA 25C8L 3O3UN 2WAHA 1RY7B 5IBUG 1QBAA 4Z7WB 4CGTA 4LKCA 1A6ZA 7FABH 4J3OC 3FN9A 2VDKH 4OZ4A 3GSXA 1MNUL 4PJEF 1YC7A 1E4KC 2AXGA 3BKCL 1IILE 1LP9B 3HCVA 5TE6L 4A6YB 5DMYA 3PHQA 1MVFA 4XNUL 5I6XC 5IMKA 1W0WA 3UC0H 2FIKA 1YNLL 1HXMB 3EDEA 4UILH 2VISB 3IVKB 1KBGH 1DEEB 5MHSE 4POZD 3C2AL 4JKLA 3MBEA 1UH3A 4PY7B 2HRPH 5I15H 4GS7C 3GKWH 3HE7C 1M7IB 2EDTA 2IBGA 3IDYB 1CT8B 1WZMA 1YZZA 2XNAB 5FGBA 3GI9L 5D1ZD 5GRYA 3E6HB 5EORL 2DL9A 4I3RH 4JFDA 1JPTL 4NNPL 3C09C 4JN1H 1Z5LB 1CQKA 2CLRA 2ORBH 4X5LA 4Z7UE 5GZOD 5IVZB 2GJ6E 4EXKA 1Q9OB 1EO8L 2OJEB 3OQ3B 1AO7B 5I1CL 4FXLA 4UT6H 5GGTA 4JG1H 2O5YL 4Y5XB 3MRDB 3P4OB 4U6YA 2VQ1A 2C1OA 2SEBA 4QHUB 5EOCJ 4NT6A 1XF5B 2VRAA 2R2HB 1MVUA 3PG2A 4M6NH 1Y18A 4NO2B 2J6EA 4JEGB 1B2WL 2CUIA 3L7EA 3QIBC 3GIZH 4DKFL 5F8RC 4M93B 4E5XA 5I16A 2XOTA 2A9MH 3BPNC 4OCWL 3MRCB 5GGUB 3B2UD 1XGRB 1QFWL 1W72H 3DUSA 3Q6FB 2R0LH 1CN4A 1URLA 3ZTNH 2GHWB 3IETA 3VA6A 1IRAY 4YHKH 4TNVK 1HINL 4HJ0C 5JHLL 3HAEG 3QUYC 3GSUB 4K23H 4RGMC 2XG5A 2HKFL 3ARZA 1TQCC 3NIDE 2IBZY 2Z8RA 1G0DA 3REWA 4U3CA 1CXFA 3LEVH 5FYKL 2GSIA 5K9QG 4O58H 2VE6B 5I19L 4L8BA 4RGNB 5KVGH 3SKUD 1UQSA 2V2TB 5K59E 3NCYP 2GK0A 5DMGC 4Y0GA 3MLVL 5IGXL 4F9PA 4Q0XL 4KROB 3TBSB 1WZ1L 1RIVH 3UZEA 2F74B 3FQXB 3WIIH 4LPVA 4YHML 3M8OL 3GEWB 1B4RA 4OQTH 1QQDB 2EYTA 4MNQA 2DM4A 4NNXA 2DICA 3VXNA 1LEIB 4HJJL 1P4BL 3P11L 5K9KA 2Z8WC 5CJOL 4JQIL 1YPZA 4P2CG 2Q86B 4X5XA 5TE7L 3JV0A 1S78C 2VC2L 1C08B 5BVPH 4TNWF 2VDQL 3SKJH 5D70L 5KBNC 3L5JA 4P4KC 4Z77A 4O2EB 5JW3L 4RFNC 2DN7A 4NRYB 4PY8I 2B4CH 3MYJA 2HFFB 3UTTE 3GIVA 3RVXC 4HUKB 2IPUG 3VRIA 3MXWH 5DWUL 5FGCB 1DBAL 3X3GH 3LRHA 4YEEA 3VXUE 5KSAC 5HDQL 3FL7A 5ALBH 1ZS8A 1MCQA 1XGPB 3PWPE 2EXYC 1OGAB 5EBWB 1PG7X 3IDXH 1FVDB 2NY6C 1DE4A 1HSBB 5DVKA 5J9PB 1KCRH 4X5WB 5E8NB 4E42B 4JFZL 3F7VA 2W9DH 3IU4L 3OAUL 5DI8A 4R97C 3T8XA 1N59A 2ZJSH 1YMHA 5FHAH 4OF7A 1CGVA 3PIQB 1HZHL 2VDOL 3D3VB 4AQ1B 4PJ9C 1PG7H 4HIIA 4KK8D 5DK2A 3LV3A 2C26A 4W4OA 2X05A 3KPRD 1JGUH 5L88H 1FFQA 2DTSA 1X5YA 3LMJH 1I1AC 3Q3GB 4UV4H 5DSCA 4I0PD 5C0BD 3T2PA 1CGYA 5AYUH 4KY1H 3SOBH 1F4XL 3V5KA 2X6MA 5E2TH 3TO4A 4MA7H 1G7JA 5MI0C 4MJ6A 2QADB 3TM6A 1YN6B 3T3ME 3QI9B 2DM2A 5C07B 3S3SA 4JG0H 5I17B 4MJIE 4FXGB 5ELIA 3UPAA 2AV1B 4EIZC 4UNUA 3BRGC 4F7CA 4HFUH 4BQ9A 3FB5A 4U0RB 4XVSH 1BQLH 3FFCE 1I8LC 4IRZL 5JHDE 4HGMA 5DJ2A 4BM7A 1JZ3A 3VG0H 2MCPH 5IMMA 2XKNB 4OSUH 3ULUL 1QKZL 1OVZA 1X4ZA 3LHPL 4P5TB 3U7WH 5IKCB 2ZZUT 2ESVE 5KVFL 2M26A 1NKRA 2ZG2A 1Q94A 3VI4E 2DD8H 3B2VL 3NFPA 5E6IA 5HVFB 1X6LA 1Q72H 2PXYD 3BP7A 3VI3E 3C6SB 2ED9A 1FFRA 2X4NA 5LCVH 4PYHA 1F00I 5C0RL 4NYLB 4OQTA 3T65B 1CVSC 1JHKH 1XFPA 1JNNH 1UB6A 4QXWA 1U9KA 4HPOH 4FP8L 4WO4B 3QDGE 1FAIL 4PJDB 5D71H 1VKXA 1C8PA 2GJ6A 3MLYL 3CDGB 4QXUL 2FBJH 5DJYB 1H5BC 4HS6B 3MNVB 2WLZA 4HQQL 2WINB 3KYOB 2GY7B 4AY0A 5BRZB 3N50A 4MXVE 3GHBH 4PJGE 2HH0L 4F58L 4XTRC 4MB5A 1NBVL 4LKXB 4LIQL 3VG9C 4LSVL 4LNRB 4OIBA 3SDAD 4WEBL 1GZPB 5F21B 1AGDB 5EOCH 5F7HA 3CC5B 1CDHA 3V0AC 4GRLA 2VSCA 3NFNA 3RWEA 1B90A 2B0SH 5TQ2L 2W60A 1QLFA 5HVGB 3BRDA 5JIIA 3OKMA 4KQ4L 5C6TH 3ULSB 2P8PB 1R3KA 2YEZA 1GGCL 1A7RH 1DN0B 1WWCA 1F90L 4HK3N 2CDGB 4PTTA 2XTJC 5LQBH 4LSQL 1JWMA 3NCJL 1G9EA 1K3IA 5IB1A 2FJHB 3W0WE 5T1MA 3NABL 3UYOD 3WXVH 4NCC1 3U4EA 1H15A 5DK0A 5LAXA 1TJHL 4HMCA 4KJWD 5DUBB 1CFBA 4FQXD 1J7VR 1MCOL 3OKEB 1INEL 4ODHH 3D48R 5CZXD 1MRDH 2C3GA 2MNUA 1U3HA 5IQ9B 5ESQA 4X8XA 5IBLC 5ESAA 4F7TA 3M17A 4E0RA 1ERNA 5DQDH 2BDNL 3RWCA 3VRJA 1TETL 3MNZA 1KPUB 1SY6H 5CLTA 4S1RL 2CK0H 1NGQL 4QXGL 4ZS6C 2F54E 1KJ2B 1FNSL 1Q8MA 3LVEA 4FQ1L 2EDKA 5FCUH 3RTQC 1I9JL 4PRNA 4PUBL 5FECA 4XP4H 4NKOB 5L2KD 5I75B 4H5SA 3U4AA 3ZL4H 2X44D 4WNQB 2BSSA 4LRIC 1OF2B 2C9AA 3UTTA 2ZSWA 3CVHA 2NZ9C 5D7IE 2VUYA 4PJEB 5IM7B 1ND0B 1XAUA 3WNOA 3MLUL 5ESVA 3BGFB 1I3RA 2OTUA 5TE4L 3QIWC 4P2OC 4TSBL 1JGEB 3RBSA 1V7ML 3PWPA 1AR1D 3O6FD 1CCZA 4S2SB 3HUJE 2PYFA 3HNSL 1I9RL 3BN9D 5INDB 5ETUB 1MAJA 5B4MC 3SN6N 3QCVH 4PJIA 4MA8L 3IFOB 1WF5A 4EEEA 4ZXBD 3QQ9C 2XPGA 4GXVL 32C2B 3LDBC 4KDVA 2XTJB 2VZUA 5ADPH 5IROA 4M7LL 4R2GD 3QXDA 3UJJH 5J06A 2DJSA 4J3XA 2AJYH 4CMHB 1U91B 3BJ91 1MHPH 1S7XB 4QRQB 3BH9B 4HXBH 1LQSR 1AD9B 3WYRA 1CICD 5GRWA 5T3ZH 4LLUA 1MRFH 4RISL 3IDGB 3CLFH 3ZDXF 1G6RB 1DZBA 4OGAD 3E6FA 2BHUA 5JO5A 2AJ3B 5E2UL 4H1LH 2IAND 2XQBH 4N1CA 1SJVA 4ODTL 4QRPE 4S1DC 4MAYA 3SGDH 5C6PB 1QR1A 4MJIA 2DTML 5HI5C 4KZEH 4GXUN 1ZMYA 2W07A 4XXCA 2MFNA 3OKDB 3RNQB 4GFTB 5FGRA 1DBKL 3H3PL 2ITDB 4JFHE 5DT1H 4PJAF 2DYPB 4HSQA 1T03H 3EFDH 1DDHA 5JHDA 5HHNB 4WFGD 2F15A 3WS6C 5HXMA 2C4FU 4EUPB 5GGSY 4WDIB 3O2DH 4NQED 1BFOB 1T7ZA 4KDWA 2ZKHH 5C9JA 1D3CA 1I8MA 1R3LA 4KJQC 5IF0B 5HGAB 5C09A 2ESVA 3VXMB 5A2KH 1KIRA 3G6JE 4LCUA 1KOAA 4NC0B 3L7FB 2BNUB 3MLTB 4Y1AD 1M4KA 3BISA 3I85A 2NY5L 1AGEA 3UTSB 1EIBA 2BSRA 3QULA 4FNLL 4KDTA 2FX7H 5E4EC 3C8KA 3RVUD 1OTTD 2X9XA 1KB9K 1C5CL 3OXSB 5LGJA 4JGUA 3QDGA 1E6OH 4N9OB 4DKEL 5E24E 2R1YB 3MOAH 5ANMB 3DRTA 1FV1A 1D6VH 4P46B 2Z8VC 1T7WA 2GJZB 3RWHA 4TTDD 3L3OA 1EEYB 2CMRH 5JXAL 4KXZH 1NEZG 5EULV 1UENA 5FYKE 2GTWB 4PJBE 4AEEA 1K8DA 1JYVA 2EYSA 3BEVB 4XCFL 5KSUA 1CU4H 1I8KA 1HI6B 2WIIA 1MFCL 2HJKB 3QDME 4OUOA 3OHXB 4LSTL 1MIMH 1U8KB 3P9LB 4Z76A 4MNQD 2A6KA 2W9EL 5BJTB 1RU9L 1S5IH 4OFIA 3HI1A 5DJ8B 5E1AB 2P44B 2LAAA 5DRWA 2GIYA 2Y25A 4H8WC 3ZE0F 3FTGB 1JZ4A 3O0RL 2KH2B 5EN2B 1XR8A 1WEJL 1F02I 5INCB 4YEFA 4J1UA 4CDGC 4Z7NF 5ILTH 3MGOB 3HMXA 3ZHLA 4JVUA 4IDJL 1U8NB 4M8VA 4YDIL 3AM8C 3UYRL 3BWAB 3ZT7A 1OSPL 4LHQB 4X8JB 3BSZH 5CZVH 2IMNA 3OR7A 1QPPA 2IAMC 3BMVA 5HHOE 3VXPB 1YQ2A 1GPOL 2CO6B 5GS2D 4YAQA 2B8OT 3JWOC 3HE6C 4HKJB 4D3CL 4EDXB 4Q6IB 1ZANH 5JNYA 4RAVA 3PGDA 5JXED 4JHWH 3K80A 4JM2A 4H1LA 1U8PA 4LHUB 4YXKL 4ZAKA 1AY1H 4X9HA 1HHGB 1R3HA 4K7FB 1D6EA 3ZSSA 2YPLE 2R0KL 3FB8A 1FFOB 3ILQC 3NIGF 3ROLA 1CDYA 2W59A 4IRJA 4LLYA 5CUSL 4GQ9L 5FKAB 3O2DA 1ZHBA 4KJYB 4TUOA 5GZND 1R0AL 4G43B 4Y4HD 1J0HA 2B39A 5JPNB 3F58L 3DO7A 4YLQT 3HLAB 4OFYD 4LSUL 3HUJA 3WN5B 1IQWH 4PV9A 4DGIL 2CIKA 3OV6A 5FEBA 5F1NA 4OLUL 5IK3A 1MCWM 3ARYA 2BY3A 5ICZA 1WSST 1K85A 3W5NA 1RZ8A 4HT1H 1AXIB 4TNVF 3U48A 5ITBL 4LSSL 4PR5A 3ISWA 4YJZL 2WK2A 3SCMB 2FZ3B 4R0LA 1P2CA 1HSAA 5I0DA 1PAMA 1PDKA 1YEJH 2D0FA 2EDRA 5HDOA 1XGUA 5L8KB 4GSDL 1FHGA 3WE6B 1ZT4A 4EXPX 5FO9B 5D1QB 5JQHC 4XAKE 2HKHH 1HOCA 3QCUL 5MHSD 5F7UA 1K4DA 3UJTH 4PJXE 2IADA 3ULUE 4HUUA 5F3BA 4C56B 3INUH 4U1HA 1OAUL 3V8OA 2R2BB 4J8RB 4MLSA 4MQSB 2IH3A 1X4YA 1EMTL 1J88A 4P5KB 4ZUTA 4XCYA 3JTTB 2MMXA 4KTEH 3EO0A 1ONQB 4M1CC 1EXUA 3V4VL 3V6ZA 3ARXA 4FQLL 4WHTA 5CWSB 4QRPA 1AI1H 4DOHB 2YD7A 1RIHL 2GJ6D 4NSKA 2W65A 43CAA 4OZGF 4ISVA 4LVNC 1AGCA 3QG6A 3PNWA 4JANB 2O5XL 3A6CH 3ZKNC 5CBEA 1C5DA 1K3ZA 4M5ZH 4LSPH 3MCKA 4GT7A 2Y36L 1G7PB 3MUY1 2EZ0D 3QHFH 4NPYA 5CIPB 1U3YA 4NQSA 4EI5B 1KJVA 2VB5A 1N6UA 3WFCL 2Z93A 5IW6B 2I5YH 4RMTA 1UKSA 4MSWA 3G6JA 4GRLD 5DRXB 3HR5B 4Y16A 3HE7D 1QFWI 4BELD 4XPBL 2KUTA 3CDFA 5F9OH 2NQCA 3RPIB 1HKLL 3D2UA 2Y5TA 5F70A 4UBDC 3SDDB 1ZHLA 5FO7B 1RZGB 3D69B 1VACB 3JTSB 3KPSE 4QY8B 4AT6B 4QXTA 4Z8FL 3QQ3A 4NZDA 3KWWA 2O26U 3HG1B 1SHMA 1GSMA 3DX8B 3FN0H 2GEEA 1UWGL 2JELH 2BMKA 4OIIH 3HAEH 3HI5L 1HNGA 2R2EB 4OD2A 4UQ2B 1HK6A 1FO0H 4PJBA 2RR3A 2E7LC 1M05B 3H9HB 1AQKH 1CGSH 1IZKA 1U3HD 4M8QA 3TJHD 4X6EA 3OX8B 4P5MB 1I1YB 2P5ED 1TPXB 3O3DA 3SE9L 5KSBE 4DEPC 4JFYA 3C5ZA 4U1IB 3DUHA 4UU9A 1II4E 3WKMH 3STLA 1ROWA 2PW1B 4OAWA 3RFZC 1A9BA 4L29A 3VFRA 1F4YH 1U6AH 3CU7A 3FB7A 2VLLA 2EIZA 4HDIA 1KLFA 4QTIH 2JTDA 5HJ3A 3SJVB 5C7XL 1A7QL 2VR9A 1Z0MA 2AV7A 4J6RL 4X6DF 3UTTD 3L1OH 1GGBL 3A6BH 3U7AA 2J4WH 3W9EB 3LKSA 5MERB 3NACL 2GITB 1T1YB 3IFLH 4PJ8D 1F11B 4NRXB 1H3TA 5CJQL 5J6GB 5DMGD 3VXUD 3D25B 1KELH 1R6VA 1MUJA 3CK0L 3F7QA 3PWPD 1TZGL 3JWDL 5HHOA 4FQHB 1DVFA 1ZGLP 1LO2L 3MRPA 4LF3A 4OCXH 2CUHA 1NCWL 1BD2B 3S35L 2EICA 5GIRB 4C58B 3MREA 2CDEB 3KYAA 2OK0L 1XF3B 4FFWC 1UXSA 3KPMA 4NC2B 3L5HA 4NUGL 4FQIL 4L9LB 4Q74A 2ID5A 4PB0L 1IGFL 1UEMA 1RUQL 3SGJC 2OR9L 3DSFH 3KDMB 2ZUYA 3JUYA 4BFIA 3I6GB 4Q2ZA 2A74A 3N9GH 2G2RA 2YPLA 3ZDYF 1NC4A 1K6QL 4WTWA 5BXFB 4HG4J 2BVQA 4I77H 1BJMA 3OKLB 5DJ0B 3RVXD 2X5PA 3MODL 4KKCC 3QR2A 2E6QA 2IQ9L 5IFAH 3DV4B 3WFEH 5KSAD 2AERT 1AKJA 4LARH 1OWWA 3FT2B 1BOGA 2EXYD 4UV7L 5HHVH 3WHXB 4JDZB 1TXKA 3C60C 4LLVA 4PJHB 4Q58C 4FQQB 1LWRA 2W0LA 4YHLH 2NY3C 3HC3H 2NY5C 5C0AE 2AXHA 1KIPB 2EYRA 2AJZA 2QQLL 3V6FB 3E8UH 1ZGLM 3PP3H 3BPLB 1Q1JH 4NCC2 5I30H 1U93B 3FFCD 4AMKH 1EGJL 4NN6C 2X1PA 2FEEI 3HAEA 4LU5H 1P84J 3ARDC 5F1SA 2Y72A 3TYGH 1IJ9A 1FO0A 1U2HA 4L4VB 3CMOL 3DYPA 1L0QA 3DX9A 1I1AD 4PJXA 1OP9A 4XWOC 1UB5B 3JZ7A 1UYWH 2CKBH 2C7UA 1VADB 2EC9T 3GO1H 2JJSC 3EOAB 3P9WB 2A0LC 3SQOH 3SE8L 2E8ZA 4G9FE 3T0EC 3DTXA 1MJ7L 3BPOC 4OCMC 5DUPL 2G9HB 4BQ8A 1VPOH 3WS3B 5I8EA 4QHKJ 3QDGD 3V52H 2XZAL 3H9SB 5C0CE 4JVWA 1KCSH 4OM1H 4H0HB 4AEFA 4I5BA 2IALA 3EHBC 4XC3L 5E8EA 4JQXA 2V7NB 3O11B 1HEZA 3ARFD 1INDH 1U3JA 5DD3L 3GSRA 4NKDA 1DQQA 5EFIB 4LSDA 1KYOJ 2XRAL 4JR9L 4LCWB 1NSNH 4J12A 2Q8AH 5E56A 4P57A 4M6AA 1C16A 4BFGA 2C3XA 1JNHA 1DQMH 1NUNB 4OCSL 4HUWB 2AJSH 3MRIA 3T4YB 2R69L 3GBML 1J12A 1B6DA 2G5BA 3U83A 4JFXB 1GJIA 3RDTC 1UJ3C 1EAJA 3MR9A 1TJGL 1DN2A 2OI9B 5E6YA 4QYOA 1J1PL 3IXAA 4NZJA 1UWEL 1BWMA 1H3GA 3W0WD 4LCCA 4QGTA 2OXGA 2UZIH 4DVRL 1S7TA 3P40A 3MLWL 3VFPA 1CF8L 1KJ2L 4I3SH 4EN3B 1X5IA 1AFVH 4JZJC 1IKFL 2X4TB 3Q2CA 5DMIL 2IFGA 4X9GA 4RMWA 4N68A 1QA9B 4JDTH 4K94L 3U6RA 5HYJB 4RQQB 4WUUB 3SBWC 2GQHA 3CSPA 4PRAB 5C08B 1LK3L 3TV3L 4TOYL 3QUXA 4TSAL 2ZP0T 2X42A 5M7QA 2F54D 1QYGH 1NDGB 2NW3A 5EU7C 4NQUA 3TWCL 4DWHA 1MQKL 5AZ2H 5FV2A 2PNDA 4ETQB 4UINH 4ZDHA 3G6AA 5C8JA 4NCDA 1QFWM 1ZT7B 4IRJD 1ULVA 4ZO7A 4Y4KB 3S4SG 1RMFL 4QHNB 1J0KA 4JY5L 1CXHA 4RIRB 2HLFC 1S7SB 2WP3O 3RWGB 5LG1A 2X10A 5FIEA 4ERSH 3QUZB 3TBWB 2VAAB 4Z7WE 1FNGA 1ZLVK 4WHYG 2EC8A 4KRPB 5IBLD 4FABH 1OY3B 2WBKA 1D9KA 5ISZB 1DJSA 1DL7H 2CKBA 4JLRA 4QNPE 4TUJB 5JQ6L 5JOEA 1UZ8A 4P2QE 4YDVA 4NFDA 4YHOL 4JKMA 2ZUQC 4R4FH 4I48B 5B22A 4GAFB 4ZS6D 3V4PH 4PLKC 5HD8D 2IJ0C 2FR4B 3BMWA 4OZIA 1VFBB 2NXZC 1S7QB 1DQDH 4JKPL 2NY2C 3SDYH 2P24A 5L6YL 1NGZB 1G6RL 1TNMA 4U1MA 4L5FL 4NQDD 4APQA 1RULL 2NZ9D 4OCYH 2I60H 3D0VA 1U8OB 2FEDC 3UJIH 1AE6L 4IHOB 4MD0B 2CLVA 4OZGB 5CINL 1F4AA 1YDPA 5L8JB 1FYHB 4WFFE 4P2OD 4U6VH 3U36A 1N5AB 4YBLB 1XGQA 1GIGL 4OF6A 2ICWB 3BWUC 5GRJH 1V7NH 4HWUA 4JO2L 5HYSB 4I2XB 1AO7E 1JYWA 5IFJA 1A3RH 4PV8B 3AU1B 3BVNB 3VFNB 3P77A 3QP3A 5BVJA 3BEWB 5E5RB 1YEKL 5E00A 2AAVA 1IC7H 3IDJA 1FG2B 5EZLB 1T66D 1RK0A 1Z2KA 3BAEH 4JFHD 4LASH 4NWUL 3V7AE 4P2YA 3H7BB 4R8WH 3VXRD 3ZZ1A 3NPSB 1EPFA 2QEJA 3AY4C 5SWSB 4RAUA 3DWTA 1WFUA 4ZSOA 3O9WB 2VXQL 3FFDB 3OPZL 5IVNA 3A6OA 4NC1C 5F9JB 1J18A 1ADQH 1UACH 2GT9B 1IM9A 2EH8H 3MJ9H 1KJ3H 5HI3C 1YYLH 4P3CL 2FGZA 4WWID 2JJWA 4Y16D 4D0BB 3NCFB 3UTPE 5J1AB 3AS1A 4WI4A 4GUPA 4A6YH 2PO6C 1EJOL 1QFUH 3VXQB 3MROA 1PFCA 4XVTH 4X99A 4G9FA 5ERWA 2NYYD 4S1DD 5CAYB 2IG2L 1WIPA 5F7EH 3VFVB 2ZWLT 1EX0A 1SYSA 4UDUA 5FYJU 1NFDB 1DLHA 3HN3A 3H0TA 1JF5A 4OB5L 1CR9L 3EO1A 3QEHB 4N0FA 5TDPB 1CLZL 1YNKL 3FO0L 3LZFL 5C0CA 5GRVK 3C08H 1IGCH 2GY5A 4KHXH 5H94B 2BXYA 2ZOLA 3QB7C 1HH9B 5T5FH 1MCDA 5E95B 1I85C 1I7TA 4UB0H 5EZOL 1OSZB 4HUXB 4KJQD 5HBBA 2YD6A 2BRRL 3FQUA 3QDMD 5C0EA 4X6DB 4FFZL 3HMWL 4ESKA 4TVPL 4ZFFA 4BH8B 4ZTOH 5J11C 4YNYA 4LPXA 3TC9A 1A6TB 2V7HB 4XP1H 3PGFH 4MCZA 1TQBC 3VFMB 4YGVB 3ZHKA 5DXWA 1G84A 1LEIA 3O6LH 1P7QB 2Y06L 2CIIB 5FGCE 3T77B 2PETA 2D9QB 2F53B 3QXUA 1OGAE 4WW2C 4MX7B 2H8PB 4IRSD 1JHTB 4LPYA 1SYVB 2I07A 5GGQL 4P23B 3L5XH 4UI2A 3HFML 5CGYC 1LK2A 1CTNA 4MD4A 3B3IA 4GO6B 1LD9B 2DLIA 3OJMB 1T5WA 3EKCA 1JNJA 1A1NB 1DVFD 4U1JB 1U0QA 4QEGA 3GSQA 5B3JE 3FRUB 3QHTC 2Y7QA 5JW4M 1KXTB 5TDOB 1FRGL 3SE4C 5KANI 5E5MA 5DMKA 4I8DA 1NAML 3MUGA 3D3VE 4S1SL 4G80B 2QKIB 1FFNB 2CPCA 4RMQA 1GL4B 5E8DL 2UVFA 5EBLA 4DQOL 2R8SH 1NGWA 1KXQE 4ENED 1PZ5A 2EDEA 5BS0A 4YGAB 2AEQH 2WBJB 1VGEH 5FB8B 2FJGB 3LKQA 1MY5A 4GAGH 4Y5YC 3VWKB 1N4XH 4ZFOA 3V5HA 3G5YB 1ZA3A 4X6CA 1VFAA 1P4IH 4FS0A 4IDLA 2LU7A 3HNTL 1ADQA 1AKJD 5C07E 1J5OL 1S3KH 3MJ9A 1VB9A 4M02A 5JMRA 3L3IB 2ICEB 3L6FA 1JGVL 2CO7B 2WWKO 4LGSB 3IF1B 1MCSA 4B7IA 4F7MB 3LPGA 4A6YA 1LP9A 4KVCL 1MCPL 2ITCB 1A14L 4H20L 4LL9A 4CVXB 2H9GB 4WTXA 4FG6C 4K3DH 3O8XC 2VISA 3FZUC 5CJXA 3QNYB 1HYSC 3RL2B 3ARUA 2ATKB 4CN1A 4Z0BL 2AGJL 3IVKA 1DEEA 1BLNB 5EZIH 2VLKB 4P2RB 2HTKD 3ILQD 3X3FL 4PY7A 3VXOB 5LXGL 1UVQB 4ONGL 1ZLWH 1KPVB 1LILA 1M7IA 1CT8A 1MPAH 1KTKE 2JCCB 2XNAA 2XG4A 2ADJA 3KVQA 3ULUD 1ZTXL 1RV6X 1N6QL 3E6HA 2PR4L 2DQUL 3OF6D 4K7PL 2DWEB 1Z5LA 3O4LD 4PJDE 1WISA 3P73B 4XCEB 2VLRB 1Q9OA 3H7LA 3VE0B 2E9JA 4XBGB 3EYFB 3LS4H 2ADIB 5ADOL 5ABDE 5IVXF 4Y5XA 3MRDA 1U58B 3D85B 3P4OA 2LTQC 2AJUH 4QHUA 5BRZE 3K1DA 3TT1H 5D1XC 1JHLL 3K7UA 5J12C 1MIEH 4C57C 2R2HA 4LAQL 4FTVB 3NCCB 4POUB 4NO2A 2D7QA 4F57H 5EOTB 4NFCA 3GSNB 1GYAA 3MRCA 5GGUA 1A6VL 1XGRA 4P99A 2ARJQ 5D72H 3Q6FA 5DJZA 2AEIT 2MWCA 3W81A 3GUTB 4LLWB 3EJJX 5K93A 1IAII 4K3EH 1JV5B 1P69B 2X4SA 1CL7L 4AEIL 4MNGA 4QOKD 1JRHL 3GSUA 3TVMB 4CU6A 2YA1A 5D6DA 1SEBB 1J1OL 3ROOB 3EYQC 2YK1H 2RQ8A 3QJHA 3KPSD 1G7IA 3VH8B 3D9AL 5CEZH 1NL0L 2VE6A 4Y4FD 2W0PA 3TZVC 3CFIC 5DD5L 4FZ8L 1T04B 3TBSA 2HWZL 3FQXA 1S7UB 5GISH 4DN3L 3VFGL 4DW2L 4WUKH 1QQDA 3TIDB 2CR3A 1BQSA 1RUKL 4ZD3L 1LO0H 4XP6H 4PG9B 1JPST 2Q86A 4WTZA 1RK1B 1C08A 3KG5A 12E8L 4O2EA 3QUXD 1VHPA 3NZHL 3HPJA 3U7YH 2DI7A 4NRYA 3S9DB 4R7DB 1IGIL 4JDVB 5CBAA 4PJEE 5C0DB 2PTUA 4JPWH 2VITA 2LU3A 1QVOB 1C7TA 2OP4H 2WBWB 5I1DB 4WFHE 2QR0B 4WI5A 3LRSB 2X4PB 4WI6A 3QIBA 1XGPA 1OGAA 5EBWA 1FVDA 1X5KA 1FZMB 2A77H 1HSBA 5J9PA 4M6OH 4L8SB 3SDXB 5E8NA 2ZOKA 3AMKA 5HDBF 4E42A 1E4WH 1FL5A 5CGMA 4UQ3B 1O5DT 4HIXL 3QUYA 1MJ8H 4X83A 3PWVB 1TVDA 3KJ4C 1Z3GH 3HPLB 1TITA 5IVOA 3PIQA 3HZMB 3Q5OA 6FABH 4Y2OA 3D3VA 4DFHA 1JIBA 2FCBA 1CD1B 5HDLA 1KCLA 2B1AH 2EH7L 4PRDB 5EU3B 1CXEA 4XI5D 1GGTA 2OM5A 3Q3GA 2VZTA 3BD5A 5HGBB 2ZCKH 4GBXB 3HHRB 5C0NC 5DR5H 1EO7A 3QO0B 3VRLE 3Q5YA 3WLWD 5IHUH 4RX4D 1QBLH 1P7KB 3QQNA 1DBJL 1GH7A 2VDLH 1CE1L 3UDWC 3KPOB 4P4RB 1YN6A 3GSXB 1RJLB 1B0GA 3QI9A 3M07A 5C07A 3CX5J 1CWVA 4FXGA 2DLFH 2AV1A 1FPTL 3HC4H 4OUUB 1E4JA 1W0WB 2VNCA 2Y5EA 1EVUA 4MZ3A 2P43B 5C0AD 3LB6C 5C0JB 3KLSA 1W0YT 3V0WL 3E3QC 3B9KC 4NKQB 2XKNA 5IEHB 3MBEB 2RFXB 3BUTA 4WI9A 1KIQA 6CGTA 2VOTA 3VXME 1BGXH 4Y2DD 5F6IB 4H88L 4OGZA 4GG6F 1H3PH 2H6PA 4FQJH 3C6SA 4YPGB 2J5LC 3EYUH 4NHCL 5KANG 4IIQB 2NXYD 2NY7H 4KKCD 4G7VH 3UTSE 1RURH 2AQ1A 3T65A 1KN4H 1MAML 1F58L 1JF1B 4WO4A 2DB8A 4RA0C 3BKMH 4PJDA 4TQEL 1RZJL 3P30L 5ANME 3CDGA 2NY3D 2UVEA 4G9FD 5H2BB 4DN4H 5DJYA 5EO9A 4BZ1L 4HS6A 3P4NB 3MNVA 5F97E 3FB6B 4JJ5B 3O2WH 2V2XB 5FYLL 2OSLB 2WINA 1WWWX 5I74B 3MLPA 5BRZA 1IT9H 4G8EB 2XZCL 4PJ9A 1QP1A 5C0CD 2EO9A 5MEPB 3D39B 3WL9B 1BOYA 4LKXA 4WVRA 4LNRA 3O3BB 1TTUA 1QHOA 1R3IL 3V4UH 5HYFA 5T1DL 1GZPA 3GKZA 1A7PL 1AGDA 2VWEC 1MEXH 3CC5A 4PJ5B 4JO4H 35C8L 2R29H 4I4WB 3GK8L 3IAPA 4YFDB 3LRGA 5I1IL 1MJJB 3ULSA 2P8PA 3GSVA 4U2ZA 4ZO9A 3VGAC 2DL2A 3X13B 4CVUA 2P45B 1DN0A 2A0LD 2CDGA 3QA3B 4J3UA 4WIQA 1G1CA 2WANA 3SKNB 4UTBL 4KK6C 1ZKAA 2FECI 5A16B 2H26B 4ZPVB 4FXKA 3UBXB 2OZ4L 1I8LA 5HPOA 2FJHA 4XNQB 1NMCB 3DXAB 4M9PA 4DFIA 2ZCHL 3FQTB 4ZOCA 2AK4B 1TZHB 4XVJH 2JK5B 5DUBA 4WY7H 1J1XH 3OKEA 2EYTB 3EHBD 4MA1B 5IQ9A 4YDLB 4LBEB 3QPQC 4L3AA 4QRRB 1H9VA 5FHBL 5LGHH 3O4OC 4NWTL 4KKNA 3X17A 5GS1B 2ZUWA 1Z9LA 4XX1E 1U3ZA 4Z77B 3VDBA 2NY0B 4G6AC 4U6XA 1XEDA 1JPTH 3I6LD 3MYJB 5CILL 3GIVB 3HB3C 1L7IH 1KGCD 3VMOA 1ZSDB 1FLRL 4OCRH 3VRIB 3WFBL 3IAGC 2I9TB 3UAJC 4WNQA 2I25N 4G7YH 2RCSH 2O5YH 3RDTD 1T20A 4PJEA 5IM7A 1ND0A 4M48H 3SY0B 3EOTL 1IAIM 5DRZB 1FVEB 3B4NA 3ARGB 5EO0A 3UTZA 3H3BC 4YX2L 3F7VB 2Q7YA 1JGEA 1RHHB 4S2SA 1PLGL 4ZUUB 3RX8A 5INDA 1LHZA 5ETUA 4HKBB 4XCCL 1D5XA 2CKNA 3REVB 1QFWH 4PG2C 3IFOA 1SMAA 2M8XA 3MXVH 1ORSB 5D8JH 4TSCL 1MREL 5TH2B 4EQ3A 1CLYL 5IT2L 4P2QD 4XC1H 32C2A 3QFDB 5DK2B 4WHYH 1FG9C 3LV3B 2Q87A 4F9LA 3QEGH 4JM4L 3GRWL 3LH2L 2W92A 2DI8A 3MA9H 3V9FA 3UZQA 1U91A 3D87B 1S7XA 1A4JB 4MD5B 3BH9A 4QRQA 3TT3L 5KVDL 3ILPB 1JPGB 1TCRB 3RAJL 5F1OB 4C56E 4F2MA 5IVXB 5IMLB 1UZ6F 1UM6L 4JREB 1W72B 4MJ6B 2BY1A 2IFFL 4WWKB 4E41D 4PYGA 3DVFA 3C5SB 3CLEH 4R90H 3I75B 1XF4A 1TTFA 4WENB 2EXWD 4HCRL 2YD9A 2VH5L 4NQCB 3M8OH 1JI1A 2AJ3A 4WFFD 4F7CB 4DOHE 5GS0C 3DYMA 5B8CB 4G3YH 4GH7B 5CJOH 3OKDA 3RNQA 1AO7D 4LFHD 3RTQA 3C8DA 1TVHB 1DTUA 1WLHA 3PWUB 2DYPA 2R4SH 2VDML 1ZEAL 3I50L 4PLKD 3KXFB 5HHNA 3RIAK 4EUPA 3B5HA 2NXZD 4WDIA 4OLEA 2FRGP 4X80L 1BFOA 5E6IB 2H3NB 4U1NB 1T7YA 2NY2D 3UZVB 2X4NB 4HAFA 3D1MC 4LRNL 5HGAA 1LNUB 3QZWG 4I18C 1ZK9A 4IMKA 4PS4L 4O9HH 3QIWA 5DWUH 2J8UF 3L7FA 2BNUA 4J7RA 1BIIB 1UB6B 1F3JA 1O0VA 3GZKA 2QHRH 3UTSA 1L7TH 1JL8A 4JE4B 2XWBA 4JFFD 4LNVA 5C86A 5E2VH 1EHLL 2PTTB 3KPLB 4H8WH 1OD9A 2ARJB 3OAUH 3UBXI 2VN4A 3HG1E 4HG4K 5J57B 1M1SA 3MOBL 4HF5H 2G75B 2R1YA 3BZ4B 4BK4A 3WEXB 4P46A 2GJZA 1YNTB 4AZ8A 3HNVH 1EEYA 1OAXL 1JZ7A 2GTWA 3DYOA 1CDBA 1A22B 4Y8AA 4ZFGL 4KROD 1NFKA 3WFZA 3ULVL 3GJFH 1HI6A 2HJKA 4N0CD 5FDWA 2XA3A 3OHXA 4ZODA 1U8KA 3P9LA 3WDJA 3HI6L 5GSRA 5BJTA 4C4KT 4NP4H 3JWOH 3BN3B 1KULA 1AJ7H 1RI8A 5DJ8A 4R4BA 2A83B 4FFYL 3ZYIA 2FX9H 4KQ3L 2IQAA 2F19H 2EDDA 3DMMC 3S4SA 1RVFL 4NO0D 3FTGA 1KCVH 3S34L 5EN2A 3UP1A 1BFSA 3SJVE 1VFOA 1BREA 4HH9A 4IS6A 5F7KC 1BAFH 5INCA 1BJ1J 4G6JL 5EWIH 3U4BL 4R96A 4RFOL 4XMLL 4LPCA 3MGOA 1U8NA 1OM3H 3WS6A 1N5YH 4PRHB 4UAOB 3BWAA 4F7TB 4X8JA 2DQGL 1HQRB 1OGAD 3LHPH 1T0PB 3VXPA 4CNIB 4HKJA 3TJEH 1BD2E 4EDXA 1A2YB 4Q6IA 3MRBA 1UM5H 5DJ6B 1UM4H 2O5ZH 2D9CA 4LQ1A 2AJXH 3EJYD 5GGSB 3DOSA 3ARVA 1HHGA 4K7FA 1ZLSL 2ZSWB 4OLZL 3D3VD 1KYOK 5BO1H 4WU5B 5DD0H 1RUMH 2FHCA 1ZVYA 5IOPB 3CGTA 5FKAA 1BF8A 1BP3B 5EPMB 1WV7T 4CAGA 5JPNA 4JO3L 2CXGA 2Q3AA 4ZUWB 4ONHB 4AM0B 5C3TA 4PJHE 1KEMH 4PJIB 3THML 1WT5A 5DEFB 4XPAL 1J0ZA 5CGYD 3WN5A 3QI9D 1L9NA 4H25B 5C07D 1NMBH 1OAKL 2XPGB 2DQHH 1KCUL 4GG6B 4B50A 3AREB 3KS0H 3QXDB 1ACYH 2VDRH 5T33H 1UJTA 2VL4A 4G42B 3SCMA 2FZ3A 4LSRH 5E2WL 1SM3H 3BPCB 5FM4A 1RZJC 3RZCB 3ZT5A 3H2WA 5KJRH 4PGEB 5FO9A 5D1QA 3T1WA 4LSQH 3L5WA 3QUMB 4L4VE 4P5TD 5TDNB 1NCCH 4HGWB 2VKWA 5CCKL 2P7TB 4MWFA 3V5DA 5T3XE 2C4FT 4C56A 1SMOA 1HHKA 4OZFG 2IAMA 2R2BA 1FORH 4J8RA 3VGEA 4YHZL 2F5BL 4P5KA 1QR1B 4P9HC 4MAYB 3HE6A 3JTTA 1ONQA 1F3DH 5CWSA 3B9DA 3QPXL 4HULB 3VFSB 2HT2C 3LPWA 4JCLA 3IXTB 4DK6A 3H9SE 4F7PB 3GSNL 4KVNL 3ARBC 5T5NF 2LVEA 4JANA 5EBMB 5BRZD 1V5JA 3I02B 5DLML 5EUOF 5C09B 3BDBA 4FG6D 3O8XD 3FZUD 4LCUB 1HYSD 4LCWE 1IC4H 5FYLE 5GGRA 4O4YH 3MCLL 4EI5A 2H2PC 5M94B 4NKIL 1XIWC 5FYJL 5IW6A 5I1LB 1ZV5A 3S3PA 2VQUA 3MRMA 4MA3B 2IPKB 2PKDA 3HR5A 2VLJD 3QULB 3RPIA 3LQAL 3SDDA 3QISA 3B5GA 5FO7A 3U30C 3LKOA 3QRGL 3D69A 3JTSA 4QY8A 1FIGL 4F15C 4YXHL 1T7VA 3KHQA 3DRTB 2EDBA 4KK5D 1YEIH 3HG1A 5IFHH 1HHIB 3LQZA 3D18B 3JUZA 1LEKA 2FH8A 2VR4A 1MI5A 3NTCH 2EIBA 1DBMH 2R2EA 3AB0B 4UQ2A 1I8KB 5D1XD 5LWYH 1A3LH 3W2DH 4XPTL 4LPUA 3S8WA 3QWRD 1AHWB 3DRQA 1B6UA 4Z76B 5KAQF 1I3GH 3H9HA 4R4NC 1IKNA 5FYKU 5T3XH 4ZS7L 2RHEA 2H1PL 5DJCB 4HIEB 3L95B 3OX8A 5D7JC 4P5MA 3LS5L 4KMTL 4WUUE 5HYJE 2Q3ZA 2H32B 2R0ZL 1VGKB 2EKJA 3P0YH 3GDBA 1NANI 1L6ZA 5AD0B 5C08E 4U1IA 5DQJA 2I27N 3SDCC 2D31B 2X2YA 2L7JA 2PW1A 3K81A 1F6FB 2NY1C 5GRUL 1CG9B 1YEGL 3HTLX 3RGVB 2FL5B 1I8IB 3NZ8B 4J1UB 1S9WB 4JFEB 4NZUL 3PP4L 3BQUB 3I84A 5JDSB 2DQJH 4OM0L 3MRKA 1I1FA 2E6JA 5IMOB 1N7ML 2APTA 2WUBH 4JKWA 3OR7B 3W9EA 5D2LF 3MLZH 5EIIB 4ODSL 2XV6B 5MERA 3HZVB 2VZSA 1G0YR 1RZ7H 2GITA 1T1YA 5ACMA 1F11A 3GMMA 2Q76B 4NRXA 4WFHD 2R56H 5J6GA 1X5ZA 3RBGA 4RFEB 3D25A 1OAQL 3UBXG 5JNYB 4PGCA 1BVKB 3K1KC 4RAVB 3GNMH 4FQHA 4PD4J 5ISZE 1H3XA 1T2QL 2J8HA 4JM2B 3BKJH 4Z95H 2A73B 4H1LB 1U8PB 2L4OA 2AEPH 4ZAKB 2OTWB 5GIRA 2VXVL 1T4KA 2CDEA 1XF3A 1XR9B 4XMKH 4K8RH 1HQ4B 4L9LA 1A3QA 3FB8B 4XNXL 4PB9H 3ROLB 2FD6H 1Q38A 4Y19D 3GBNL 2PYED 3KR3H 3KDMA 3CFKB 2O93L 3I6GA 1ZHBB 3H42L 5I2IB 4Z18A 2Y6SD 5BXFA 2ADFH 5I9QB 4XNYL 2DLTA 3OKLA 5DJ0A 1GAFH 1IEAA 4EDWL 4OZGE 5F3HB 2IF7A 4ODVH 2BNRB 2D7MA 3EDFA 3DV4A 5I1AB 1EZVX 1FDLH 5GZOC 1Q9WB 4LQFH 1BZQK 3FT2A 4L8CB 3R0NA 4JDZA 3U0WH 3F6LA 5IK3B 3TN0B 2DQDL 4NN5C 4I2XE 4PJHA 2IGFH 4FQQA 3W11D 5DFTA 3LEYH 4M5YL 4X6BA 5K9JL 1UG9A 2J8UB 5DYOA 4U3HA 3LD8B 1HSAB 2XTLA 1FNEB 4X7EC 1XGUB 4LVOB 2DLHA 2DYPD 2MQ3A 1PW3A 3B2UC 4PTUA 5SWSE 3MPCA 2E9IA 2Z35B 1K4DB 4ORGB 1OAZL 5KVEL 1OTUC 5F3BB 4L4VA 4FQ2H 3VXMD 3MFGB 5BV7L 5GGTL 1QFPA 2QL1A 2XICA 1LDPL 2ZPKL 4ZUTB 3UPCA 1JJUA 5F7YC 5T1LB 5FUCC 2E8YA 1X5JA 1NCNA 3OG4B 4N0RA 4EBQL 1QFHA 1KXVC 1OTSD 1VADA 1RJYB 3VD9A 1I9IL 1OL0A 5DJAB 3EOAA 4K71B 5F71A 3V6ZB 5LBSH 1NH6A 2J6EL 2APFA 5DGQA 1QBBA 1DLFH 3G5XB 4B5EA 1EHAA 1YN7B 43CAB 2G9HA 2VXUL 4ISVB 3I9GH 4AEHL 1NFDE 4OCNC 5LVEA 3H9SA 1C5DB 3VJ6B 4K2UH 1A47A 4RWHA 4P46D 5GGVH 1G9NC 3SGJA 2W0KA 3U0TB 1MY7A 3QQ4B 1AXSB 3E2HB 4OLYH 3WIHH 2WLYA 4ZTPH 2V7NA 3B9KD 4HWBL 1WITA 5D1ZB 4UIKH 2VMFA 5EFIA 4UIMB 1FGVH 4I13B 4LCWA 3EZ8A 3AROA 3LN4A 4HW6A 1R3JB 1YY9C 1BM3H 2E7BA 1A5FL 4X6DE 4IJ3B 3EJZD 1FNFA 4HZLB 3V95A 3P0VL 3ULVE 3MLXL 3LQMA 4HUWA 2R39A 4Y88A 4G8IB 4FQCL 3EO9H 4FMKA 3WD5H 1OW0C 3WJJA 4UDTB 1HNFA 1RZFL 5DC9B 3DUUB 3WO3B 2J3SA 1MHEB 1W0VB 3HKFA 2XZQL 1MFAL 2HVJA 2DQEH 1FZJA 4OD2B 4TVPD 3QFJD 3QIUC 4Q9RH 5IWLA 4U49A 4ZQKB 1I7RB 2F53E 4CL7A 1D5MB 2V5RA 1Q9KB 7FABL 5I8CA 1F6AA 2VDKL 3AGVA 4G8GB 5JOFB 3MX0A 4EN3A 1MCIA 2DJ4A 1L6XA 4NBXB 2X4TA 3OKNA 1DUYB 1NJ9B 3RY6A 3ZTJG 1EBPA 3UC0L 5C0FA 1QA9A 4RQQA 4WUUA 1DANU 4UILL 5D96B 4JPIA 4CN6A 4L29B 3GB7A 3VFRB 2NX5B 5EC2B 2ICES 3IU3B 4DUVA 1IAOB 4W6YB 1UEYA 1QFOA 1KBGL 2AQ2A 2VLLB 4PRAA 4HDIB 4LHUD 4KK8C 1T83A 1UGNA 1NDGA 2HRPL 5I15L 2PCPB 3GKWL 4HIJA 5IBUB 4CBPA 4I0PC 4PRPD 4ETQA 3FCTB 4KK6D 3LKSB 3ALWA 1ZT7A 2XYCA 4I3RL 1FSKC 4JN1L 3W5MA 4GKSB 1R5VB 4QHNA 2D03H 2ORBL 1MUJB 1BEYH 2O5XH 1S7SA 5DVNA 1YEEH 4M1GH 3TBWA 4UT6L 4L3EB 4JG1L 2BNQD 4HWEH 1CFTB 3U79A 4XGZB 2KZWA 5ISZA 1JFQH 1JPFB 2BSED 1IAIH 4BFEA 4KGLA 4M6NL 2NY4C 3GI8L 4I48A 3QG7H 4U7SA 4XBEH 3GIZL 4W4NA 2A9ML 3NFSH 4G6AD 2FR4A 5ITFB 3TA3C 1VFBA 1T7XA 1NC4B 1S7QA 1W72L 2PXYC 3PL6B 4FA8A 3HB3D 1UJ3A 4KJPD 2R0LL 2VLKE 1SJEA 3QJFB 4P2RE 3LEXA 1NGZA 3ZTNL 4D0CB 4YHKL 1F2XK 3WIHA 1MCKA 4LLDA 1MRCH 4TRPH 1WBYB 4K23L 2JCCE 4ZOAA 3GMRB 1NLDH 2WW8A 3GRWA 4IHOA 4KHTH 4BQCA 4OZGA 4C56D 3ZYJA 4HKXB 4TN9A 3LEVL 2RIKA 2Q1EA 3V8CA 4O58L 1N5AA 4CADB 3KLHC 2MPAH 2ICWA 3L3JB 5KVGL 2VLRE 2V5YA 5I76B 4X7SH 5HYSA 4I2XA 4PV8A 4O51B 3VFNA 1A6UH 3LQAC 3BEWA 2YPKA 3Q1SH 2IC2A 3Q6GH 1FYTD 1FZKB 2V2WA 1JPSH 3WIIL 1FG2A 1P5VA 1T1XB 4J2XA 1T2XA 3KPRB 4FHBD 4FTVE 3O6MH 3SDAC 4OQTL 3DROB 2BHYA 3H7BA 5C0BB 5JTWA 1FO0B 5A40E 5SWSA 3L3DA 3U2SB 4XP5H 3DX9B 2ERJC 3O9WA 3IT8D 1MSPA 4L4JA 3C6LC 3FFDA 2UUDK 4FQPA 1MFDH 3SKJL 4EI5D 5F9JA 2CDFA 3RVTC 2GT9A 2HT4D 5E03A 5C0GB 1LE5B 4NM8H 2B4CL 1FCGA 2Y07H 5CSZB 4D0BA 5J1AA 2EDYA 3DTXB 1OPGH 5FYJE 3SDDD 4YHYB 4JGMA 1ES0A 4M7ZC 1GC1H 3MRGB 3T0DA 5I8EB 1WCBB 3MXWL 3X3GL 1BQHB 4GRWF 1T3FB 5EU4B 3N0PB 5ALBL 2CRZA 4KJWC 4KKLD 3IDXL 1QSZA 2LFGA 3ABZA 4ALAH 1NFDA 3LN5B 3QEHA 4DVBB 4N8VG 3SO5A 1KCRL 5TDPA 4S1QH 2W9DL 4BJLA 1JGDB 4PRIA 5H94A 5BMFH 3A0OA 3N85H 3RQ3A 2ZJSL 1HH9A 3BDXA 3CX5K 4N0YH 5FHAL 4P57B 2X7LB 1AD0B 3IKKA 1H3VA 3CSBA 1OSZA 4HUXA 3MJ8B 4D9RE 4ORZC 1YYMH 1A1OB 1MLCA 3MRIB 4X6DA 1BVLB 1SEQH 5IUSA 5D2LB 2G5BB 5HGGS 4BH8A 3SHSA 1PG7L 4JPKH 1JGUL 4QGYA 5L88L 4M61B 2V7HA 3EYSH 4JZOA 3LMJL 2FBOJ 4UV4L 3VMPA 1QD0A 2QQQA 3VFMA 4YGVA 5AYUL 4KY1L 3SOBL 2AW2A 5FK9B 3SJVD 4LCCB 1Y6MR 5E2TL 2CIIA 4MA7L 3QUKB 5F8QC 3O6FC 3PQYB 4Z7UF 3BH8A 3VWJB 4JG0L 4N8PA 3AY4A 1JHTA 4MCYB 2FO4A 4BSVA 3TESA 1SYVA 3NCBB 1CXIA 3SDXE 4EOWH 1J0IA 3MJ7A 4HFUL 4XB7A 1ZWIB 4XVSL 1BQLL 3MV01 2QSQA 4KTDL 4XHJC 5D5MB 1TVBA 3QCTL 4U1JA 2E9WA 3GJFK 1N3NB 1IZJA 2MCPL 3FRUA 4OSUL 1BD2D 4WRLA 2PO6A 3WHE0 1CLOH 2DD8L 2QKIA 3VCLB 1Q72L 3DMMD 3EDKA 5JIPA 1OLZA 4JQVA 5LCVL 2QJDA 5C1MB 1I1CA 4FQXB 4F8QA 3MUHL 2FJGA 3DX7A 1A7OH 1TJIH 4HV8B 5D2NC 5FGBC 3VWKA 1JHKL 1JNNL 2X9YA 2CSPA 4HPOL 2Z91B 3G5YA 5E9DA 5HVHB 4GAJH 3VXTB 3ZKXC 4L1DA 5D71L 4DTGH 4OD3H 2FBJL 5CLWA 1OGTB 5DO2C 4JR9H 2YBRB 3L3IA 5BV7C 2ICEA 4Y5VB 4P9MH 1IQDB 4NN7B 5K59F 3TH2T 3ZYZA 1QSEA 5I8KH 3NAAH 3IF1A 4HKZB 4F7MA 3GHBL 1RUAH 4OZIB 2ITCA 3VXSD 3NA9H 4FMFA 1A1MB 4CVXA 3GBMH 1RAMA 2H9GA 5GHWL 3KHOA 5FCSH 5EOCL 4U1MB 1VFUA 3QNYA 3PDGA 1BHGA 3RJDA 3RL2A 1WBXB 2HFGH 2ATKA 3TCLB 1VENA 5TPWH 4AYFA 2B0SL 1BLNA 2VLKA 1FH5H 1UH2A 1YEFH 5C6TL 3VXOA 1UVQA 4JFDE 3EYVB 1A7RL 2QLVB 2JCCA 1HXYB 1OTTC 4Z5RA 4N5EC 3RNKB 1SBSH 2DMKA 5I71C 1DCLA 4KRLB 5MEOA 4ZXBB 5LQBL 2DWEA 2P1YA 1WAAE 3QXWA 1WTGT 4YO0B 2IBZX 4G6KL 3WXVL 3P73A 3K2MC 5E00B 3MLRH 2VLRA 3VE0A 4R2GB 4TTDC 1I9EA 4XBGA 3EYFA 4NZRH 1C5BH 2ADIA 1RK0B 1U58A 2CRYA 3D85A 4ODHL 4OZFH 1MRDL 4F9PC 1P9MA 3FHAA 4F7EB 1CICB 3H9SD 4JHAH 5DQDL 1VA9A 3L3GA 3D39E 4FTVA 4ZSOB 1SY6L 3BP5B 4HS8H 2D7OA 3MSPA 5EOTA 1OB1B 2CK0L 1IGTA 2A1WH 1B88A 4PJ5E 3OR6B 5IV2B 4LCWD 5FCUL 5FYLD 2AABH 2OCFD 4K9EC 2NLJB 3K74B 4XP4L 3S88L 3GSWB 4L8DB 3CH8A 4LLWA 3ZL4L 1JV5A 3QWQB 1TZIA 4X99B 2BY0A 1F2QA 1L0YA 3K4DA 5SWZD 3DX6B 3TVMA 3CDCA 4HZAA 1SEBA 3ROOA 4UDUB 3KGRA 4YHOH 3CFBA 3DXAE 1LMKA 2QSCH 3BO8B 3T3MF 3MRQB 4ODWA 2AK4E 3MZTA 3EIFA 1IGYA 4LVHC 1T04A 1X5LA 4MXQC 3QCVL 4Y1AB 3QBTB 3ZDZF 1S7UA 3VW3H 4QRRE 3FQUB 5JXEC 2Z31B 1AXTH 3TBYB 1BMGA 4EN3D 2EECA 3VFUB 2EE3A 3TIDA 2H2PD 4WV1B 4YQXH 1XIWD 4V1DB 4DAGH 4PG9A 5ADPL 3PWLB 5AUMB 1BFTA 3UJJL 4TPRH 1RK1A 3HMXL 5HYJD 4WUUD 2V9QA 2HJLB 4N8CH 2EIEA 1MHPL 3VI4F 2DQTL 4HXBL 4RZCB 5C08D 2CLZB 4HIHB 1CZ8H 3VI3F 2E27H 1ACZA 4W4OC 4R7DA 5T3ZL 3E0GA 5GZNC 3CFJB 1MRFL 4LMQI 1UXWB 3CLFL 5C0DA 4YHNA 2IMMA 1QVOA 2XA8H 4HS3B 4UZGA 3UO1H 5I1DA 1UCBH 3MLSH 2QR0A 3TO4C 4Y4KD 3LRSA 1YEHH 3KYMB 4KPHH 4Q9QH 2YZ8A 1NBQA 5A2JH 4KZEL 2HMID 3FO2B 4QF1B 1WBZB 3K46A 1MCHA 2ZCLL 3GSQB 3QUZD 4M7KH 4UQ3A 1BQUA 1T03L 1B4JH 3MGTA 4PJGF 3EFDL 5GRXG 5DMKB 5KN5A 5D7JD 4DUXA 1KEGH 3O2DL 4Z7VB 3VMNA 3PWVA 3BZEB 2ZKHL 4HPYH 1NGWB 5IJKC 3SDCD 3HPLA 3HZMA 5BS0B 1RUPH 2NY1D 4PPTA 3VFTA 1QBMH 3IFPB 5HHXL 2GKIA 3WXWH 2HA1A 2X41A 3CUPB 1ZHNB 2VXTH 1EVTC 1YY8B 4X6CB 5EU3A 5IVXE 5B39B 3DURB 3OJ2C 4OB5H 1DBBH 4WFEE 4MS8D 2GSGA 5HGBA 2ZUVA 4GBXA 3LKRA 3QO0A 5GJTH 1E6OL 3L6FB 4NQCE 2DS4A 1P7KA 3HZKB 3W39B 4QLRA 3KPOA 4P4RA 3MOAL 1RJLA 4Z7QE 1J86A 2LABA 3MV8A 1D6VL 3IDIA 3MRFB 5I1HH 2CMRL 2YUVA 4OUUA 2B4CC 4FFZH 4YZFF 2OMBA 4ODXA 4TTGA 3RWJB 1CU4L 1LEGB 3MUJA 3GMLB 3KXFE 2EZ0C 5C0JA 5DD1H 4KMQA 4DGYL 5D7LD 1MIML 5IEHA 1PD6A 4Y4HB 2RFXA 3PXHA 5F96H 5JR1H 1S5IL 2DKSA 4GRLC 1HHJA 5SWSD 4GRWB 2ADJB 3O9WD 4YPGA 4YK4B 4IIQA 4QHMB 3EUUA 5BQ7B 3G6DH 2YA2A 1NEZB 5F9WC 5D7IF 2MKWA 1HCVA 5ILTL 1JF1A 5TF1H 1T21B 1WAAA 4MQ7B 3D0LA 2JB6B 4JRYB 5H2BA 4XP9H 5DA0B 3BSZL 2XFXB 5CZVL 1OCWH 3P4NA 2VL5B 5T5NG 5I1EL 4NUJB 3FB6A 4JJ5A 3SO3B 5KS9F 2V2XA 2OSLA 1NAMH 5I8OL 1U3HC 3TJHC 4G8EA 4HHAA 3R8QA 4PJ7B 5FGSA 4HUNB 1B0RB 3D39A 1ZANL 4OF8A 3WL9A 5C2BH 5MEPA 2YKLH 3O3BA 4JHWL 2BSTA 5DJZB 1D7FA 5AEAA 1OTUD 4PJ5A 1AY1L 1R24B 1G0XA 2X4SB 4MNGB 4I4WA 5FUOH 4HWBA 1W8NA 3WUWG 3UDWA 4Z7UB 5I18H 1MJJA 3QJHB 3X13A 3ULVD 1M7DB 4NDMB 1AP2A 1G7IB 5ALCL 2WIMA 5I6XB 1HH6B 3QA3A 5HDBE 3G08B 1JMZA 3JVGA 3SKNA 2FNBA 5IQ7H 1CXLA 5A16A 4PJ8C 2H26A 1PKOA 4ZPVA 5FA4B 3UBXA 1XF1A 1NGXB 4XNQA 1NEUA 1P7QD 3DXAA 4PRHE 4QO1A 2V17H 3FQTA 5DTFB 1X3DA 2AK4A 1UA6H 1TZHA 5KAQG 1IQWL 2F53D 4GS7B 2JK5A 1BQHG 3V6OE 3ZKMD 3HE7B 3L5IA 2NZIA 4LBEA 4L9DA 4QRRA 4P23D 4RWYH 4X9BA 5HYEA 4HT1L 5KSVB 1IEHA 3C09B 5AWNH 5GS1A 1YY9D 2EEDA 4U2YA 1IGJB 3TH3T 4X7TB 1YEJL 3HPJB 1BFVH 2VN7A 5HVWA 2HKHL 5CBAB 3ETBF 3UJTL 1GOGA 2VITB 3ZTJH 3BE1H 2EDFA 1ZSDA 3MV7A 3Q5TA 2I9TA 3INUL 4PJFF 4HXAH 2WBJD 3R0MA 3SY0A 3QIBB 5IESH 3DVGA 3QIUD 4YBHA 3VWKD 3BPNB 5DRZA 4KTEL 1FVEA 1CFVH 2P47B 1J11A 1A4KB 2P5EB 3ARGA 2G60H 3P4MB 3RKDD 1KTLA 1E28B 2ZOKB 1FL5B 1RHHA 1AI1L 4PJIE 4HX1B 2VYRE 1DUZB 4LCYB 4ZUUA 4HKBA 4XRCB 3DO3A 3QUYB 4IOFC 3REVA 4GG6E 3OKYA 4RGMB 3HS0B 5GS0H 3A6CL 4NGHH 1ORSA 1TQCB 4LSPL 3G9AB 4M5ZL 2IPTH 5TH2A 3QHFL 3QFDA 4JFPA 2X09A 2I5YL 5GSVB 4YWGH 4QHKI 1EK3A 1D5ZA 3TNMB 3TH4T 1KB5H 1S9VA 1H3UA 2D0HA 1A4JA 4MD5A 5F9OL 3RWIA 3VXUB 3ZLQC 5DC4B 3ILPA 1JPGA 5J13C 1NL0H 1TCRA 3BKYH 4P2RD 2D7NA 2X4RA 2DQIH 5IVXA 3V7MA 5IMLA 1WFOA 1N64H 3CVIH 2VSDA 1W72A 4WWKA 4KDTC 1B0GB 3C5SA 3OKOB 3I75A 4NQCA 3JV4A 3MTRA 3FN0L 1KN2H 3U46B 1E6JH 5E94B 2JELL 1JTOA 5DEGA 4OIIL 1NANH 1JTPA 5B8CA 4TULH 4P4KB 4X4YB 3OJDA 4RFNB 1J8HA 3U82B 1FO0L 3BESR 2NY4D 3ARFC 1TVHA 3PWUA 4MB3A 1KIQB 1AQKL 1CGSL 3DSNA 4IOSD 1H8NA 3KXFA 5C09E 3TBTB 3TA3D 5IIEA 1TIUA 2H3NA 2H6PB 4PD4K 4U1NA 5KSAB 2B2XH 3WKML 1LNUA 2NY6B 1U8HB 1F4YL 1U6AL 1BIIA 3VD5A 1JMXA 2WV3A 4R97B 4QTIL 3C5JB 5FUZH 4PRBB 3RY5A 3P3YA 4RRPG 3T3PF 2NCMA 1I7ZB 2PTTA 3TVMD 3RI5K 3L1OL 3PDOA 5FYJD 3KLHD 3KPLA 5EO9B 2ZNXA 2ARJA 3A6BL 2J4WL 1YJDH 3KLAA 1CD0A 3IFLL 5DURB 2G75A 1WWBX 3BZ4A 4G6FB 1WJ3A 3WEXA 4UT7H 1KELL 1NC2D 2W0FA 3DHJA 4PJ9B 3FOLA 1YNTA 2ICWJ 3QUMH 3BXNB 7CGTA 4ODUB 2AKRB 1I1AB 4HFWB 4K3JH 2Z4QB 3CFCH 2GCYA 4J3VA 3MRRB 5FA3B 5CSBA 5MI0B 3C6LD 3OJVC 1N26A 3B5TA 3GSVB 1FGNH 1EBAA 3B9EA 3RVTD 4D9RD 3DSFL 1NCAH 1AC6A 4WEUD 2A83A 1EEUA 1GZQB 3GM0A 3N9GL 1DBJH 3WUZA 3TYFB 4BK5A 5JW4Q 43C9B 5CP3H 4RGOH 3ELAT 5JZ7C 2P49B 1FZOB 3B8SA 4PJXF 3ULUF 1NCTA 4I77L 1QNZH 4IRJC 4JFEE 4FXKB 5A3IC 1E4XH 3V0VB 4LEOB 4MXWH 2DM3A 5IFAL 3IYLW 3WFEL 4IMLA 5LJYH 1INQB 1MWAH 4LARL 5HHVL 1ZLVH 2R4RH 4OLVH 5T3ZE 1KB5A 5JA9A 4PRHA 1L0XA 4LLAA 4YHLL 4D9QD 3HC3L 2R15A 1HQRA 4M9OA 3V6OA 3BGMA 4CNIA 4M62H 5ICXB 4H88H 3E8UL 1OLLA 5HD8C 1A2YA 4NHCH 4KI5E 4U6XB 1Q1JL 3CAFA 5I30L 3CNKA 4AMKL 4R0LC 2Q8BH 5DJ6A 4OFPA 4WJ5B 1KIUA 2OL3B 4LU5L 2RAMA 3X14A 5GGSA 1MCRA 1H5BB 1BBDH 3TYGL 3BZFB 1K4CB 1T20B 3RX7A 4U6HA 4YUEL 4WU5A 4K7PY 2DWDB 5IB2B 2I24N 5EO0B 4PGDB 3VGHA 3UTZB 5IOPA 1UYWL 3VG9B 2CKBL 3GO1L 1CTOA 2QQNH 2Q7YB 3SQOL 2BNRE 2FGWH 4NZTH 5EPMA 3X12A 1ZGLB 3O6KH 5D9SB 1VPOL 1D5XB 2H32H 4ZUWA 4ONHA 3STZB 3V52L 4AM0A 2WUCH 5DEFA 5F7DB 3WMSA 4P9HH 4U1LA 4H25A 4KKBC 1KCSL 1T66C 1VFMA 4OM1L 3BT2H 4XHJD 1ORQA 4XPGH 3MOQA 2J8UE 4GG6A 3AREA 1INDL 3H9ZA 2GYSA 4G42A 2GUOA 5EUKB 3BPCA 4XPFH 5DA4A 4GMSH 3RZCA 5MEQB 5KSBF 3TIEA 4JZNB 2Q8AL 3ET9F 4PGEA 2FATH 3MBED 4F2MB 3KJ6H 1DQML 3QUMA 5TDNA 3DNKA 2CK2A 4Y16C 4O02H 3DPBA 4HGWA 1FLTX 2P7TA 1XF4B 1F97A 1W8OA 2DBLH 3L3KB 5KS9B 3LIZH 2B1HH 4JFDD 3CX2A 3WJLA 2D3VA 4B7LA 2NYYC 4N8VA 5EU6B 2WP3T 5B39G 5MENA 1H0DB 5DO2D 3WDHA 3RTQB 1EFXB 1YUHB 5I0ZA 3GMOB 1BX2B 4EKXA 5CP3A 2UZIL 3VFSA 3IXTA 4F7PA 4I3SL 4NQDB 1AFVL 1XGTA 1I75A 3WKNA 5EBMA 2B5IC 3I02A 2A6IB 5BW7A 3U9PH 4JDTL 2YD1A 1MWAA 4M1DH 3WFBH 3EAKA 2F5AH 3WBDA 3D39D 3QIWB 5ENWB 4P2OB 4ZNCD 1EDQA 1GOFA 3C5ZC 1F3JB 3PWJB 5I1LA 4J4PA 4PJ5D 1QYGL 4MA3A 5JW5B 2IPKA 4CDHA 4NO5B 3P9MB 2A6DB 2XWBB 5AZ2L 1SY6A 2NW2B 2BC4A 3KYKH 1MLBB 4N5ED 5DJXB 3QRFM 4UINL 2F58H 3QEUB 2HFTA 3SQBA 1Y6KR 4PBVC 2DLEA 2VABB 3LDBB 3VXRB 1OT1A 1HHIA 4ERSL 4KUCD 3BHBA 4IRSC 3D18A 1G7MB 4NHUB 2P8LB 4F8TA 4OKDA 2EC9U 2HLAA 2CH8A 3ZHDA 4FABL 4WCYH 4G8GE 3WNPA 2KBGA 1RJZB 5FDWB 1DVFC 1DL7L 1F4HA 4E9LA 1AHWA 1JNLH 5GSRB 5CSGA 4R4FL 4AL8H 2GAZB 4PJFB 2FB4H 4QRRD 5DJCA 3V4PL 4HIEA 3L95A 4HBCH 4R4BB 3QH3B 4NJ9L 2H32A 1VGKA 4MAUH 1DQDL 2NX5E 1R5IB 1EEZB 2IQAB 3GM8A 3F62A 4R26H 5E99H 5AD0A 3S4SB 3RGHA 3SDYL 4JVPA 2D31A 4ENEC 3A67H 2NY0D 4HH9B 3SGEI 3LN9A 1CG9A 4IS6B 3RGVA 2FL5A 1I8IA 3NZ8A 1S9WA 4R96B 4JFEA 4OCYL 2I60L 3BQUA 5JDSA 4D9LH 1MFBH 4KV5E 1HDMB 1QLEH 4PIRF 3ARBA 4R6UA 4U6VL 3BW9B 5IMOA 5IB4A 1MFNA 2O61B 1N0XH 5EIIA 5GRJL 1V7NL 2OLDA 3HZVA 3DVNB 3IDNA 1CYGA 4GG8B 2Q76A 1A3RL 4L3EE 2HFEB 4MXQD 4RFEA 1F8TH 3C8HA 3CZFB 3BP6B 4QHLA 3KPNB 1BVKA 5EC1B 3MRBB 3SE3C 1IC7L 2YMXH 2PF6A 3ZE1E 1DQJB 2A73A 3C9NB 1T1WA 3BAEL 4Z7OE 5E4EB 5LKNA 2OTWA 4R8WL 4ZFOL 1JI2A 1XR9A 1RZIA 5KW9H 1HQ4A 1UC6A 4RA3A 2HTKC 3KAAA 4BUHA 5J89A 5IHLB 1XT5A 1ADQL 1V3JA 1UACL 3L3HB 2EH8L 3CFKA 3MJ9L 1KJ3L 4IRSB 1YYLL 5I2IA 1D5BB 3ULUC 1JGLH 1BBJB 1HIML 4S11A 4WI7A 4WEMB 4A6YL 1QFUL 5F3HA 3T0WA 2JB5H 2BNRA 5I1AA 3TO4D 4XVTL 4UOW0 1Q9WA 4WWKD 4L4TB 3JV5A 4L8CA 5F7EL 1QG3A 3TN0A 1CLCA 4OV5B 1BPVA 1X5HA 5L8LB 4U1GC 1YQVH 5E7BA 3I2CH 3C08L 1IGCL 4KHXL 4MQTB 5DHYB 3I3BA 2J8UA 3U9UB 2Z9TA 5T5FL 3KPRE 4JQXC 4P0DA 1FNEA 4M6MH 4UB0L 5C0BE 1G9NH 3L5WB 2Z35A 1MFEH 5L0QC 5E8OB 4ZFZB 4OLXH 2FX8L 4ORGA 5E6ID 4MWFB 3V5DB 3CCHB 3GJFB 4XNZC 1UH4A 4ZTOL 1HHKB 4OI7A 2IAMB 2IWGA 4BKLB 4KZDH 1LDSA 1KENH 4RBPK 1KG0B 1A8JH 3HE6B 4XP1L 4RMSA 5T1LA 3PGFL 3KPQB 4HJGB 2V5MA 5HPMA 1RJYA 3O6LL 3NH7H 5DJAA 1ZLUH 4Y4FC 2YN5A 5DUMH 4Q97A 1F5WA 3G5XA 1YN7A 1MCBA 1G9MH 4LDEB 1C12A 1IFHH 4QRUA 3OGCB 4Z7WF 2GK2A 4LGRB 3L5XL 3CPLB 3VJ6A 1NGPH 4C4KO 3NCYS 3U0TA 3QQ4A 1AXSA 3FOMA 4N9GB 2EDWA 1GOHA 5GGRB 5HHMB 3TP4A 4JY4B 1KT2B 2G5RA 3MBXH 5HTSA 4YXLH 5D1ZA 1IGMH 2HN7B 4JRXB 1FAKT 4UIMA 3MRMB 4NBYB 1EZVY 3MV9B 3O4LB 3VGGA 1R3JA 5KG9A 3LKOB 3QUXC 4P59H 3N1QC 5D2LE 1WC7A 4HZLA 2R8SL 3ARPA 3U1SH 1NCDH 1QLRB 5H35B 1BF2A 1F13A 2AEQL 4G8IA 1VGEL 3SKMB 1AGBA 3OMZA 4GAGL 4UDTA 3LQZB 1N4XL 1LEKB 4YHPA 3DUUA 5IHZB 1MI5B 1P4IL 1MHEA 1W0VA 2FJFA 4AIZA 3PQYE 1BECA 3OTTA 2D7TH 4ZQKA 1I7RA 2CGRH 1D5MA 1S3KL 4OT1H 1Q9KA 3DRQB 2N1KA 3OZ9H 3T2NH 4S0TD 4G8GA 4UT9H 5JOFA 3S3JA 5C92A 1FBIH 1T5XB 15C8H 3BD4A 1D9KC 4F3FA 2BJMH 4QOKB 5D5ME 1DUYA 1NJ9A 5DQJB 2UZYB 3PV7A 4IM8A 4K3DL 3KYNB 1N2RB 4N90E 4UNVA 2NX5A 5EC2A 3IU3A 1HILB 1IAOA 2HRLA 2J88H 2X70B 5C71A 1AIFA 5EZIL 5DHVB 3MCG1 3MRKB 1I1FB 2PCPA 3NBNA 4XI5C 4APQC 1WQVT 4LVNB 5B38B 1DSFH 3OWEA 1CK0H 4NO3A 1JYNA 3FCTA 4LMQE 3WLWC 3GMMB 4IOIB 5C2UB 3NA4A 4Q7DA 4GKSA 1R5VA 3JV6B 4PGCB 4EVNB 2YS4A 3LS4L 4Q9CA 3CZJA 4L3EA 1EERB 5KSBB 2AJUL 2BOBA 1CFTA 1T4KB 3AS2A 2AXJA 4PLOB 3TT1L 4XGZA 1MIEL 4OZIE 1JPFA 2X1OA 3GFUA 4NM4H 2OJZH 4F57L 1Y6NR 5BOPA 4JHZA 4K07A 2YRPA 1EJ6A 4HC1H 5ITFA 2X4QB 1FIGH 4Y2DC 1QRNB 2R0WH 3QAZC 5D72L 3RI5F 2JJVA 3HC0B 3PL6A 4YIQB 5I73C 1QEWB 3GGWB 1I3UA 3QJFA 1IEAB 2NXYC 4D0CA 2BERA 4OQ1A 4K3EL 5HGDB 4PJAB 1WBYA 1CFNB 1X44A 2EIDA 3GMRA 3O45B 1VEOA 2YK1L 3NGBC 2K7PA 3OGOE 2WZPD 1YMMB 1Q0YL 4HKXA 2XY2A 5CEZL 4DEPB 1LO3H 5EUOA 4CADA 1PY9A 4D94A 4X6BB 4MAYD 3L3JA 4MJID 1TNNA 5I76A 5DYOB 4DGVH 3TPKA 4C83A 4O51A 4IOFD 1U8IA 2V9TA 2BRQA 3BYYA 4GAYB 1FZKA 5GISL 4QWWC 4PTUB 1T1XA 5JHDD 5E7FA 4K55A 3TLRA 3KPRA 1KLUA 4ZSOE 4A2MA 3IJYA 3NCMA 4WUKL 1J05A 5DGRA 4X4ZA 3DROA 1LVEA 4I0PA 4CW1B 2HTLD 3FQRA 1LO0L 5C0BA 4XP6L 5M95B 5HSFA 5C09D 2ESVD 3U2SA 5IBTH 1MAKA 3F12B 2E6PA 3T0XA 4YE4H 1OARH 4J4PD 4ETYA 4X98A 3U7YL 2YD5A 5IHBA 1S7RB 5C0GA 4YFLF 1LE5A 5ID0B 2AK1H 4XPHH 5CSZA 5E6ZA 1OAQH 4JPWL 3MRGA 5CD3A 5D93C 2OP4L 4WW2F 4YBQC 1WCBA 2CD0A 4WI2A 1BQHA 1T3FA 5EU4A 2VXVH 4BSWB 1NCBH 2JLLA 3T4AB 2A77L 1M6OA 1OQOA 4U05A 3LN5A 4DVBA 4M6OL 4MJ5B 1E4WL 4Y1AE 2DDQH 3RRQA 1JGDA 1NAKH 5LGKA 5MP6H 3LN4B 2X7LA 1MJ8L 1AD0A 3MJ8A 2QSVA 4Q9BA 4V1DE 1Z3GL 4WHDA 1A1OA 6FABL 3C60B 1SVZA 1BVLA 1DFBL 5AAWA 2P5WB 3JSSA 2W9LA 5FM8A 2NY3B 5D2LA 2X9WA 5L7XH 2X89A 2B1AL 2NR6D 1WZLA 2DQDH 4M61A 5J7CC 2HVJB 2BFVH 1FZJB 3WO4C 1T22B 3RGVD 1ZT1B 4U1SA 2J12B 3H9YA 4JFED 5DR5L 3BQUD 4HC1A 3ARWA 4NN6B 5FK9A 5IHUL 2ADGB 2EDHA 1QBLL 2B20A 5I8CB 3SDAA 3QUKA 3TO2B 1F6AB 3PQYA 5E08H 3ARDB 3VWJA 4JO1H 5EA0H 1A6WL 2VDPH 4H0IA 2DLFL 1PSKH 5T3ZD 5CS7A 3OKNB 4MCYA 3HC4L 5C0FB 2Q7NA 1JZ8A 2C3VB 1ZWIA 4JPIB 3IB4A 4MVBC 4O5LH 3GB7B 5D5MA 4PP1C 4DCQB 1N3NA 4JM2D 2JIXB 4YDKH 2FHBA 4Z7VE 3T0EB 4ZAKD 3BPOB 3KPPB 4HIJB 4KI5D 5BS0E 1BGXL 4KAQH 2CJUH 2J6EH 3VCLA 1H3PL 4FQJL 5JZ7D 1U42A 1SBBA 3H3KA 2NY7L 4FQXA 5A3ID 4X6CE 4G7VL 4WI3A 3IDYC 1RURL 1GGIL 2EXWC 4HV8A 3FT4B 4ONFH 3IJSA 1KN4L 2H2SC 2Z91A 3BZDA 4RNRB 3BKML 3VXTA 1NUDA 1CS6A 2FLBT 3QWOB 3VD4A 1BZ7B 1RIUH 4DN4L 3HZYA 1LP9E 1OGTA 1NBYA 4R3SB 2YBRA 5F88B 1FP5A 4Y5VA 3T0AA 1IQDA 3O2WL 1Q0XH 4Y5XC 4KGJA 4HKZA 1IT9L 4X7CC 4M7LT 2HAZA 3WNKA 2I26N 3GHEH 1JBJA 3RDTB 4FZEH 3V4UL 1A1MA 1UJ3B 4TUKH 3WHE1 2VLME 1SJEB 3LEXB 4M93C 1MEXL 1F4WH 4JO4L 1RZKH 1WBXA 2WMPA 2R29L 3TCLA 3STBA 4LLDB 1FFPB 4GRWE 1CQYA 2VDNH 4RRPA 4LDLB 3O6FA 1FJ1B 1FN4B 4JZJB 3EYVA 1JE6A 2BXZA 1HXYA 4K9EH 3RNKA 3FO9B 3LCYA 5D6DC 1XZ0B 5T1LD 2FYYB 4JN2A 4ZXBA 2JJTC 3BIAX 1C1EH 3H6JA 4P2QB 4LOUD 4YO0A 3B83A 3WFDH 2YPKB 3SKOB 4QRPD 2E7MA 2V2WB 3RKPA 4RGNC 4M3KB 4JRYE 4XVJL 1I3VA 4KKBD 2XACC 3WSQH 4XWGH 3SGKA 3RIFK 4M7JH 1OQXA 1J1XL 4LEXH 4WY7L 2V5TA 4KROC 3BIKB 4F7EA 5CZKA 5KTEH 1CICA 2C1PB 3L3DB 4N0CC 4PJ7E 5LGHL 1OHQA 2P42B 4E41B 5GS2H 2DQFB 3BP5A 3OXRB 2CDFB 1OB1A 5D2NA 4CU8A 4I0CC 3DBXB 3ESVF 1H3WM 3OR6A 5FF6B 5IV2A 4LCIH 5T1KB 4MNGE 2NLJA 2IANA 3D2UD 3GSWA 4L8DA 2BZDA 1L7IL 1CE6B 1ES0B 1XCTB 4OCRL 1CGUA 1RFDH 4G7YL 5FKPB 4TVSa 2RCSL 3VFWB 3DX6A 1NMAL 2ZUQB 5C0IB 5I1KH 4M48L 2IBBA 4RGNE 1FL3B 1UKTA 3ALXA 3VRLF 2NXZB 4NQEA 5DZNA 1T0NB 2NY2B 1KC5H 3GI8H 2E7HA 3BO8A 3MRQA 4PRIB 1ZA6B 1CGXA 1HCFX 5EU5A 5ACZB 4XZUA 3HRPA 5FYKD 1W2KT 4GRWH 3IRZA 4Y1AA 3I3EA 3FQWB 3MNWB 5FOJA 4X9IA 4N1EA 2QQKL 4G8GD 3MXVL 1CGTA 1CBVH 1MLCB 1LO4H 2Z31A 3IGAA 5D8JL 5HI4C 3TBYA 3VFUA 1Q9LB 4JFFB 1BZ9A 5F6HI 4XC1L 5D6CB 3C5ZD 3EJYC 4WV1A 3T08A 3JWDC 4V1DA 3PWLA 3R06B 5AUMA 3QEGL 5ICYB 1RJCA 1X5FA 3MA9L 2HJLA 4JZOB 2NX5D 3CXDH 4LLQB 4RZCA 4NBZB 2CLZA 1DQLH 4HIHA 4KKAD 5KVMC 1OWRM 5GJSH 3EOBB 4H0GA 4PP2B 3CFJA 3TFKC 5TGBA 5J6HA 1UXWA 3CLEL 4R90L 2XT1B 1MF2H 3BH8B 3EYOA 2X40A 4HS3A 3JXAA 1SVCP 1MJUL 2BOCB 2P5EE 2FO4B 4BSVB 5CEXA 2QADC 3KYMA 3MJ7B 1XCQA 3QI9C 1NLBH 4G3YL 1WIOA 2ILLA 4S10A 2COQA 3FO2A 4QF1A 5HHOD 1WBZA 1QR4A 1TVBB 4L3ED 5CJBA 1NBZB 1JZ5A 2R4SL 4G5ZH 4NO0B 2PO6B 1P4LB 4U0RC 4ELMF 4QCIA 3RVVD 2GFBB 4HLZG 1BVZA 2BVYA 4OJFH 4Z7VA 3FN3A 3BZEA 4P49A 1E27B 2EKSB 3MJGX 1OD7A 1G1YA 4P5TC 2P4AB 3OSKA 2DQCH 3DX7B 4O9HL 3HR6A 2YPLD 5GPRA 1NC4D 3IJHB 1QZ1A 4G8FB 3IFPA 3BRFA 3PL6D 3CUPA 1ZHNA 5J0BA 1YY8A 2QHRL 5E9DB 2MHAB 5B39A 2YD3A 1L7TL 3DURA 3AAZA 3K2UH 2X1XR 3CU1A 5E2VL 2F9BT 4PJCF 4XMPH 3S5LB 3DI3B 4H8WL 3LKPB 1S7VB 1MCEA 5JXEA 4WO4C 2CR6A 3HZKA 5B38G 3W39A 1QSEB 2R1XA 4HF5L 2LQRA 4PREB 3GMNB 4X0KB 3GMPB 1A9EA 1FNAA 3MRFA 3PHOB 5J11B 2FHFA 2EE2A 3HNVL 2EO1A 3QZWB 2P8MB 1KFAH 5CEZE 2JF1A 2AJVH 1YECH 4GJTB 1TQBB 5J1TC 3RWJA 1LEGA 3GMLA 3MMEB 5F93C 4Y4HA 3OKKB 4WW1B 4NP4L 3JWOL 4NFBA 5FAAA 4GW4B 3RVWC 5EO1B 1YC8A 2RJMA 1UT9A 4WW2B 1X5AA 4XAKD 3CFDA 1AJ7L 4OFYA 4OF0A 2XIDA 4Z5RB 2FX9L 2F19L 5MEOB 3BDYH 4QHMA 1A6AB 1KCVL 1IEBB 2DBJA 3OAZK 3GSOB 5BQ7A 1JYXA 1NEZA 3PHSA 5IB3B 4KK5C 3ES6B 1IAKA 1BAFL 4YHIB 3ZDZE 2H45A 5EWIL 4N5UA 3I6KB 1T21A 1EAPB 4KTDH 2Z0BA 4MQ7A 1OM3L 3QCTH 1N5YL 2A9NH 1MH5B 3CVHH 2ARWA 1PYWB 3MRNB 2JB6A 4JRYA 3RU8H 1CIDA 2FEEL 2XFXA 5IJKA 3K4ZA 2D7PA 2VL5A 3L3GB 3IS1X 4NUJA 4WU7B 1R5WB 2E5EA 2MQCA 4LP4A 4RSVA 3ZT6A 4I1NB 4Y5YB 3TJEL 1IGTB 4PJ7A 1T2JA 1TENA 2XQYG 4OGXH 4Z6AT 1B0RA 4JGJA 2VZ1A 1UM5L 1QSFB 1NDMB 3R1GH 1T89A 3QNXB 1UM4L 4OD1H 5EOQH 4OFVA 3BP4B 3AC0A 2O5ZL 1AC0A 4WGVB 5I1JH 2AJXL 2XWJB 1R24A 1WICA 1TZIB 3NN8B 4OZHF 5BO1L 4Z7UA 1MCLA 4K94C 5I75C 1E4KA 5DD0L 1M7DA 1RUML 4NDMA 4OTXH 4D8PA 3LKNA 4GMTH 3K3QA 2X89D 1HH6A 4JY6B 3CFBB 3G08A 5D7SH 2IH1B 1VCAA 3FQNB 4ODWB 1ZLUK 1IE5A 4KUZH 3O8XB 3BGFC 1IGYB 5AZEH 5FA4A 3RA7H 1MCCA 3DGGB 1NGXA 2QTEA 3S37X 1KEML 3PQYD 5DTFA 4OF3A 5GHWH 4XAWH 4JFOA 3VWJD 1A0QH 1NMBL 3HE7A 2VLJB 2DQHL 4WGWB 4UMGA 3N1FC 4YR6B 3ECBB 5KSVA 1ACYL 3QXVA 2VDRL 5T33L 1QHPA 4LSRL 5IG7B 1SM3L 1IGJA 4KTYA 4X7TA 4F37K 4ZOBA 5KJRL 5EZJB 4F9LC 3EGSA 3PABA 4N90D 3AMLA 2Y6SC 4CMHC 1NCCL 5DQ9B 3S37H 4JAMA 2LTQB 1OAYH 5C6WH 4G6KH 4YHNB 5FM5M 2E9BA 3FMGH 5D1XB 5DZLA 5J12B 4JPVH 2VIRB 4LGPB 4PGZA 1PKQB 1FORL 1FE8H 1G7QB 4A2LA 2QHLA 2PW2B 4YZFE 5KZCD 3MRLB 1A4KA 2P5EA 4RMUA 5L9DH 2ATPB 3P4MA 1E28A 2H41A 3W11C 3IFNH 4HX1A 1DUZA 3MGTB 4LCYA 5KN5B 2Q6WB 2YPVH 1D9KD 2FSEB 1JZ6A 4XRCA 2APVA 2D0GA 2XTJE 3HS0A 4BZ2H 3S88H 2ZUSA 5ID1B 1GHFH 4Z78B 4YFLI 5HYIA 4DKDC 4OZFB 1IC4L 4O4YL 3VFTB 1KF9B 1UADC 2NNA