4ZXEA

X-ray crystal structure of chitosan-binding module 1 derived from chitosanase/glucanase from paenibacillus sp. ik-5.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
132
structure length
132
Chain Sequence
b'HHNLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDSGTPTNWTTVYTTTTGDGGIDDITFTARTAKYVRVHGTVRGTPYGYSLWEFEVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucanase/Chitosanase
molecule tags Hydrolase
source organism Paenibacillus fukuinensis
publication title Mechanism of chitosan recognition by CBM32 carbohydrate-binding modules from a Paenibacillus sp. IK-5 chitosanase/glucanase
pubmed doi rcsb
total genus 31
structure length 132
sequence length 132
chains with identical sequence B, C
ec nomenclature ec 3.2.1.132: Chitosanase.
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4zxeA00
1CZVA 1GUIA 1KGYA 1UMHA 5JXHA 5JMOA 3A22A 2WAAA 2ZXQA 4PQQA 1D7PM 4MOAA 4E8DA 2W5FA 5LCWL 1UYZA 2WQ8A 3P6BA 3FHQA 4QX0A 2YC4A 1O8PA 2X09A 4CU8A 2QQJA 2CDOA 4BK5A 4XUPA 4OZOA 3W5NA 4D8MA 3D3AA 1JI6A 4DXSA 2ZEXA 3GXUA 3CMGA 2VMEA 4PF1A 2ZEWA 2VC9A 5G04L 4XURA 3LE0A 1GNYA 2YG0A 3WF0A 3CQOA 5B4XA 2YB7A 1GOGA 1UY2A 3VD3A 4CUBA 2VZTA 3ZM8A 4OYUA 1JZ8A 4QB2A 3A7QA 3WF2A 1YQ2A 3WF3A 3WNPA 3GM8A 3T0AA 1OD3A 2W87A 2Y6KA 3VDAA 4AAXA 2W1QA 2VMDA 3VD9A 4A6OA 2J1AA 2VZQA 4QDRA 2W9XA 1JZ2A 3C7HA 5CYYA 2VTFA 1UY0A 2VZPA 2Z4FA 1NUKA 5J1XA 3PUIA 4ZY9A 2WYSA 1T2XA 1GOHA 1JYNA 2J1SA 1DP0A 4MGQA 1UWWA 1W8OA 3HPNA 2VOTA 1GOFA 3ETPA 4DUVA 3LQCA 5EJ1B 4DUWA 2XONA 4DEQA 2WZEA 1WCQA 4YPJA 3SEPA 2J22A 1NX9A 1CZTA 1UY4A 3VDBA 3SEEA 2C26A 2ORZA 3AC0A 2DDUA 1US3A 1JZ3A 4Z2AA 3DYMA 2YFUA 4A44A 3OEAA 1F4HA 1JZ4A 1K42A 5CZKA 2LW8A 1TVGA 2Y6GA 1JU4A 3C8XA 5LA1A 4DEVA 3E1F1 1P8JA 2E26A 4A42A 3I2IA 2J7MA 3VD5A 2EIEA 1XNAA 1K45A 4XZUG 4OMCA 2J1UA 3MV11 5JXJA 4JHZA 1H6XA 2CDPA 1F4AA 3T0BA 3FL7A 2QQLA 2KD7A 4UOJA 4XVHA 4OMDA 1J83A 1US2A 5IHRA 1NKGA 2W1UA 4P5YA 3CZJA 3C7OA 3WNNA 1PX4A 4RYDA 2B9VA 4P08A 2BGOA 4M4PA 3CDZB 1O8SA 1RYYA 1UYYA 4ARYA 2JE8A 1XC6A 3I3EA 2Y64A 2VCBA 1JZ5A 1HN1A 3MBWA 3I2FA 5C71A 1W9WA 2X05A 3VD4A 3PUHA 3DYOA 4QB1A 4W8JA 2HLEA 2BERA 4XUTA 1EUUA 3VDCA 4PT6A 3WF4A 1W0NA 4XUOA 3VD7A 5JXIA 4QPWA 1IQDC 2QQIA 1L7RA 4BJ0A 2PQSA 5I0DA 5C70A 3IIIA 4A3ZA 4AG4A 1CX1A 4QAWA 4W4ZA 2JD9A 1I5PA 3EYPA 3I2KA 3OBAA 3UETA 3HOBA 3CKHA 1UXXX 2WUHA 4CU7A 4TXWA 4QX3A 2WABA 2Y6LA 1JZ6A 3NNGA 4ZXEA 2VQUA 1XNTA 2YFZA 3IDAA 1GMMA 2BGPA 2C4XA 1UY1A 3UNPA 3SKVA 3MUY1 3OEBA 4QX2A 3HNMA 4MGSA 2Y8KA 3HNYM 2VJXA 1GU3A 4XUNA 5DMYA 4LKSA 1ULPA 2VZOA 2YC2A 1EUTA 5LA0A 1DLCA 1W9SA 5JXGA 5F7UA 3WNOA 2RV9A 4GZ9A 4OUEA 2XHNA 2W1SA 3UESA 3F2ZA 1JYWA 4ZZ5A 2ID4A 2BZDA 1PMJX 2QBXA 4QB6A 1W8NA 4CVUA 4KI5M 3CIHA 3WNLA 3CZUA 3J7HA 3HEIA 3T08A 2VL4A 1SHWB 2WAOA 4GWJA 4DXTA 1JZ7A 3NJXA 2J1EA 4LPLA 2WO3A 4LHSA 5IFTA 4CUAA 3NQHA 2QQMA 4P00B 3K4DA 2R7EB 3T2PA 1JHJA 2ZEZA 3P1IA 1KEXA 4A45A 2RJ2A 3T0DA 2VMCA 1OF3A 3EB7A 3OB8A 3T09A 4TTGA 2E32A 2VCAA 3MO4A 3ACFA 3I3BA 5JR2A 1OH4A 2VZRA 2E31A 4A41A 2HYXA 3SKJE 4A4AA 4CU9A 1H6YA 3WF1A 2WO1A 3ECQA 4D0QA 2VZ1A 2QQNA 3IB3A 3WQBA 4DXRA 1L7QA 2WDBA 2W46A 2XQXA 4MO3M 3NRUA 3I2HA 1JYVA 3FN9A 2DCKA 4DUXA 2WN3A 3LPGA 2JDAA 2W1WA 2V4VA 1SG3A 1O59A 1MPXA 1ULOA 2E33A 2EIDA 2VZVA 3T2OA 5B4NA 2W91A 2ZEYA 4FI9A 2Y6HA 4JKMA 5IJRA 5HPOA 4BK4A 2C9KA 3ACHA 3LEKA 2DCJA 3I97A 4KWUA 5A1AA 4W50A 4L0PA 2EIBA 2B4KA 1UYXA 1UY3A 1GQPA 4CUCA 3W5MA 3HN3A 3K4AA 5EJZB 2WO2A 4E8CA 3A23A 5IFPA 4RN5A 1J84A 4ARXA 2XOMA 2J1TA 3K75B 2WZ8A 2V72A 3JXSA 3K77A 2L9LA 3HJRA 3DYPA 3THCA 3A21A 5DPNA 1DYOA 2RVAA 5FUIA 4CU6A 3I2JA 3ABZA 4BXSV 1UZ0A 3LEIA 2W92A 3BGAA 5HXMA 2X10A 1CZSA 3NJVA 3WEZA 3GGLA 5DN2A 3I2GA 3I3DA 1OT5A 5EIYB 3ACIA 3WNKA 1W9TA 3C7EA 1OF4A 3OG2A 1SDDB 1CIYA 1K12A 1XPWA 4IUGA 1LNSA 1UMIA 3GDBA 3U37A 1W99A 1UXZA 3C7GA 4BDVB 4QDSA 2QQOA 2VZUA 2VQTA 1NAEA 5DQ0A 4ET7A 3T2QA 1UX7A 2VZ3A 4M4RA 3BN6A 4UI9L 4GWIA 1WKYA 2J1VA 2VMFA 3C7FA 3HNBM 2VO5A 2VCCA 2Y6JA 4UAPA 4XUQA 3K4ZA 3IAPA 1BHGA 2W3JA 3FHAA 5G05L 1JU3A 3OGSA 4JX0A 2EICA 3MUZ1 3THDA 2ORXA 2W94A 3K46A 2VZSA 3WSOA 4ZZ8A 2W47A 1PX3A 3OGRA 2LS6A 1PMHX 4JKKA 3WNMA 3ACGA 2W95A 5LA2A 5C7GA 4LQRA 2OKXA 4MADA 3OGVA 1K3IA 4P02B 1TG7A 2JKXA 2VR4A 2BBAA 2WBKA 4KMQA 4JKLA 3LEGA 3MV01 4HG6B 5JUVA 2J1RA 2QQKA 2WN2A 5IYYA 3LPFA 1R64A 2V5DA 3DECA 4QX1A 4QDQA 2VM9A 1JYXA 3IAQA
chains in the Genus database with same CATH superfamily
1CZVA 3CO2A 1W03A 1AF9A 4URTA 2JECA 3P5BA 5GZDA 2HH9A 2NYYA 3D0SA 1ULCA 4LA2A 1MR5A 4M3CA 4Q4X1 3WV6A 1R1A3 2QVSB 4COUA 1UMHA 2VQAA 4TLFA 1BEV1 1VR3A 3ES1A 5LRRA 4BXFA 1KDKA 1WCDJ 1E5IA 4CDUC 1COV3 1JMUB 1D7PM 4MOAA 1ND2A 2CNAA 4E8DA 1UYZA 3GZAA 3HR9A 4AVSA 3FZ3A 1DQ0A 3M3EA 4Q1RA 2UWAA 4NRQA 5FY1A 1JHNA 1RUD3 4FFGA 4O7XA 2VECA 3N9OA 3OUHA 2VAUA 2X8KA 4OZOA 2ET1A 2BTVC 4P9WA 5F5CA 1DDLA 5HCAA 3Q8BA 4E9KA 1G9CA 2ARBA 4XYXA 5FKBA 4QKBA 1TMF1 4N43A 4RD7A 4RS5A 4AVTA 2DV9A 5JVVA 2VUCA 4Y1UA 3ZFGA 4DRVA 3RZGA 3M8LA 3KF3A 3T1MA 3OBZA 4PDWC 2VMEA 3CJXA 1ZZ9A 5I0UA 4DQAA 1JOPA 3ZXLA 4HSLA 1Y9MA 3M4FA 1GNYA 1W0OA 4CP0A 2VVEA 3PVNA 5JOXA 2WSUA 2WNUA 5DUWA 1LEMA 3DCQA 1G9DA 1K5MA 4QXKA 4BHPA 3WW3A 1GBGA 4FFHA 3B9IA 3ZM8A 2OXBA 1ULFA 1G8WA 1KFXL 5CNAA 4JZRA 5LBBA 1JZ8A 1YIFA 4JCKA 1RUD1 1DF0A 3WNPA 5A70A 3D82A 2WZR2 1RUH1 1D4VB 2IXIA 3R05A 1YQCA 3KSCA 3TOJA 1Y9QA 4IEUA 5LBFA 3VBHA 3G6JB 2GNMA 3QH7A 3VDAA 1OSGA 1X82A 2NM1A 3Q8EA 3FX3A 1DZQA 4AVAA 1PO23 3H8RA 2HWC2 1WW4A 3POBA 5F2SA 4IEXA 3WOGA 1NY72 1QH6A 2W9XA 4IQPA 5DAXA 2BWAA 3C7HA 1PVC1 3FFZA 3J8F1 4I01A 3EJKA 3CU7A 1JYCA 2YXSA 4OFGA 2HEVF 2VH9A 1EP0A 1VBB1 1KJLA 1D4M2 4GAZA 4QQOA 1SCRA 4R9CA 4FQ4A 2CAVA 5LW9A 4QPGC 2ZZJA 4FOWA 4BQ2A 3MLLA 1H1IA 4K3UA 2K2SA 4MX3A 1GOFA 2Y60A 2H6CA 4ES9A 4DUVA 1BLZA 3IDBB 2GN7A 5E6HA 3VBRC 4AFDA 2FDIA 1OA3A 1Q8PA 2ZGSA 4I0BA 5BPXA 4DUWA 3MHZA 4FTBA 3HN1A 3ACLA 3JZVA 4DS0A 1QJU3 3UKNA 2C24A 1OOPB 4OHYA 1UNBA 2YPJA 2A3XA 4NHKA 4QGLA 3VDBA 4IESA 3NL1A 3SEEA 3W9AA 2C26A 1DQ5A 4LORA 3KQRA 3MDPA 4RS5C 5GLZA 3U07A 3ZFGC 3HIFA 3UGFA 2B46X 5C3QA 2VMHA 5F1RA 4GWNA 1LOGA 2DDUA 1Q8OA 2PQQA 2GC0A 4V2WA 3IMMA 3B3QE 4KWLA 5A6YA 4AHZA 4EYUA 1K42A 4FPHA 1SPPB 2RG4A 4KH9A 2FCVA 2PMWB 1GYKA 1YO8A 1H2MA 2Y6GA 1GZWB 4XIKA 1JU4A 3LCPA 4YG6A 2RMU1 2RDQA 5FMDA 3UKVA 2JXAA 5CIRA 3L9JT 5FZDA 1GQGA 3TEWA 3I2IA 4LHLA 1AR92 2EIEA 2ETEA 1XNAA 3ZFEA 2B39A 4UYBA 4COZA 4OMCA 2J1UA 4RGAA 1CAVB 2GALA 3MV11 4CDQB 1VBA2 1IS3A 1OHFA 1Z7S2 1WW7A 1QDCA 1H6XA 2IXKA 2XHKA 1GR3A 3USSA 2RJLA 3MPPG 4Q26A 1J59A 4RQPB 3FL7A 2QQLA 2PHUA 2B42B 1IZ3A 1SLTA 2KD7A 3AX4A 4BMBA 1FOD2 2FZ1A 2ZGKA 4HVRA 3ZMOA 5IHRA 2XL7A 3MEPA 2PHRA 3UV9A 4S2FA 2W1UA 5JSPA 5JOZA 4S2GA 2RE9A 1Y43B 5GLWA 2NLRA 1BBT3 1DCSA 1LCLA 1S4CA 1XNKA 2VTXA 4XQ4A 5DDJ1 5KBFA 4CDWB 2AR6A 3H50A 4QHOA 3DXTA 4BM8A 4JC1A 1XSQA 3E5UA 3CDZB 1GZWA 1UYYA 3S30A 4ARYA 2IXCA 3S0MA 3D0JA 4BIFA 1AX2A 1Q56A 3W59A 4D6SA 2Y64A 4LBNA 1BKZA 3LA2A 4WM7C 3I2OA 4IV3C 3I2FA 5T3NA 3I7DA 2VW0A 1KXGA 1LU1A 4YM3A 4CDWA 4OHXA 1H8TA 1Z0HA 2RDSA 3DYOA 1HW5A 4HK8A 5FZ0A 4W8JA 3U78A 4XUTA 1QMJA 4I0WB 1J3QA 2WFF2 1AR81 4PT6A 1UIJA 1GNHA 2BFUL 1RUH2 2HWF3 5A1LA 1WCUA 1OA4A 2ARCA 2ZBJA 1MZ5A 3VD7A 2EVXA 2DVAA 2VTXJ 4NIAA 4CUGA 1AR82 3RVHA 5CADA 1V6NA 4Q4W1 1A34A 1IQDC 1C1FA 3IDEA 5A1FA 1CAVA 3FMGA 3VLBB 4BJ0A 1X9PA 5I0DA 1FOD3 1QXJA 4OZXA 2JD9A 3DL3A 3OCPA 4OHZA 2IVIB 2VVDA 2IXLA 5FYYA 1S0DA 2WIIB 1PGL2 1QJY2 1B35A 1ZZ6A 3ZX7A 1YQ8A 1FV3A 3OBAA 2Y0OA 4JV4A 5E88A 3QBQA 1H8VA 4LLOA 5FP3A 5F5AA 3CKHA 2OVUA 2D5FA 1AR62 2OYZA 4AI9A 4TXWA 4NIHA 4XBNA 2BVBA 4YARA 1XYPA 1AUYA 1EYBA 3NNGA 4ZXEA 4MHRA 1KS5A 3H8XA 2WLQA 5JIAA 2BGPA 1XOYA 2J42A 3POJA 2C4XA 4FP2A 4YFWA 3O1MA 1GICA 1BZWA 1SLAA 3SKVA 3ZYJB 3MUY1 4JAAA 4XDPA 1MS8A 1VRBA 2W52A 3HNMA 2RS51 3SC7X 1JODA 4MGSA 5EYYA 4GXLA 1DQ2A 3N7KA 4PIYA 2YC2A 3RYKA 3ZXDA 1VBD3 5E16A 3ITQA 1DLCA 1SFYA 4I3GA 1RL3A 1A3KA 1W9SA 1YFWA 5FZ8A 1OQ1A 1OQDA 1WCSA 3HT2A 3HQUA 2D6LX 2AH2A 2W2IA 5FZAA 1BEV3 3WHUA 5FOJB 1WD4A 5A3LA 5DZGA 1JYWA 4XFBA 5I0SA 4LKDA 1AR93 4OUSA 4YG0A 4AFBA 5J7MA 4XFCA 1VBD2 4A7ZA 1GKBA 3TB0A 1J58A 1XQNA 2RS32 5H9SA 4XABA 4QM9A 4AQTA 3LF7A 2NPIA 2VOWA 4ASKA 4KI5M 4O9EA 3UKTA 2BYVE 1UX6A 4QGMA 3OPTA 5F37A 4IL7A 3WVJA 1OKOA 5FFOC 4D3WA 4FXKB 3HEIA 1RUE2 4FPOB 2WAOA 1CPNA 4GWJA 4HFSA 4R8HA 1JZ7A 4D94A 4MXVA 2VMGA 1LHOA 1ZZ7A 4LPLA 2WO3A 2JDNA 4JTOA 4LHSA 5A3WA 3TWIA 1VBE3 3THTA 2ADEA 3WW2A 5IFTA 1HN0A 5CU1A 2RMU2 5A6QA 1O4TA 2XJTA 4HVOA 5LZ6A 4AQ2A 4M3CB 3WQ7A 4FPEA 4P9YA 4H14A 3NNJA 3TYJA 4YZ3A 3QH6A 2IVJA 1XYNA 3WG2A 5GZGA 1JBCA 1WUVA 1IPSA 3GALA 4BH9A 1W2UA 1OVSA 4TWTA 1UOBA 2P3YA 1N1SA 4N9IA 3T3YA 2VCAA 3NV2A 4AHYA 2IXJA 2Y33A 1YJLA 1QOOA 3V56A 5FYUA 1FOD1 3FHIB 2BOJA 4Y1XA 2VBPA 5DUUA 3NKTA 3NJZA 1CAXA 5FZHA 3WT3A 4UFJA 2R49A 1IKPA 2DVGA 1LOBA 5FZLA 4A41A 4A4AA 4D69A 4AHXA 4CP9B 1RUH3 2YV8A 4HONA 4NPRA 2RS31 2XUEA 2GMEA 2CY6A 4Y1YA 4D0QA 1FATA 4LO4B 4QXCA 2CGNA 4QPIA 2AEZA 4DXRA 1L7QA 4FTEA 2YBSA 2HWF1 4MO3M 3NRUA 2W68A 1AX0A 2XLFA 3FUOA 3QOPA 1YCIA 2JDAA 4XBLA 2V4VA 2TEPA 1X7NA 5FY4A 4EN8B 1AJOA 3VL8A 5B2GB 1ULOA 2WZR3 3DF0A 2VZVA 5JDBA 3QLQA 1HB2A 4NWWA 2P2KA 1ENSA 2PAEA 2Q0AA 2RS11 5HXVA 1S55A 1SBEA 4XF4A 5FZFA 3RJRA 4L97A 1GP5A 3NJYA 3TN93 2GSYA 4K20A 4QGNA 3OD0A 5C8WA 3E6DA 3PVBB 2VMIA 3QD6A 3R4UA 1VE0A 4CXWA 5FV3A 3I97A 4KWUA 2Q8EA 4RS5B 3VBOA 5A1AA 1RUJ2 5FXVA 3K48A 5DDJ3 3APBA 1HXS2 2EIBA 2YU2A 4Q4V1 3EMRA 4U36A 5FZ6A 1RHI2 2AREA 2WO2A 1CQ9A 3NWKA 5GJ6A 5FK8A 1TNRA 1OLQA 2Y0IA 5FZMA 1XE0A 2WSVA 4RN5A 5KHHA 4BQ4A 2R0HA 5FJHA 3WQ0A 1EY2A 2OX0A 1WMEA 2PHXA 3KT1A 2G9ZA 4FPGA 3O12A 3ZO0B 3SMHA 2IUWA 3VB9A 2WZ8A 3KV6A 2HWE3 1ZNPA 4CYDA 2V72A 1J1TA 4NO4A 3K77A 3AVRA 4FOQA 1W90A 3WXPA 3V0AA 2JDHA 3EO6A 2BU9A 2MEV2 3A21A 3THPA 1DYOA 3VBOB 3O1SA 2D6NA 1LEDA 2RVAA 4CU6A 4NHMA 4GB32 2GNDA 1PVC2 3K2OA 3LEIA 1GSLA 1SBFA 2TNFA 1CJDA 5FQ0B 2VU9A 1VB2A 5FZ4A 5HXMA 1CZSA 2D43A 3RI8A 3IZOA 1QHDA 4BQXA 5ABJC 3WEZA 4UF0B 3HD8B 1CN1A 4EWDA 2HWE2 2W39A 3ZIWA 3OGGA 4IEYA 4MXWA 1IS4A 4CCMA 4JRAA 1OT5A 5EIYB 1E57A 5IVEA 1DFQA 2ERFA 5LA9A 2QE3A 2G19A 1PVXA 4LJHA 1W9TA 1H4HA 1OF4A 3OG2A 2ZMLA 3ZKYA 4CEYB 1SDDB 2WT2A 3O1RA 2UYAA 4AF9A 4XILA 1UMIA 4COWA 1W99A 5FXZA 4LR4A 3BTXA 1UXZA 1YJKA 2BWCA 1GLHA 4ASLA 3RJ2X 2VZUA 4K21A 4BDVB 4F7ZA 2VQTA 5F5QA 1KRIA 5A3TA 4UW6A 4UXAA 1QJX1 4BQYA 1A8MA 3T2QA 3BB6A 3EHKA 5CFCC 2EA7A 2WQ4A 4HL0A 4PLNA 2H0VA 4OLLA 4UFMA 3BN6A 2WFF3 3BCWA 4LITA 5FOBB 2J1VA 2VMFA 3C7FA 4XFFA 3VDDC 3IPVB 4XJWA 2VCCA 2Y6JA 3H8UA 3L2YA 5EWSA 4A3XA 2CGPA 2ZMNA 1RVF2 2FDHA 3VHNA 1BMV2 3A4UA 5FQ0A 2B9UA 3ROUA 2Q5TA 5H9QA 3M3QA 3MUZ1 2EXJA 4CDWC 3Q8AA 1YFYA 2W94A 3K46A 3PMEA 1PX3A 4C8DA 2C1FA 4H7MA 4CXXA 1I3HA 2XGXA 4JKKA 3WNMA 2DWRA 2HWB3 3ACGA 1RGSA 4BLJA 1GFF2 1Q8QA 5C7GA 4XEZA 2JG9B 5EPAA 4LQRA 3CL1A 4E4HA 5FPVA 1IG3A 3JBG3 2DTYA 2QZ2A 1UAIA 2VR4A 3MFAA 1WBLA 2WBKA 5JLVA 3RZMA 4JKLA 1E5SA 3LEGA 1U12A 3MV01 4HG6B 4CP2A 2A7AA 2WN2A 2D7FA 5C8CB 4I3PA 1MS9A 4AQSA 5FYZA 4XFAA 3UL2A 5JSOA 3DECA 4CDXB 5L36A 3OD4A 1W0PA 4HBNA 4QDQA 1HV1A 2RS13 2VGDA 3SISA 4HK9A 5J09A 3AKPA 1H1MA 2GAUA 2ZKNA 2MNGA 5L9BA 4FOYA 2GMPA 2YHJA 1Y4WA 1MS0A 5CFDA 1WWYA 3KM5A 1KGYA 4JDMA 1W6QA 1PM7A 4YVWC 5FLJA 5JMOA 3A22A 3U10A 2PLV3 4N9HA 2CYFA 3PNAA 1OKQA 4ZU5A 4XJZA 2E7TA 1YIPA 2WAAA 5JPNB 1GP4A 3H8OA 2WQ8A 1R1A2 3FHQA 5GLUA 1FNZA 1RUG1 4E2GA 4CA9A 1UW8A 2CDOA 3AL5A 4D6RA 1ZRDA 2P17A 1YFUA 4BYYA 5IK4A 3CHXA 3VHOA 5I0TA 4QXHA 1UO9A 5BNNA 3W5NA 4COVA 4JRLA 2A3WA 4D8MA 1CWPA 3D3AA 1W39A 4KL1A 3B00A 5ACA1 1CAUA 4MSVA 4IGQA 4URAA 2OW4A 4EN7B 2IXHA 2JIJA 3HAGA 5F8PA 3CEWA 3JU9A 5CKQA 3GXUA 1LHNA 2HBTA 3CMGA 1UYPA 2Y26A 4GD4A 4PF1A 3U4SA 2ZEWA 4IEVA 5G04L 4AGVA 5I91A 5IAXA 3PJYA 4LNVA 4AFMA 4EZHA 1BVP1 3CNAA 2YG0A 3WF0A 2D40A 2NZ9A 4JDNA 1ZREA 2PA7A 4J6GA 1RJ7A 1C5HA 1GOGA 1TEIA 2QTWB 2JENA 4QHBA 4XDOA 3VD3A 3VBUB 4C1XA 4CUBA 5LRSA 4QXBA 4XPVA 4CPBD 4QB2A 5LK5A 2VCMA 3A7QA 2G1MA 3WF2A 4ZU7A 3S5QA 3LAGA 1EV12 5EXOA 3T0AA 1XJAA 1C8M3 2YC0A 3FFQA 5SV5A 4JGZA 1F2NA 5CG9A 4Q4W2 1VRH2 1ZBA2 1CAWA 2RR11 2NMOA 1CPMA 3RYRA 1RUD2 5FBZA 4LTAA 4QDRA 1XNCA 3M3OA 4FAHA 5D21A 5FLHA 1C4RA 2VTFA 4XF9A 2VZPA 1GZ9A 5T5OA 1NUKA 1Q8VA 2OZ6A 1S0BA 5C4WC 3KB5A 3B5LB 1UF2C 4HPKB 2WYSA 1T2XA 1PGL1 3TAYA 3A0NA 3KT4A 3LB9A 2PN5A 3MLKA 2E6VA 3NAPC 5D1IA 4N8MA 1POQA 1ZVFA 2J1SA 3H9AA 3VHRA 4JQTA 4MGQA 2HWB2 1WCKA 2QQWA 1B09A 4O65A 4Q4Y1 1YFXA 2VOTA 1X8MA 1DBNA 1ALYA 3WZ1A 4CCCA 2EXKA 1WMFA 3FJSA 5EJ1B 1POV1 1PZ7A 3POEA 2XONA 2WINB 3EBRA 4QPIC 4QKDA 2IFWA 5E8AA 3S5AA 5F3IA 4YPJA 4LEJA 1UOGA 2D6KA 2OQ7A 1NX9A 1OPMA 3VBSC 1CZTA 1ONAA 1UY4A 4A6SA 2B7YA 4AI2A 1DGRA 4FBFA 1WLDA 2ORZA 1N3QA 4KU7A 1H0BA 1FYUA 1UPSA 1DGRN 2JWPA 2E53A 2XJSA 2OS2A 3MYXA 5FK7A 3DYMA 2YFUA 1CONA 1Y7BA 2YZ4A 4LKEA 5A7OA 5I8TA 2XLGA 1W8WA 3U75A 3FWEA 1L3JA 1TVGA 5EP9A 1LR5A 3LFMA 4HLTA 2GH8A 5LWBA 2XPJA 1BXHA 1ST8A 1XBFA 2XQRA 4DEVA 3AKQA 3Q8FA 1VJ2A 4A42A 1LHUA 2FDJA 3WDYA 3OPZA 5KXBA 4XOGA 1G9AA 2Z69A 2FD8A 5FZGA 1XU1A 1OLME 3B69A 5FXXA 4WVMA 5I8SA 3R6SA 1LHVA 4H7LA 1DQ4A 1W2TA 1EV13 5IVJA 2WRAA 2QQVA 4TN7A 1NOVA 2FQPA 1RUJ3 2VNGA 2LM3A 4XDQA 4LHNA 5LATA 4OMDA 1HIXA 1J83A 1SFPA 5ABJB 2WL1A 5I8YA 3W58A 2XLAA 3FLTA 1DGWA 1RUI1 4P5YA 2EAAA 3VBRB 1ZRCA 3AZYA 3CZJA 3ENRA 2JEMA 4G9SB 3WNNA 1PX4A 4RYDA 5FZEA 3CJIC 2YROA 3FBYA 2BQPA 2OIIA 5F32A 1I9RA 2JJ6A 5KWRA 4M0NA 2WFPA 4Y5Z0 1W6PB 3SH5A 2K9ZA 4F8AA 1O8SA 4OVEA 3TEZA 5GZCA 3ORJA 3GCXA 1OXCA 1XC6A 2B45X 3J8F2 1LOFC 3OOXA 4HMZA 2XBO1 3B9CA 2R073 1GWKA 4G3YC 4CDUA 5LEKA 1JZ5A 2DU1A 4M01A 5KHGA 1W9WA 2RS52 4IXLA 3VN4A 1F5FA 1HB1A 1R092 1KFUL 4DY5A 1EUUA 3VBSA 1PO11 3VDCA 1OOPA 1NQJA 4R9AA 5FWEA 5ABJA 1W6MB 3WF4A 5KR7A 4BQ5A 4IEOA 2PHWA 5C9AC 4QQLA 5D8AB 5FKCA 1W9FA 3WDWA 4MGYE 1VRH1 1ZBA1 3P3PA 5JPMB 5FYMA 1S1AA 2BEOA 2XMLA 2VOXA 2YDEA 4AI3A 4MHUA 2Q8DA 3WP3A 2EXIA 4AG4A 1CX1A 4QAWA 1AL22 1SZBA 2F6BA 2WNUC 4WM8C 1FPN2 4BMEA 1DHKB 4KGQA 4Q8LA 5FZIA 2A6VA 1IPJA 3NNFA 4R9DA 2ZHMA 3HOBA 3AMHA 4IEZA 4CCJA 5DABA 3LOIA 4QX3A 3RRDA 2Y6LA 1AXZA 1RJ8A 1CESA 2K46A 2C6SA 3MIEA 3ZXJA 1XNTA 5I0RA 4QWNA 4WM8B 1QWRA 3KD4A 3MICA 4YLZA 5ERLA 2DBNA 3VDDA 1NZCA 1W05A 3PUQA 1UY1A 5F2WA 4RHV2 5A7WA 1H2LA 2BNOA 2HEYF 2YPDA 4HXCA 4UFHA 5FY8A 1PM4A 2P3KA 3PTRB 3R4DB 4RQPC 4N53C 3HNYM 4ZS3A 1QJFA 2VJXA 3M3CA 4XUNA 3LFIA 4TLGA 2VZOA 1W2AX 2R043 5CBLA 3ZSKA 1HRI2 3X29B 3N9MA 5JXGA 1POV0 4Q0UA 1TME1 2B8MA 3POWA 4KQ7A 4Q4X2 1W3XA 1AYM1 3MI8A 3UGGA 3WNOA 5AFEA 5KXEA 1QY4A 2ZGPA 4FQZA 1R1A1 3RNSA 2A71A 4B1LA 1NQDA 2WZPP 1UU5A 2D5HA 4DPNA 1W28A 5IK5A 2W08A 1HXS3 1MS1A 1XE8A 5FPBA 2DVBA 2R072 3G7DA 4KG0A 2BPA2 4XFHA 2ID4A 1YI7A 1N3PA 2V73A 1NCRA 1RUC1 3OJBA 2QBXA 4GMP0 5C8CA 1CAUB 2JD4A 1JOBA 1QQP2 4AZZA 4CVUA 2ES3A 4DXZA 3CIHA 1C3HA 4GJZA 4CDXC 5D2AA 5FY9A 2VE1A 5LK7B 3PURA 3SNMA 4IV1C 3KWVA 3SHRA 5C9AA 4DB5A 3AYEA 2VL4A 4XIOA 1SHWB 1ND3B 3B94A 1KS4A 3NJXA 1RUF3 3ZVXA 4Y26A 3AFGA 5EJ3A 4AFAA 3HQXA 2VQ0A 5DAPA 3SLIA 4YW4A 1NYWA 4CUAA 2HBUA 1HV0A 3BOWA 3NQHA 2CU5A 4AW7A 3ELNA 4IV1B 1NLQA 1QKQA 3MF9A 1OLRA 4XXPA 3BUCA 3VZLA 4B4QA 4B7EA 4LO7A 4CSWA 4Q8KA 4BA6A 2GDFA 3J8F3 1FPN1 1AL0G 1C8M2 2RJ2A 2VOVA 2VXRA 3AKTA 4J25A 4A45A 1G9FA 3VGIA 1ZYBA 3OB8A 1AVBA 1V70A 3LDKA 4FT8A 5FZOA 4LE3A 5IVCA 4FO9A 2E32A 4OI4A 2JB8A 4H2AA 2PAMA 4NPMA 1ODNA 5ACA2 1E5HA 3WUCA 3I3BA 1OH4A 2E7QA 4OQ9A 4HKOA 2RS33 5DAVA 2HYXA 4QM8A 3SKJE 3U14A 1Z78A 3RSJA 1Q8SA 2WO1A 4ISRA 4PIXA 3ECQA 3ZDVA 3MGUA 2ZHKA 5FZ3A 4HVQA 4RFRB 2P3JA 4CE8A 4W6WA 4FTSA 5BNPC 4LBQA 1X9TA 1S0FA 1AR71 3P3NA 5T55A 5IATA 3AL6A 3AM2A 2W46A 5KHKA 3I3QA 1VMFA 2OUHA 1U5XA 3M1HA 1JYVA 3FN9A 3N4MA 1IPKA 2R6QA 3AMQA 3O0VA 4FP3A 3ZFFC 2WN3A 3LPGA 5DDJ2 2W1WA 5BNOB 4DUXA 1SG3A 3H1WA 3KS7A 1AL23 5FZKA 2EIDA 5CFDB 4LO6B 3O0XA 4KWJA 4U2AA 4YVSA 3UGHA 3BIEA 2W91A 5K8SA 4GULA 2LUWA 2O8OA 4XE9A 5A33A 1JUHA 2ZCWA 4UF0A 5LEJA 2VBDA 2XUMA 3BPSA 4FPCA 4S2HA 4CXYA 2ZEYA 1SBDA 3R0RA 1GNZA 3B7MA 3POFA 4FI9A 5EV7A 3BU7A 5HPOA 3ZFFB 1COV2 1HB4A 4MH0E 5T52A 1H1AA 1VAVA 2C9KA 1W8FA 3WP5A 4CDXA 3KCXA 3BTZA 1VBA1 3GJAA 3J7NA 4LUMA 1ND2C 4W50A 1PZ9A 1R093 3WDUA 3JBG1 4XBQA 1QXRA 4MUVA 1UY3A 1GQPA 5EHDA 5FTTC 3HN3A 3VZNA 1RUOA 3K4AA 5EJZB 1ZZBA 4XF0A 3JQXA 1GQHA 2BDRA 3HBZA 5FZ7A 5FZCA 3ZN5A 1OBNA 3RGBA 2ZMKA 1KDMA 2P3IA 4Q4X3 2PHDA 3LEMA 2J1TA 2WA4A 1ND2B 3WP4A 3JXSA 3M2MA 3M7AA 3NSTA 5IAVA 2L9LA 3F95A 2WR9A 4UFLA 5J36A 4X6QB 4Q0VA 1LGCA 2X5IC 3ABZA 2O14A 4P9GA 1RMU3 4PBOA 2XVLA 1BMV1 3GJBA 1FI2A 1DZTA 3N9LA 1TZOA 5CVRA 1F8VA 1LOEA 1WA6X 3NO8A 4OHVA 2ZJCA 3BU0A 3GGLA 5DN2A 5FY7A 3I59B 2GNTA 4NRMA 4ORFA 3IPVA 1HQLA 1UZWA 4NHXA 2GNBA 2YUEA 3BOPA 1F9KA 3I3DA 4RHV1 4XCBA 3ZN6A 4ZS2A 3AP7A 3V0AB 2RM21 2X5IB 3ACIA 5BNPA 3KCYA 1ZRRA 1PNFA 1ULEA 3N7MA 4L8QA 3K3OA 3GYDA 1UZYA 5KC6A 1SACA 3GDBA 4P5HA 2D3RA 4NAOA 4WV8A 3RFRA 2XKOA 3KHBA 3ZOIA 2Y34A 5JR7B 2DUPA 2W0XA 2QQOA 3JD73 4FFIA 3HBKA 1NAEA 2P5BA 4NHYA 5DQ0A 4CEYA 4AYUA 2RR13 5A80A 4L9BA 5LB6A 2WS91 2RM22 4M4RA 3WX5A 3ZN6B 1PZ8A 4E4SA 2D93A 3HNBM 4MXWB 3AP9A 2F4PA 3BIWE 1F35A 2XB6C 1OC1A 2XBO3 2XL9A 3H0OA 4K1YA 4UAPA 3ZFFA 2VVFA 3K4ZA 1ASJ3 3O7OA 1ZM1A 2BGCA 1QQP1 4GMP3 1LHWA 3MF6A 2OT7A 5C5UA 3A0KA 4DMIA 4JX0A 1BQPA 4AVBA 4K9SA 2N7GA 4OQ8A 5FPLA 3THDA 4AEDA 1JTZX 2ZHLA 3CJIA 2ZACA 5FBJA 3WNXA 3WSOA 1S0GA 4ZZ8A 1BK1A 1DG6A 1PGW2 1JXNA 4JVAA 1PMHX 5DAWA 1LODA 5IVYA 4L99A 1FMD3 1V6MA 1AL21 2PHLA 3N9QA 5DG1A 5AVAA 3JCIA 3U4XA 1ND3A 4AK3A 2JG8C 1K3IA 3GHNA 5F6LB 2I2SA 3ZMNA 1S2BA 2F4LA 1TG7A 2WNVC 4DRRA 2BBAA 1AR73 2JKBA 4GA9A 5K4LA 3FE5A 4B3NA 1VAMA 3JQWA 3MIGA 4QPYA 4LK7A 3LWCA 2P6HA 5JUVA 1O4YA 4NWVA 1UQXA 3FBMA 5LASA 5CKMA 2ILMA 3NNLA 1NCRB 3HVDA 2V5DA 4XHBA 3ZXKA 2YBPA 3KV5A 1RUE1 4L2NA 2R16A 5AVPA 2HEWF 3SH3A 4DY3A 2DBIA 5FDBA 3WDTA 5CFCB 4IDZA 4AL9A 4Q5OA 1WZXA 1Q43A 3AFKA 1HRI3 5FUNA 5FYTA 1MVQA 1V6KA 4RR3C 3ILFA 1EAH2 5KXCA 3POSA 2XBO2 2YMZA 3WG3A 4FOVA 4H3WA 1RXGA 2XJQA 2O1QA 4GQ7A 5F5IA 2Z42A 5BNNC 1ULDA 3SQOA 1DYPA 1KITA 1O4ZA 4A7YA 3ZSEA 4CDQC 3OYWB 1HRV3 5BNOA 2ZXQA 3LA3A 3JBG2 3I3MA 2W5FA 4AXOA 2HWF2 5LCWL 5LBCA 4CEYC 1WA4A 5EFUA 2YC4A 3IM0A 4AE2A 4CU8A 3C3VA 4BK5A 2F17A 5GKAC 4XUPA 1COV1 4Q29A 3MPBA 1OFSA 1PIV3 2OUJA 3H1YA 1HX6A 3NW4A 1R083 2UURA 2ZKLA 4C90A 4LIVA 4AEJA 2VNOA 1JI6A 4BB3A 4YYOA 1REFA 4DXSA 2ZEXA 4SLIA 4E27A 4Z8BA 4Z82A 3N7JA 4ZXKA 3FLPA 5C8CC 4H55A 4CCLA 4J1XA 5JSRA 2A6XA 2E9QA 3CQOA 5B4XA 2ZZQA 4PHZA 1N1VA 2JE9A 1UY2A 1JYTA 4IV1A 4OULA 2VZTA 4QKFA 1AHSA 2D98A 3AYAA 1G7YA 2MEV3 4Y20B 4YFZA 3KV4A 4OYUA 1V9U2 3UT0A 1FX5A 1NG0A 2V5YA 2VBBA 2WKKA 3MIFA 4NAMA 3WF3A 4NHLA 1BVVA 3GM8A 3ZSJA 1YYNA 3OBRA 2GN3A 1ZZ8A 1FXZA 2W87A 1J1LA 1W8UA 5FIXA 2BP6A 5A7WB 5BYNA 1LB2A 2Y6KA 2WS93 1VBB3 2D3SA 3QACA 2WWUA 4AAXA 2LROA 2CWMA 2VMDA 2W1QA 4V2VA 4YZ5A 2H0BA 1YXWA 2VZQA 4EQVA 3RZKA 4RGGA 4GH4C 1ND3C 3TNPB 1V9U3 4N7IA 5CYYA 4W6XA 2WNVA 4BCUA 3O1PA 5A6XA 2OQ6A 5J1XA 5A3MA 2X29A 3AZWA 1JYNA 3K51A 1MS5A 1BK0A 3SXWA 1S0IA 1SLIA 4QX8A 5ANNA 5BNOC 4A7KA 1QJEA 1DP0A 1YC61 1FMD2 1UWWA 4X8PA 1NLRA 5FZ1A 3HPNA 1W8ZA 3J7MA 1SDWA 2RDNA 4KBZA 3H3ZA 4BQ3A 2Y6FA 3LQCA 3RZZA 3E5QA 5T5JA 3VBFB 4NROA 2HWD1 4FPJA 3SEPA 1XYOA 1IHMA 3DPRC 1WLCA 3MIHA 1VBE2 5JZGB 2R042 2C5DA 3OGJA 4XETA 5F3EA 5FAXA 4CDQA 3J4UH 2HWE1 1XRUA 2ZGQA 4QX7A 1EPZA 2R0FA 4NIIA 1JZ3A 2FDGA 3OEAA 1F4HA 1QF3A 5K0UC 1JZ4A 2XWBB 1NCQC 4NPLA 2FMYA 4QT6A 5CZKA 4B4PA 3USUB 2QDRA 1PGSA 5LY1A 1ZA7A 5IUQA 2E63A 3DEMA 2ZX0A 2VD7A 1P8JA 2E26A 1HQWA 3RS6A 4WM7A 4NRPA 2J7MA 1S0JA 4FPYA 4MGKE 3KT7A 3VD5A 1PGW1 5KXDA 3GZEA 3JB4C 2I07B 2KM2A 1PHMA 1ZBE1 4EWEA 4ZHNA 5K0UB 2GU9A 1S0CA 1QJY3 1UZVA 3M70A 3V65A 3VBRA 5JXJA 3ZXAC 1F4AA 1YI9A 2YYOA 4I30A 1QOSA 1UMZA 3DGTA 3PHMA 3VUOA 2FDKA 4EWAA 5BV6A 2PXJA 2PAKA 4Q4V2 4XVHA 3VKMA 1US2A 3OBTA 2P4EA 1NKGA 1AYN1 1RUJ1 1CGPA 5TSWA 2VNVA 4Y24A 1CJPA 1HJGA 4UW3A 1D4M3 1X8EA 2A70A 1RINA 1N1YA 1UL9A 1K5JA 2FCUA 3ZYBA 2B9VA 4P08A 2BGOA 2DCZA 2G9GA 5GLTA 1MZFA 1TE1B 5JI9A 3KZ4C 5CFDC 2IWGB 5CKNA 3NV3A 4YVWA 5HCFA 5JWPA 2JE8A 1ZX5A 4LBMA 5FWJA 2ZX2A 3J9SA 3I3EA 1O6UA 4MV2A 4MVTA 5C4WB 2DFCA 3I4IA 5L7OC 1HN1A 3MBWA 4GH4A 2FDFA 3S57A 1D2QA 3AXDA 4XTPA 1S2EA 4W6YA 1L7LA 1HQNA 5FYVA 3BALA 5A32B 5BUVA 2QNKA 3OY8B 3PUHA 5FXWA 3VD4A 1CAWB 5FO7B 5C3SA 5C3OA 4DOUA 5K7PA 4YW5A 4FPFA 2HLEA 1J3PA 1OA2A 4QKNA 4W65A 1W3VA 5JZGA 3DPRA 3RG0A 4CTEA 2I74A 3JD71 2P37A 4L11A 2XJUA 5C5TA 2R30A 3ZR5A 2ZOEB 3KVBA 2SBAA 2D6OX 3DXUA 2A1XA 2Y38A 1UKGA 2KXLA 5JXIA 1YLLA 4D7YA 3JD72 3BVCA 3VBSB 1XE7A 3VBUA 4CCOA 2QQIA 1R091 5DAQA 5K0UA 5J48A 1EAH3 1VMJA 4WVMB 1L7RA 1MQTA 3CF6E 3NV1A 3VZJA 4CEWA 4AI0A 1MEC1 1RUF1 2QQUA 5A32A 3LOBA 1VBC2 5ANQA 5JMCA 2ARAA 1QJX2 1VBA3 3ZLIA 2QCSB 3VBOC 1LJ7A 5FMBA 5FUPA 2RHPA 5F3CA 1UXXX 2V4AA 2WUHA 2WNVB 5DUVA 4N43B 2WABA 3OPWA 1JZ6A 3PLQA 5FPUA 1NZIA 3DUIA 4FPLA 1C1LA 3GCWA 2CWSA 2O8QA 2XVKA 3IN9A 3ZXEA 2GMMA 1PIV1 3UNPA 4Q0PA 4WVZA 4QX2A 1FV2A 2Y8KA 3W21A 5BY5A 1ULPA 2P34A 2VULA 3RWKX 5LA0A 1ZBE3 3J26N 4Y20A 3U0ZA 1W6QB 4Q4V3 1YEWA 4WZCA 5AC92 4QQPA 1DQ6A 2BNMA 1U5YA 2P1BA 2MEV1 2RV9A 3RYPA 4BE3A 5C3RA 1XXNA 1RIRA 3TEYA 1ENXA 2JG8B 4IGPA 1WW6A 2R063 4LBKA 4OUEA 4DNYA 1B35C 2W1SA 5D8AC 4JTNA 4Z1VA 4I09A 2WLPA 2JIGA 3VKOA 1C57A 2BNNA 1SCSA 2VUJA 3ZXGA 2CHHA 4IE4A 1HLCA 1PMJX 1TMF2 2ZX3A 5APAA 4HN1A 3H3UA 3WDXA 1QJZA 2JDZA 2DTWA 3VZKA 4BPZA 4PLMA 1H9WA 5A3PA 1AR61 3WNLA 3CZUA 5GZEA 4JGZB 3T08A 4P14A 4FXGB 5CISA 3H7JA 4DXTA 4XFGA 3VHPA 2X53S 1QU0A 4RR3A 4D7SA 4LBJA 3AP6A 3ZYRA 2BUKA 4CZSA 1JN2P 4NIDA 3ZYGA 1MS3A 3B01A 3I2DA 3OUJA 4YG3A 3N36A 4P00B 3W20A 4AEDB 4D7TA 1YQ6A 4PF5A 1MACA 1RC6A 5KHJA 3WP6A 1FMD1 3E5XA 1UZZA 4K1ZA 3T2PA 3P1IA 3T0DA 2CAUA 4NOTA 5C3PA 2VMCA 1E5RA 4WBBA 4Z92B 1GP6A 3EB7A 1AZDA 3WINE 1R1ZA 3AJZA 3PUAA 1LENA 4QD2A 3N9PA 4V1PA 3GHMA 1MQTC 4CEWC 2WA3A 3ALQA 2QKDA 1TQ5A 4X6RB 3O14A 3ACFA 2ZPXA 5JR2A 4IEQA 2VZRA 2E31A 2E7AA 4CU9A 4PCRA 1X36A 1H6YA 2WC2A 1RUC2 2JX9A 2WFF1 4J1WA 3J7LA 4R4XA 3ILNA 5BNQA 1D0GA 1APNA 4AI1A 1VIWB 2WYFA 1RHI3 3ZKUA 2ZGNA 4QX5A 1Z7S3 1OMIA 3TEXA 2DCKA 5BXXA 5FYCA 4I0AA 1LULA 1RUF2 1YWKA 4XMAA 1LAJA 2PFWA 1MPXA 4TZDA 1LOFA 3AMNA 3S6PA 1HRI1 1GZTA 1K5MB 3AVSA 5B4NA 1NA1C 4YNIA 4Y5TA 4NIGA 2QDNA 4YZ1A 3KQ4B 4PLOA 3RWNA 1POV3 5F9TA 4JKMA 2Y6HA 3LZZA 4C1WA 1REDA 4LA3A 2QJVA 2NN8A 4UBHA 2UWBA 1Z7S1 1UOFA 3ACHA 3LEKA 3JB8A 3MW2A 1LTEA 1RUNA 4BQWA 4S2DA 4ZU4A 3N7LA 4I02A 4DINB 3KV9A 1UYXA 1OPOA 4PDWA 3ON7A 3AMMA 3GZUC 3H7YA 4CUCA 5J3UA 4IETA 4X8NA 3KF5A 4XF3A 1OLMA 1WD3A 2WWJA 3GBFA 4E8CA 4EROA 5FY0A 5FP7A 2XH6A 1DLLA 1J84A 2BVVA 4KGGA 3NNMA 5EQUA 2XOMA 1G9BA 1NLSA 3IKWA 3K75B 3ZDSA 1I6XA 3ZYFA 1PK6C 2V09A 3POIA 3POYA 1QH7A 5BNPB 3I54A 4QHZA 4Y33A 3AP5A 5DPNA 2MHFA 1LGBA 3ZYIB 4BOWA 2EXHA 1IOAA 4BXSV 5T5PA 4A2UA 2YBKA 1O5UA 1YHFA 2ATFA 1U5ZA 4OHWA 3Q8CA 1OUSA 3EQEA 3NJVA 5FPZA 3PTYA 5F3GA 1LESA 1QNWA 4EZ4A 2YY1A 2GH2A 5E1RA 3I2GA 3IBMA 2RJKA 1W6OA 2Q1FA 2HWC3 3LSDA 4WVVA 4Y1ZA 4K6BA 1RVF3 3URFA 1W6NB 3WNKA 1NCQB 3C7EA 1X33A 3RZJA 2OA2A 3T30A 3ILRA 1IS5A 1IQAA 1D4M1 2CSGA 4XQWA 4MGTA 1K12A 2WT1A 1ZA4A 1LNSA 1ASJ2 3WR0A 1VBC3 1AYN3 4XJUA 3TNQA 4PI2A 3C7GA 2DVDA 1F5JA 1R081 2AZ5A 4UT5A 4PQ9A 4YZ4A 2AYHA 3IIAA 3TN92 4SBVA 5L9RA 3VBFC 5L19A 4K40A 4HKWA 1RVF1 1PO21 1BBT2 1I5ZA 1UX7A 3HT1A 2HWC1 1QQP3 4GMP1 2GC2A 3BODA 3V0BB 2VZ3A 1ODMA 2R1DA 4INDA 4GWIA 3IWZA 3MFCA 4UBGA 1N47A 3NKGA 1DIWA 3IAPA 1HDKA 2BFUS 3FHAA 1W9YA 5G05L 5JCTA 5A3UA 3OGSA 3NV4A 3LA7A 2ZGTA 4BLIA 4EE2A 4M0HA 1FPN3 1XB9A 2R32A 5A6ZA 1ZBE2 5T50A 2YGLA 2W47A 3OGRA 2KR2A 2LS6A 3R4SA 5FRAA 1N1TA 3BPZA 2WZR1 5FYBA 1TNFA 2UYBA 2W95A 5LA2A 4Z2WA 2GP5A 4NJ4A 2OKXA 2HWD3 4MADA 3DKWA 3OGVA 4QPIB 4XFIA 1CX4A 2BRTA 4P02B 3KLSA 2C0ZA 4HKLA 2LTNA 4Z07A 1DQ1A 4TSVA 3AKRA 4RSUA 4CCEA 4DFSA 5FCCA 4PDWB 1JW6A 3HMYA 5EZWA 2VG9A 1V0AA 5FO8B 4MG2A 4Q4Y3 2BW8A 1C8NA 4JGYA 4NVPA 5IYYA 4GB31 3VL9A 1MEC3 1QEXA 1J3RA 5A7SA 1W6OB 2RMU3 4JDOA 4RGKA 1SLCA 2R1BA 2RDRA 5FZOB 5HV4A 1HJFA 5H9RA 3KGLA 3BYWA 2VM9A 1JYXA 3SCGA 2PLV1 2CGOA 4MGZE 4Y22A 1V9U1 3PVEA 2PHTA 4BU2A 2WQZC 5A33B 2VY0A 1GUIA 4LO5B 3N3HA 1TME2 1NT0A 3T2TA 5JXHA 4YM0A 2IZWA 1QJY1 4BISA 2XVGA 1FNYA 2QFEA 1RHI1 2D6MA 3FC0A 3MLJA 3TRSB 4HZFA 4PQQA 5FR3A 3ATGA 5C6CA 1QGLA 1DYKA 5IW0A 3P6BA 4QX0A 2DFBA 3T4VA 1O8PA 4HN0A 3QCWA 2X09A 2QQJA 3RMYA 1W06A 1DU3D 3WCSA 3RI9A 2DCTA 4AFCA 3LIHA 3H1MA 5FMCA 2HYKA 4IEPA 1STMA 3WCRA 4NR1A 2RS12 3SH4A 2A5ZA 1DGLA 3ZIXA 1OQEA 2XJPA 5A7PA 1PIV2 4CCKA 5FY5A 3PIGA 2AUYA 3VV1A 5A7QA 5DUXA 1F15A 2VC9A 1AR91 3DV8A 4CRQA 2LRPA 1SLBA 4DZGA 4LULA 4XURA 4K8RB 3LE0A 4YW1A 2XDVA 5FYIA 4LOTA 5FZ9A 3BTYA 4RHV3 3HQRA 2YB7A 5IK7A 5ACA3 2PHFA 1OOPC 4N43C 5DZFA 3T1LA 4BIOA 3GZTB 2QZ3A 4ATFA 4HOOA 3PUSA 4LMFA 4DO0A 5D8AA 5FPXA 2WNOA 4Y1VA 5JOWA 3T4HB 4IERA 2DUOA 2ENRA 1YQ2A 2JE7A 4RR3B 4UFKA 4AR2A 2TUNA 4CPBA 1OD3A 1G86A 4LXLA 3VZMA 1ZRIA 3LIGA 5GLVA 1PO12 1RUG3 1VRH3 1ZBA3 4LBQB 1QJU2 4L92A 5JOYA 5HCHA 5C9AB 5J37A 2JICA 3FUQA 3VD9A 4WM8A 3OY8A 4A6OA 3LSEA 1JOJA 4LE4A 4Q27A 3RDIA 2J1AA 4LUKA 1CAXB 4C0HA 3D6EA 5SV8A 4AEKA 1V6OA 1JZ2A 4UW4A 3CLPA 1AXKA 1UY0A 4UFIA 4KU8A 2Z4FA 4FAGA 3PUIA 4ZY9A 2VNRA 1ASJ1 1VB4A 1B35B 4PJYA 1GOHA 4IE7A 1YQ5A 4YGCA 4NUBA 1BJQA 2ZAAA 4FCAA 1Q5OA 4B7KA 4Y3OA 1XNDA 1JYIA 2D44A 1W8OA 4Y4YA 3LDRA 5LY2A 5FYHA 4MYEA 3ETPA 4AOCA 1D2SA 1FAYA 2AGSA 3LGRA 3OF1A 1AYN2 3N35A 5FMOS 3GBWA 4FSJA 5GALA 4N90A 2VOKA 2WNEA 4Y4RA 3PVOA 1URXA 4DEQA 1OH3A 2WZEA 4Q4W3 1H30A 1WCQA 4UW5A 4F83A 3O1OA 3JUUA 5K9YA 1W6MA 2J22A 2UU8A 4EV0A 4JGZC 3IMNA 4N53B 1QDOA 1F31A 3WY6A 3ZR6A 1WLWA 5I93A 2G4IA 3VDDB 4R52A 4IEWA 5AC93 3AC0A 3ZFEB 4YZ2A 2A6ZA 1NA1A 3ME2A 4K7JA 4YGBA 1QNYA 4AQ6A 4WM7B 1US3A 5KHIA 2CV6A 4EN9B 4Z2AA 4A44A 4AVVA 1IG0A 1GZCA 2DU0A 4AEDC 3UJOA 4M3CF 1RMU2 5C4WA 4BQ1A 1LECA 4K8FA 2LW8A 1M4WA 1MS4A 3UK9A 2BV4A 4IW3A 1EAH1 2R071 1DZRA 4Y5SA 1W6PA 1TME3 3C8XA 1HB3A 5LA1A 2ET7A 3E1F1 3NAPA 1CVNA 1GANA 2ZS6B 5FMOL 4B4RA 1AYM3 1NA1B 1O5LA 4RL7A 2JG8A 1K45A 4XZUG 2IFRA 1MQTB 3AZZA 4CEWB 2HKXA 5L73A 1BEV2 1YRZA 2R041 4IGOA 3OUIA 4MLOA 1UU4A 4ES8A 1VP6A 2HJIA 4JHZA 4F3JA 2CDPA 4HT1T 3KHCA 3WUDA 3T0BA 1U0AA 3AKSA 1LU2A 2VPVA 3AZVA 4YW7A 3I49A 2H6BA 4UOJA 1O7FA 5A3NA 2QQPA 5JAXA 2Q1MA 1IS6A 5L7OA 2CL2A 3GNEA 4AAPA 1H2KA 3WD5A 1M06G 1VBE1 3C7OA 2Q8OA 4R9BA 1PNGA 2GC3A 3VKFC 1H8TB 3ZPOA 2XR4A 1SFNA 4M4PA 5A3OA 4GH4B 4DIQA 4WVWA 1QXPA 5JZGC 1RYYA 4BZ4A 1XU2A 4XW3A 4KBBA 2O0OA 2VUAA 3PJQA 3MW3A 4YVWB 3ZSLA 1ENRA 4P9LA 2VCBA 2EIGA 2EAKA 3VKLA 3UJQA 3GF6A 4ATEA 5C71A 2X05A 3U1XA 3VBUC 3WDVA 1O3RA 4QB1A 4AI8A 4QU1A 1QJX3 2EF6A 2BERA 2ADDA 4UWDA 5FP9A 4LO8A 3VBHB 4META 2D3PA 2ARXA 1EV11 5FJKA 2ZTNA 1OURA 1AX1A 3HWJA 3MW4A 3PU3A 3VBFA 4OI0A 1W0NA 4EJRA 2AC1A 4RQPA 4XUOA 3ZN4A 4QPWA 2ZABA 1C28A 3DPRB 3O5SA 2PYTA 4JQRA 1QJU1 3MIDA 4NE9A 5GZFA 1YNAA 1SEFA 2DUQA 1UKRA 3VZOA 5KC5A 2BBVA 1H4GA 2PQSA 2NP0A 5C70A 1H2NA 3IIIA 4A3ZA 2VW2A 4W4ZA 1WGPA 3DN7A 4YWAA 1PO22 1I5PA 1KD7A 4AEMA 1O91A 3EYPA 3I2KA 4MGIE 1JUIA 4OUMA 3TN91 4CDUB 3UETA 5AC91 4N7UA 4Q0QA 4XAEA 5FLIA 2AEYA 4XXAA 5F6KA 2OZJA 4XAAA 4B8EA 1UPIA 1ULGA 4CU7A 3FLRA 4HSJA 5CEHA 4LT5A 2NMNA 4XJ9A 4RA0A 3IT8A 2MPFA 2WO7A 2LALA 3BTAA 1X50A 2VQUA 1ZZCA 2YFZA 1GMMA 3IDAA 4P9IA 1Y9GA 1ENQA 3RPQA 2GP3A 1C5IA 3K3NA 5L7OB 1V00A 3RQ0A 4PBPA 1JS9A 3OEBA 2NQYA 3RZHA 4AGGA 1GU3A 2BOIA 5FPAA 3D5OA 3ZXFA 3AB0A 4LKSA 4QQ2A 4EN6B 5DMYA 1RTVA 1EUTA 4OCTA 5IVBA 1V6JA 2JB4A 1G6NA 4IE0A 1HRV1 4C91A 4ASMB 1VBD1 2XJRA 4JGYC 5F7UA 2Z5WA 3KGZA 4LKFA 1RMU1 4GZ9A 3ST7A 2Q1ZB 5AFBA 1REEA 1O3SA 2RS53 2XHNA 3PMSA 4E4ZA 3O1TA 5T54A 1U5IA 1MEC2 2A75A 3NAPB 4NMIA 4YM1A 4YGDA 5DZEA 3UESA 5GM0A 3F2ZA 4B29A 5CFCA 4HPKA 4I2OA 2FZ2A 1DGWX 4ZZ5A 1QIQA 2XJVA 4QPGB 3USUA 1SPPA 5E89A 2BZDA 4JGYB 1RUE3 1V6IA 4QB6A 1W8NA 2FMDA 4YRDA 2PLV2 4CP1A 4IE5A 3NVCA 3LKJA 4YW6A 1N3OA 3Q9OA 3J7HA 3O1VA 1TMF3 4YW2A 4EN0A 3ZSMA 1UU6A 4HANA 2ZX4A 4N53A 4ZPIA 1OVPA 2J1EA 2YGMA 1PMIA 2AACA 2JG9A 4GKYA 2WJSA 3WW1A 4YSFA 3I8TA 1SLLA 1VBB2 2FBEA 3TBDA 3BKZA 4E2SA 1FT9A 2A6WA 2QQMA 3AYCA 3IAQA 3CJIB 1WMDA 2FHRA 2G9FA 4FPKA 5T5LA 2HWB1 3K4DA 1MVEA 1VMHA 2R7EB 1JHJA 2WWSA 2ZEZA 1KEXA 2UY8A 3E6BA 4GJYA 4LOSA 1YUDA 2ZGOA 4AGRA 1IGOA 1OF3A 1D0HA 1HXS1 2C9AA 3H3LA 1PVC3 3T09A 4TTGA 1LOCA 1NCRC 3MO4A 4ISQA 2CTVA 2I45A 1XSRA 3D4KA 3PIJA 5IWFA 3V0BA 2PTMA 3PDQA 2VW1A 4NN0A 5CG8A 4OI2A 2HWD2 4P9JA 1NY71 1C8M1 4XCAA 1CIWA 2JDPA 2ZAHA 4XC9A 3VKNA 3WF1A 3IDCB 1EPWA 1LRHA 1GWLA 2DF7A 2WT0A 4LBQD 4YGEA 3ZYPA 1MZEA 1A8DA 1VAKA 2VZ1A 3PL0A 4M3CE 3WQ1A 4XMIA 2QQNA 4YM2A 5H9PA 1W04A 3IB3A 3RMXA 3WQBA 2WDBA 2XQXA 2SLIA 3I2HA 4PI0A 2QUOA 5FREA 2XXZA 1A78A 5IT6A 4TYSA 5FZBA 3WHTA 3ES4A 1O59A 5J96B 2JDYA 1O3QA 1AYM2 2E33A 4PIZA 3INAA 4Q0SA 4WZFA 3T2OA 2B5HA 2ZGUA 2UWCA 2WNUB 4LHKA 3KCCA 4Q1PA 1AXYA 2ZHNA 4GB33 2DCYA 3AK0A 4Y22B 4E4DX 4B1MA 1KQRA 5IJRA 2ZX1A 3S7IA 4BK4A 3POGA 2JDUA 2XKPA 3U11A 2RR12 4BWOA 4XZPA 4KWKA 4AWDA 4GWMA 4COYA 2Z2SB 3ZFGB 2DCJA 3SITA 4XTMA 4ONUA 4MZUA 1NE6A 2Z79A 1PK6A 4L0PA 2B4KA 1XNBA 3ZFEC 1AR63 1BYHA 5BNNB 3W5MA 2JG9C 3E97A 4G4FA 4OI1A 5CAZA 1O3TA 4XACA 1SQ4A 1T6BX 3AYDA 5HV0A 1R082 3A23A 5IFPA 4Q4Y2 1RUC3 4ARXA 4ZKTB 1NXMA 2GC1A 5F39A 2AENA 5FP4A 3ZPYA 4AHWA 1WW5A 1LKNA 1NE4A 2A6YA 3OYWA 4D6QA 3ZYHA 3HJRA 1QOTA 2UY9A 1VLNA 2VXJA 2PELA 3DYPA 4JHTA 4YVSC 3THCA 2R061 1LGNA 2FCTA 3ETQA 4IV3B 3OTFA 5FUIA 2DURA 2P6CA 1IKQA 1UOJA 3AJYA 3I2JA 1HRV2 1UZ0A 3RZLA 4KG8A 2W92A 4QQHA 3BGAA 3I59A 2K0GA 1S2KA 2Q30A 2X10A 1WMXA 2BJSA 3B02A 3WG4A 4QU2A 5CA6A 5J98B 1UCXA 4IE6A 1W8HA 4GKXA 4XQDA 3DKQA 1ACCA 2IC1A 4M00A 5DG2A 4YVSB 3LD8A 4AVCA 5IK8A 4O9GA 4IV3A 4LBLA 1Q3EA 3WG1A 2TBVA 3GBGA 4FFFA 4GALA 4GIQA 2DVFA 4LBOA 3L2HA 1ZRFA 1H8TC 1BBT1 1UN1A 1VBC1 4ZONA 1VALA 4YW3A 4CCDA 3SCFA 1I1EA 1CIYA 1XPWA 4ITCA 1RUI3 4IUGA 3U37A 3UYJA 2D6PA 2KA3A 5IVVA 4QMAA 5ISLA 1W8TA 3V64A 4QDSA 1KJRA 1AR83 4XF1A 3LDBA 1UD1A 4C0BA 4HETA 3OSDA 5JI7A 1AJKA 2RM23 4XJAA 2JDMA 1SMVA 4ET7A 1MZ6A 1T6GC 3H42B 3MZHA 1W2NA 5EYXA 1NXD1 1VPHA 1W6NA 1OUXA 4LLFA 3S7EA 2X5IA 1RB8G 5HBAA 3MIBA 3EXUA 4UI9L 1H9PA 1RXFA 1RUI2 1WKYA 2E51A 2XWJB 3ASIA 5HCBA 1K5MC 5M0TA 3AMPA 3BI3A 2VO5A 2D97A 5C33A 1CD3G 2EALA 4XUQA 3WLUA 4KNCA 5JIUA 4O61A 3AZXA 1BHGA 2W3JA 2Q4SA 2Q8CA 5DXDA 2YU1A 4P9XA 2GZWA 1OD5A 2JDKA 5FYSA 5CB7A 1JU3A 1Y3TA 3KMHA 2EICA 4XJ8A 1V6LA 4XHXA 1BCXA 1GWMA 2ORXA 4CCNA 5A7NA 2A73B 1A6CA 3SCHA 2VZSA 1PO13 1RUG2 4E2QA 1CR7A 1HKDA 3O1UA 2XG3A 1WBFA 2ZGMA 1OFNA 3PU8A 1AR72 2A3YA 4FVVA 1WLTA 3AXEA 4Q2FA 2JKXA 1UIKA 2ZA9A 2ZGRA 3NMBA 2ZGLA 1W2OA 3CBNA 1S0EA 4KMQA 4CP9A 3M3IA 3O0WA 3WW4A 4LIUA 5L9VA 2J1RA 5FP8A 3VBHC 5IVFA 1NCQA 1PK6B 2QQKA 2OPKA 3LPFA 1R64A 3E6CC 5FO9B 2VUDA 3B93A 4QPGA 1GV9A 4RFT0 2R062 3D8CA 3KVAA 3AP4A 3C2UA 3N9NA 4R4ZA 4LK6A 4QX1A 2WS92 5LBEA 5HI0A 1JH5A 1LOAA 1RITA 2DYCA 1OI6A 2OPWA
chains in the Genus database with same CATH topology
1CZVA 1GUIA 1KGYA 1UMHA 5JXHA 5JMOA 3A22A 2WAAA 2ZXQA 4PQQA 1D7PM 4MOAA 4E8DA 2W5FA 5LCWL 1UYZA 2WQ8A 3P6BA 3FHQA 4QX0A 2YC4A 1O8PA 2X09A 4CU8A 2QQJA 2CDOA 4BK5A 4XUPA 4OZOA 3W5NA 4D8MA 3D3AA 1JI6A 4DXSA 2ZEXA 3GXUA 3CMGA 2VMEA 4PF1A 2ZEWA 2VC9A 5G04L 4XURA 3LE0A 1GNYA 2YG0A 3WF0A 3CQOA 5B4XA 2YB7A 1GOGA 1UY2A 3VD3A 4CUBA 2VZTA 3ZM8A 4OYUA 1JZ8A 4QB2A 3A7QA 3WF2A 1YQ2A 3WF3A 3WNPA 3GM8A 3T0AA 1OD3A 2W87A 2Y6KA 3VDAA 4AAXA 2W1QA 2VMDA 3VD9A 4A6OA 2J1AA 2VZQA 4QDRA 2W9XA 1JZ2A 3C7HA 5CYYA 2VTFA 1UY0A 2VZPA 2Z4FA 1NUKA 5J1XA 3PUIA 4ZY9A 2WYSA 1T2XA 1GOHA 1JYNA 2J1SA 1DP0A 4MGQA 1UWWA 1W8OA 3HPNA 2VOTA 1GOFA 3ETPA 4DUVA 3LQCA 5EJ1B 4DUWA 2XONA 4DEQA 2WZEA 1WCQA 4YPJA 3SEPA 2J22A 1NX9A 1CZTA 1UY4A 3VDBA 3SEEA 2C26A 2ORZA 3AC0A 2DDUA 1US3A 1JZ3A 4Z2AA 3DYMA 2YFUA 4A44A 3OEAA 1F4HA 1JZ4A 1K42A 5CZKA 2LW8A 1TVGA 2Y6GA 1JU4A 3C8XA 5LA1A 4DEVA 3E1F1 1P8JA 2E26A 4A42A 3I2IA 2J7MA 3VD5A 2EIEA 1XNAA 1K45A 4XZUG 4OMCA 2J1UA 3MV11 5JXJA 4JHZA 1H6XA 2CDPA 1F4AA 3T0BA 3FL7A 2QQLA 2KD7A 4UOJA 4XVHA 4OMDA 1J83A 1US2A 5IHRA 1NKGA 2W1UA 4P5YA 3CZJA 3C7OA 3WNNA 1PX4A 4RYDA 2B9VA 4P08A 2BGOA 4M4PA 3CDZB 1O8SA 1RYYA 1UYYA 4ARYA 2JE8A 1XC6A 3I3EA 2Y64A 2VCBA 1JZ5A 1HN1A 3MBWA 3I2FA 5C71A 1W9WA 2X05A 3VD4A 3PUHA 3DYOA 4QB1A 4W8JA 2HLEA 2BERA 4XUTA 1EUUA 3VDCA 4PT6A 3WF4A 1W0NA 4XUOA 3VD7A 5JXIA 4QPWA 1IQDC 2QQIA 1L7RA 4BJ0A 2PQSA 5I0DA 5C70A 3IIIA 4A3ZA 4AG4A 1CX1A 4QAWA 4W4ZA 2JD9A 1I5PA 3EYPA 3I2KA 3OBAA 3UETA 3HOBA 3CKHA 1UXXX 2WUHA 4CU7A 4TXWA 4QX3A 2WABA 2Y6LA 1JZ6A 3NNGA 4ZXEA 2VQUA 1XNTA 2YFZA 3IDAA 1GMMA 2BGPA 2C4XA 1UY1A 3UNPA 3SKVA 3MUY1 3OEBA 4QX2A 3HNMA 4MGSA 2Y8KA 3HNYM 2VJXA 1GU3A 4XUNA 5DMYA 4LKSA 1ULPA 2VZOA 2YC2A 1EUTA 5LA0A 1DLCA 1W9SA 5JXGA 5F7UA 3WNOA 2RV9A 4GZ9A 4OUEA 2XHNA 2W1SA 3UESA 3F2ZA 1JYWA 4ZZ5A 2ID4A 2BZDA 1PMJX 2QBXA 4QB6A 1W8NA 4CVUA 4KI5M 3CIHA 3WNLA 3CZUA 3J7HA 3HEIA 3T08A 2VL4A 1SHWB 2WAOA 4GWJA 4DXTA 1JZ7A 3NJXA 2J1EA 4LPLA 2WO3A 4LHSA 5IFTA 4CUAA 3NQHA 2QQMA 4P00B 3K4DA 2R7EB 3T2PA 1JHJA 2ZEZA 3P1IA 1KEXA 4A45A 2RJ2A 3T0DA 2VMCA 1OF3A 3EB7A 3OB8A 3T09A 4TTGA 2E32A 2VCAA 3MO4A 3ACFA 3I3BA 5JR2A 1OH4A 2VZRA 2E31A 4A41A 2HYXA 3SKJE 4A4AA 4CU9A 1H6YA 3WF1A 2WO1A 3ECQA 4D0QA 2VZ1A 2QQNA 3IB3A 3WQBA 4DXRA 1L7QA 2WDBA 2W46A 2XQXA 4MO3M 3NRUA 3I2HA 1JYVA 3FN9A 2DCKA 4DUXA 2WN3A 3LPGA 2JDAA 2W1WA 2V4VA 1SG3A 1O59A 1MPXA 1ULOA 2E33A 2EIDA 2VZVA 3T2OA 5B4NA 2W91A 2ZEYA 4FI9A 2Y6HA 4JKMA 5IJRA 5HPOA 4BK4A 2C9KA 3ACHA 3LEKA 2DCJA 3I97A 4KWUA 5A1AA 4W50A 4L0PA 2EIBA 2B4KA 1UYXA 1UY3A 1GQPA 4CUCA 3W5MA 3HN3A 3K4AA 5EJZB 2WO2A 4E8CA 3A23A 5IFPA 4RN5A 1J84A 4ARXA 2XOMA 2J1TA 3K75B 2WZ8A 2V72A 3JXSA 3K77A 2L9LA 3HJRA 3DYPA 3THCA 3A21A 5DPNA 1DYOA 2RVAA 5FUIA 4CU6A 3I2JA 3ABZA 4BXSV 1UZ0A 3LEIA 2W92A 3BGAA 5HXMA 2X10A 1CZSA 3NJVA 3WEZA 3GGLA 5DN2A 3I2GA 3I3DA 1OT5A 5EIYB 3ACIA 3WNKA 1W9TA 3C7EA 1OF4A 3OG2A 1SDDB 1CIYA 1K12A 1XPWA 4IUGA 1LNSA 1UMIA 3GDBA 3U37A 1W99A 1UXZA 3C7GA 4BDVB 4QDSA 2QQOA 2VZUA 2VQTA 1NAEA 5DQ0A 4ET7A 3T2QA 1UX7A 2VZ3A 4M4RA 3BN6A 4UI9L 4GWIA 1WKYA 2J1VA 2VMFA 3C7FA 3HNBM 2VO5A 2VCCA 2Y6JA 4UAPA 4XUQA 3K4ZA 3IAPA 1BHGA 2W3JA 3FHAA 5G05L 1JU3A 3OGSA 4JX0A 2EICA 3MUZ1 3THDA 2ORXA 2W94A 3K46A 2VZSA 3WSOA 4ZZ8A 2W47A 1PX3A 3OGRA 2LS6A 1PMHX 4JKKA 3WNMA 3ACGA 2W95A 5LA2A 5C7GA 4LQRA 2OKXA 4MADA 3OGVA 1K3IA 4P02B 1TG7A 2JKXA 2VR4A 2BBAA 2WBKA 4KMQA 4JKLA 3LEGA 3MV01 4HG6B 5JUVA 2J1RA 2QQKA 2WN2A 5IYYA 3LPFA 1R64A 2V5DA 3DECA 4QX1A 4QDQA 2VM9A 1JYXA 3IAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZV A;  1GUI A;  1KGY A;  1UMH A;  5JXH A;  5JMO A;  3A22 A;  2WAA A;  2ZXQ A;  4PQQ A;  1D7P M;  4MOA A;  4E8D A;  2W5F A;  5LCW L;  1UYZ A;  2WQ8 A;  3P6B A;  3FHQ A;  4QX0 A;  2YC4 A;  1O8P A;  2X09 A;  4CU8 A;  2QQJ A;  2CDO A;  4BK5 A;  4XUP A;  4OZO A;  3W5N A;  4D8M A;  3D3A A;  1JI6 A;  4DXS A;  2ZEX A;  3GXU A;  3CMG A;  2VME A;  4PF1 A;  2ZEW A;  2VC9 A;  5G04 L;  4XUR A;  3LE0 A;  1GNY A;  2YG0 A;  3WF0 A;  3CQO A;  5B4X A;  2YB7 A;  1GOG A;  1UY2 A;  3VD3 A;  4CUB A;  2VZT A;  3ZM8 A;  4OYU A;  1JZ8 A;  4QB2 A;  3A7Q A;  3WF2 A;  1YQ2 A;  3WF3 A;  3WNP A;  3GM8 A;  3T0A A;  1OD3 A;  2W87 A;  2Y6K A;  3VDA A;  4AAX A;  2W1Q A;  2VMD A;  3VD9 A;  4A6O A;  2J1A A;  2VZQ A;  4QDR A;  2W9X A;  1JZ2 A;  3C7H A;  5CYY A;  2VTF A;  1UY0 A;  2VZP A;  2Z4F A;  1NUK A;  5J1X A;  3PUI A;  4ZY9 A;  2WYS A;  1T2X A;  1GOH A;  1JYN A;  2J1S A;  1DP0 A;  4MGQ A;  1UWW A;  1W8O A;  3HPN A;  2VOT A;  1GOF A;  3ETP A;  4DUV A;  3LQC A;  5EJ1 B;  4DUW A;  2XON A;  4DEQ A;  2WZE A;  1WCQ A;  4YPJ A;  3SEP A;  2J22 A;  1NX9 A;  1CZT A;  1UY4 A;  3VDB A;  3SEE A;  2C26 A;  2ORZ A;  3AC0 A;  2DDU A;  1US3 A;  1JZ3 A;  4Z2A A;  3DYM A;  2YFU A;  4A44 A;  3OEA A;  1F4H A;  1JZ4 A;  1K42 A;  5CZK A;  2LW8 A;  1TVG A;  2Y6G A;  1JU4 A;  3C8X A;  5LA1 A;  4DEV A;  3E1F 1;  1P8J A;  2E26 A;  4A42 A;  3I2I A;  2J7M A;  3VD5 A;  2EIE A;  1XNA A;  1K45 A;  4XZU G;  4OMC A;  2J1U A;  3MV1 1;  5JXJ A;  4JHZ A;  1H6X A;  2CDP A;  1F4A A;  3T0B A;  3FL7 A;  2QQL A;  2KD7 A;  4UOJ A;  4XVH A;  4OMD A;  1J83 A;  1US2 A;  5IHR A;  1NKG A;  2W1U A;  4P5Y A;  3CZJ A;  3C7O A;  3WNN A;  1PX4 A;  4RYD A;  2B9V A;  4P08 A;  2BGO A;  4M4P A;  3CDZ B;  1O8S A;  1RYY A;  1UYY A;  4ARY A;  2JE8 A;  1XC6 A;  3I3E A;  2Y64 A;  2VCB A;  1JZ5 A;  1HN1 A;  3MBW A;  3I2F A;  5C71 A;  1W9W A;  2X05 A;  3VD4 A;  3PUH A;  3DYO A;  4QB1 A;  4W8J A;  2HLE A;  2BER A;  4XUT A;  1EUU A;  3VDC A;  4PT6 A;  3WF4 A;  1W0N A;  4XUO A;  3VD7 A;  5JXI A;  4QPW A;  1IQD C;  2QQI A;  1L7R A;  4BJ0 A;  2PQS A;  5I0D A;  5C70 A;  3III A;  4A3Z A;  4AG4 A;  1CX1 A;  4QAW A;  4W4Z A;  2JD9 A;  1I5P A;  3EYP A;  3I2K A;  3OBA A;  3UET A;  3HOB A;  3CKH A;  1UXX X;  2WUH A;  4CU7 A;  4TXW A;  4QX3 A;  2WAB A;  2Y6L A;  1JZ6 A;  3NNG A;  4ZXE A;  2VQU A;  1XNT A;  2YFZ A;  3IDA A;  1GMM A;  2BGP A;  2C4X A;  1UY1 A;  3UNP A;  3SKV A;  3MUY 1;  3OEB A;  4QX2 A;  3HNM A;  4MGS A;  2Y8K A;  3HNY M;  2VJX A;  1GU3 A;  4XUN A;  5DMY A;  4LKS A;  1ULP A;  2VZO A;  2YC2 A;  1EUT A;  5LA0 A;  1DLC A;  1W9S A;  5JXG A;  5F7U A;  3WNO A;  2RV9 A;  4GZ9 A;  4OUE A;  2XHN A;  2W1S A;  3UES A;  3F2Z A;  1JYW A;  4ZZ5 A;  2ID4 A;  2BZD A;  1PMJ X;  2QBX A;  4QB6 A;  1W8N A;  4CVU A;  4KI5 M;  3CIH A;  3WNL A;  3CZU A;  3J7H A;  3HEI A;  3T08 A;  2VL4 A;  1SHW B;  2WAO A;  4GWJ A;  4DXT A;  1JZ7 A;  3NJX A;  2J1E A;  4LPL A;  2WO3 A;  4LHS A;  5IFT A;  4CUA A;  3NQH A;  2QQM A;  4P00 B;  3K4D A;  2R7E B;  3T2P A;  1JHJ A;  2ZEZ A;  3P1I A;  1KEX A;  4A45 A;  2RJ2 A;  3T0D A;  2VMC A;  1OF3 A;  3EB7 A;  3OB8 A;  3T09 A;  4TTG A;  2E32 A;  2VCA A;  3MO4 A;  3ACF A;  3I3B A;  5JR2 A;  1OH4 A;  2VZR A;  2E31 A;  4A41 A;  2HYX A;  3SKJ E;  4A4A A;  4CU9 A;  1H6Y A;  3WF1 A;  2WO1 A;  3ECQ A;  4D0Q A;  2VZ1 A;  2QQN A;  3IB3 A;  3WQB A;  4DXR A;  1L7Q A;  2WDB A;  2W46 A;  2XQX A;  4MO3 M;  3NRU A;  3I2H A;  1JYV A;  3FN9 A;  2DCK A;  4DUX A;  2WN3 A;  3LPG A;  2JDA A;  2W1W A;  2V4V A;  1SG3 A;  1O59 A;  1MPX A;  1ULO A;  2E33 A;  2EID A;  2VZV A;  3T2O A;  5B4N A;  2W91 A;  2ZEY A;  4FI9 A;  2Y6H A;  4JKM A;  5IJR A;  5HPO A;  4BK4 A;  2C9K A;  3ACH A;  3LEK A;  2DCJ A;  3I97 A;  4KWU A;  5A1A A;  4W50 A;  4L0P A;  2EIB A;  2B4K A;  1UYX A;  1UY3 A;  1GQP A;  4CUC A;  3W5M A;  3HN3 A;  3K4A A;  5EJZ B;  2WO2 A;  4E8C A;  3A23 A;  5IFP A;  4RN5 A;  1J84 A;  4ARX A;  2XOM A;  2J1T A;  3K75 B;  2WZ8 A;  2V72 A;  3JXS A;  3K77 A;  2L9L A;  3HJR A;  3DYP A;  3THC A;  3A21 A;  5DPN A;  1DYO A;  2RVA A;  5FUI A;  4CU6 A;  3I2J A;  3ABZ A;  4BXS V;  1UZ0 A;  3LEI A;  2W92 A;  3BGA A;  5HXM A;  2X10 A;  1CZS A;  3NJV A;  3WEZ A;  3GGL A;  5DN2 A;  3I2G A;  3I3D A;  1OT5 A;  5EIY B;  3ACI A;  3WNK A;  1W9T A;  3C7E A;  1OF4 A;  3OG2 A;  1SDD B;  1CIY A;  1K12 A;  1XPW A;  4IUG A;  1LNS A;  1UMI A;  3GDB A;  3U37 A;  1W99 A;  1UXZ A;  3C7G A;  4BDV B;  4QDS A;  2QQO A;  2VZU A;  2VQT A;  1NAE A;  5DQ0 A;  4ET7 A;  3T2Q A;  1UX7 A;  2VZ3 A;  4M4R A;  3BN6 A;  4UI9 L;  4GWI A;  1WKY A;  2J1V A;  2VMF A;  3C7F A;  3HNB M;  2VO5 A;  2VCC A;  2Y6J A;  4UAP A;  4XUQ A;  3K4Z A;  3IAP A;  1BHG A;  2W3J A;  3FHA A;  5G05 L;  1JU3 A;  3OGS A;  4JX0 A;  2EIC A;  3MUZ 1;  3THD A;  2ORX A;  2W94 A;  3K46 A;  2VZS A;  3WSO A;  4ZZ8 A;  2W47 A;  1PX3 A;  3OGR A;  2LS6 A;  1PMH X;  4JKK A;  3WNM A;  3ACG A;  2W95 A;  5LA2 A;  5C7G A;  4LQR A;  2OKX A;  4MAD A;  3OGV A;  1K3I A;  4P02 B;  1TG7 A;  2JKX A;  2VR4 A;  2BBA A;  2WBK A;  4KMQ A;  4JKL A;  3LEG A;  3MV0 1;  4HG6 B;  5JUV A;  2J1R A;  2QQK A;  2WN2 A;  5IYY A;  3LPF A;  1R64 A;  2V5D A;  3DEC A;  4QX1 A;  4QDQ A;  2VM9 A;  1JYX A;  3IAQ A; 
#chains in the Genus database with same CATH topology
 1CZV A;  3CO2 A;  1W03 A;  1AF9 A;  4URT A;  2JEC A;  3P5B A;  5GZD A;  2HH9 A;  2NYY A;  3D0S A;  1ULC A;  4LA2 A;  1MR5 A;  4M3C A;  4Q4X 1;  3WV6 A;  1R1A 3;  2QVS B;  4COU A;  1UMH A;  2VQA A;  4TLF A;  1BEV 1;  1VR3 A;  3ES1 A;  5LRR A;  4BXF A;  1KDK A;  1WCD J;  1E5I A;  4CDU C;  1COV 3;  1JMU B;  1D7P M;  4MOA A;  1ND2 A;  2CNA A;  4E8D A;  1UYZ A;  3GZA A;  3HR9 A;  4AVS A;  3FZ3 A;  1DQ0 A;  3M3E A;  4Q1R A;  2UWA A;  4NRQ A;  5FY1 A;  1JHN A;  1RUD 3;  4FFG A;  4O7X A;  2VEC A;  3N9O A;  3OUH A;  2VAU A;  2X8K A;  4OZO A;  2ET1 A;  2BTV C;  4P9W A;  5F5C A;  1DDL A;  5HCA A;  3Q8B A;  4E9K A;  1G9C A;  2ARB A;  4XYX A;  5FKB A;  4QKB A;  1TMF 1;  4N43 A;  4RD7 A;  4RS5 A;  4AVT A;  2DV9 A;  5JVV A;  2VUC A;  4Y1U A;  3ZFG A;  4DRV A;  3RZG A;  3M8L A;  3KF3 A;  3T1M A;  3OBZ A;  4PDW C;  2VME A;  3CJX A;  1ZZ9 A;  5I0U A;  4DQA A;  1JOP A;  3ZXL A;  4HSL A;  1Y9M A;  3M4F A;  1GNY A;  1W0O A;  4CP0 A;  2VVE A;  3PVN A;  5JOX A;  2WSU A;  2WNU A;  5DUW A;  1LEM A;  3DCQ A;  1G9D A;  1K5M A;  4QXK A;  4BHP A;  3WW3 A;  1GBG A;  4FFH A;  3B9I A;  3ZM8 A;  2OXB A;  1ULF A;  1G8W A;  1KFX L;  5CNA A;  4JZR A;  5LBB A;  1JZ8 A;  1YIF A;  4JCK A;  1RUD 1;  1DF0 A;  3WNP A;  5A70 A;  3D82 A;  2WZR 2;  1RUH 1;  1D4V B;  2IXI A;  3R05 A;  1YQC A;  3KSC A;  3TOJ A;  1Y9Q A;  4IEU A;  5LBF A;  3VBH A;  3G6J B;  2GNM A;  3QH7 A;  3VDA A;  1OSG A;  1X82 A;  2NM1 A;  3Q8E A;  3FX3 A;  1DZQ A;  4AVA A;  1PO2 3;  3H8R A;  2HWC 2;  1WW4 A;  3POB A;  5F2S A;  4IEX A;  3WOG A;  1NY7 2;  1QH6 A;  2W9X A;  4IQP A;  5DAX A;  2BWA A;  3C7H A;  1PVC 1;  3FFZ A;  3J8F 1;  4I01 A;  3EJK A;  3CU7 A;  1JYC A;  2YXS A;  4OFG A;  2HEV F;  2VH9 A;  1EP0 A;  1VBB 1;  1KJL A;  1D4M 2;  4GAZ A;  4QQO A;  1SCR A;  4R9C A;  4FQ4 A;  2CAV A;  5LW9 A;  4QPG C;  2ZZJ A;  4FOW A;  4BQ2 A;  3MLL A;  1H1I A;  4K3U A;  2K2S A;  4MX3 A;  1GOF A;  2Y60 A;  2H6C A;  4ES9 A;  4DUV A;  1BLZ A;  3IDB B;  2GN7 A;  5E6H A;  3VBR C;  4AFD A;  2FDI A;  1OA3 A;  1Q8P A;  2ZGS A;  4I0B A;  5BPX A;  4DUW A;  3MHZ A;  4FTB A;  3HN1 A;  3ACL A;  3JZV A;  4DS0 A;  1QJU 3;  3UKN A;  2C24 A;  1OOP B;  4OHY A;  1UNB A;  2YPJ A;  2A3X A;  4NHK A;  4QGL A;  3VDB A;  4IES A;  3NL1 A;  3SEE A;  3W9A A;  2C26 A;  1DQ5 A;  4LOR A;  3KQR A;  3MDP A;  4RS5 C;  5GLZ A;  3U07 A;  3ZFG C;  3HIF A;  3UGF A;  2B46 X;  5C3Q A;  2VMH A;  5F1R A;  4GWN A;  1LOG A;  2DDU A;  1Q8O A;  2PQQ A;  2GC0 A;  4V2W A;  3IMM A;  3B3Q E;  4KWL A;  5A6Y A;  4AHZ A;  4EYU A;  1K42 A;  4FPH A;  1SPP B;  2RG4 A;  4KH9 A;  2FCV A;  2PMW B;  1GYK A;  1YO8 A;  1H2M A;  2Y6G A;  1GZW B;  4XIK A;  1JU4 A;  3LCP A;  4YG6 A;  2RMU 1;  2RDQ A;  5FMD A;  3UKV A;  2JXA A;  5CIR A;  3L9J T;  5FZD A;  1GQG A;  3TEW A;  3I2I A;  4LHL A;  1AR9 2;  2EIE A;  2ETE A;  1XNA A;  3ZFE A;  2B39 A;  4UYB A;  4COZ A;  4OMC A;  2J1U A;  4RGA A;  1CAV B;  2GAL A;  3MV1 1;  4CDQ B;  1VBA 2;  1IS3 A;  1OHF A;  1Z7S 2;  1WW7 A;  1QDC A;  1H6X A;  2IXK A;  2XHK A;  1GR3 A;  3USS A;  2RJL A;  3MPP G;  4Q26 A;  1J59 A;  4RQP B;  3FL7 A;  2QQL A;  2PHU A;  2B42 B;  1IZ3 A;  1SLT A;  2KD7 A;  3AX4 A;  4BMB A;  1FOD 2;  2FZ1 A;  2ZGK A;  4HVR A;  3ZMO A;  5IHR A;  2XL7 A;  3MEP A;  2PHR A;  3UV9 A;  4S2F A;  2W1U A;  5JSP A;  5JOZ A;  4S2G A;  2RE9 A;  1Y43 B;  5GLW A;  2NLR A;  1BBT 3;  1DCS A;  1LCL A;  1S4C A;  1XNK A;  2VTX A;  4XQ4 A;  5DDJ 1;  5KBF A;  4CDW B;  2AR6 A;  3H50 A;  4QHO A;  3DXT A;  4BM8 A;  4JC1 A;  1XSQ A;  3E5U A;  3CDZ B;  1GZW A;  1UYY A;  3S30 A;  4ARY A;  2IXC A;  3S0M A;  3D0J A;  4BIF A;  1AX2 A;  1Q56 A;  3W59 A;  4D6S A;  2Y64 A;  4LBN A;  1BKZ A;  3LA2 A;  4WM7 C;  3I2O A;  4IV3 C;  3I2F A;  5T3N A;  3I7D A;  2VW0 A;  1KXG A;  1LU1 A;  4YM3 A;  4CDW A;  4OHX A;  1H8T A;  1Z0H A;  2RDS A;  3DYO A;  1HW5 A;  4HK8 A;  5FZ0 A;  4W8J A;  3U78 A;  4XUT A;  1QMJ A;  4I0W B;  1J3Q A;  2WFF 2;  1AR8 1;  4PT6 A;  1UIJ A;  1GNH A;  2BFU L;  1RUH 2;  2HWF 3;  5A1L A;  1WCU A;  1OA4 A;  2ARC A;  2ZBJ A;  1MZ5 A;  3VD7 A;  2EVX A;  2DVA A;  2VTX J;  4NIA A;  4CUG A;  1AR8 2;  3RVH A;  5CAD A;  1V6N A;  4Q4W 1;  1A34 A;  1IQD C;  1C1F A;  3IDE A;  5A1F A;  1CAV A;  3FMG A;  3VLB B;  4BJ0 A;  1X9P A;  5I0D A;  1FOD 3;  1QXJ A;  4OZX A;  2JD9 A;  3DL3 A;  3OCP A;  4OHZ A;  2IVI B;  2VVD A;  2IXL A;  5FYY A;  1S0D A;  2WII B;  1PGL 2;  1QJY 2;  1B35 A;  1ZZ6 A;  3ZX7 A;  1YQ8 A;  1FV3 A;  3OBA A;  2Y0O A;  4JV4 A;  5E88 A;  3QBQ A;  1H8V A;  4LLO A;  5FP3 A;  5F5A A;  3CKH A;  2OVU A;  2D5F A;  1AR6 2;  2OYZ A;  4AI9 A;  4TXW A;  4NIH A;  4XBN A;  2BVB A;  4YAR A;  1XYP A;  1AUY A;  1EYB A;  3NNG A;  4ZXE A;  4MHR A;  1KS5 A;  3H8X A;  2WLQ A;  5JIA A;  2BGP A;  1XOY A;  2J42 A;  3POJ A;  2C4X A;  4FP2 A;  4YFW A;  3O1M A;  1GIC A;  1BZW A;  1SLA A;  3SKV A;  3ZYJ B;  3MUY 1;  4JAA A;  4XDP A;  1MS8 A;  1VRB A;  2W52 A;  3HNM A;  2RS5 1;  3SC7 X;  1JOD A;  4MGS A;  5EYY A;  4GXL A;  1DQ2 A;  3N7K A;  4PIY A;  2YC2 A;  3RYK A;  3ZXD A;  1VBD 3;  5E16 A;  3ITQ A;  1DLC A;  1SFY A;  4I3G A;  1RL3 A;  1A3K A;  1W9S A;  1YFW A;  5FZ8 A;  1OQ1 A;  1OQD A;  1WCS A;  3HT2 A;  3HQU A;  2D6L X;  2AH2 A;  2W2I A;  5FZA A;  1BEV 3;  3WHU A;  5FOJ B;  1WD4 A;  5A3L A;  5DZG A;  1JYW A;  4XFB A;  5I0S A;  4LKD A;  1AR9 3;  4OUS A;  4YG0 A;  4AFB A;  5J7M A;  4XFC A;  1VBD 2;  4A7Z A;  1GKB A;  3TB0 A;  1J58 A;  1XQN A;  2RS3 2;  5H9S A;  4XAB A;  4QM9 A;  4AQT A;  3LF7 A;  2NPI A;  2VOW A;  4ASK A;  4KI5 M;  4O9E A;  3UKT A;  2BYV E;  1UX6 A;  4QGM A;  3OPT A;  5F37 A;  4IL7 A;  3WVJ A;  1OKO A;  5FFO C;  4D3W A;  4FXK B;  3HEI A;  1RUE 2;  4FPO B;  2WAO A;  1CPN A;  4GWJ A;  4HFS A;  4R8H A;  1JZ7 A;  4D94 A;  4MXV A;  2VMG A;  1LHO A;  1ZZ7 A;  4LPL A;  2WO3 A;  2JDN A;  4JTO A;  4LHS A;  5A3W A;  3TWI A;  1VBE 3;  3THT A;  2ADE A;  3WW2 A;  5IFT A;  1HN0 A;  5CU1 A;  2RMU 2;  5A6Q A;  1O4T A;  2XJT A;  4HVO A;  5LZ6 A;  4AQ2 A;  4M3C B;  3WQ7 A;  4FPE A;  4P9Y A;  4H14 A;  3NNJ A;  3TYJ A;  4YZ3 A;  3QH6 A;  2IVJ A;  1XYN A;  3WG2 A;  5GZG A;  1JBC A;  1WUV A;  1IPS A;  3GAL A;  4BH9 A;  1W2U A;  1OVS A;  4TWT A;  1UOB A;  2P3Y A;  1N1S A;  4N9I A;  3T3Y A;  2VCA A;  3NV2 A;  4AHY A;  2IXJ A;  2Y33 A;  1YJL A;  1QOO A;  3V56 A;  5FYU A;  1FOD 1;  3FHI B;  2BOJ A;  4Y1X A;  2VBP A;  5DUU A;  3NKT A;  3NJZ A;  1CAX A;  5FZH A;  3WT3 A;  4UFJ A;  2R49 A;  1IKP A;  2DVG A;  1LOB A;  5FZL A;  4A41 A;  4A4A A;  4D69 A;  4AHX A;  4CP9 B;  1RUH 3;  2YV8 A;  4HON A;  4NPR A;  2RS3 1;  2XUE A;  2GME A;  2CY6 A;  4Y1Y A;  4D0Q A;  1FAT A;  4LO4 B;  4QXC A;  2CGN A;  4QPI A;  2AEZ A;  4DXR A;  1L7Q A;  4FTE A;  2YBS A;  2HWF 1;  4MO3 M;  3NRU A;  2W68 A;  1AX0 A;  2XLF A;  3FUO A;  3QOP A;  1YCI A;  2JDA A;  4XBL A;  2V4V A;  2TEP A;  1X7N A;  5FY4 A;  4EN8 B;  1AJO A;  3VL8 A;  5B2G B;  1ULO A;  2WZR 3;  3DF0 A;  2VZV A;  5JDB A;  3QLQ A;  1HB2 A;  4NWW A;  2P2K A;  1ENS A;  2PAE A;  2Q0A A;  2RS1 1;  5HXV A;  1S55 A;  1SBE A;  4XF4 A;  5FZF A;  3RJR A;  4L97 A;  1GP5 A;  3NJY A;  3TN9 3;  2GSY A;  4K20 A;  4QGN A;  3OD0 A;  5C8W A;  3E6D A;  3PVB B;  2VMI A;  3QD6 A;  3R4U A;  1VE0 A;  4CXW A;  5FV3 A;  3I97 A;  4KWU A;  2Q8E A;  4RS5 B;  3VBO A;  5A1A A;  1RUJ 2;  5FXV A;  3K48 A;  5DDJ 3;  3APB A;  1HXS 2;  2EIB A;  2YU2 A;  4Q4V 1;  3EMR A;  4U36 A;  5FZ6 A;  1RHI 2;  2ARE A;  2WO2 A;  1CQ9 A;  3NWK A;  5GJ6 A;  5FK8 A;  1TNR A;  1OLQ A;  2Y0I A;  5FZM A;  1XE0 A;  2WSV A;  4RN5 A;  5KHH A;  4BQ4 A;  2R0H A;  5FJH A;  3WQ0 A;  1EY2 A;  2OX0 A;  1WME A;  2PHX A;  3KT1 A;  2G9Z A;  4FPG A;  3O12 A;  3ZO0 B;  3SMH A;  2IUW A;  3VB9 A;  2WZ8 A;  3KV6 A;  2HWE 3;  1ZNP A;  4CYD A;  2V72 A;  1J1T A;  4NO4 A;  3K77 A;  3AVR A;  4FOQ A;  1W90 A;  3WXP A;  3V0A A;  2JDH A;  3EO6 A;  2BU9 A;  2MEV 2;  3A21 A;  3THP A;  1DYO A;  3VBO B;  3O1S A;  2D6N A;  1LED A;  2RVA A;  4CU6 A;  4NHM A;  4GB3 2;  2GND A;  1PVC 2;  3K2O A;  3LEI A;  1GSL A;  1SBF A;  2TNF A;  1CJD A;  5FQ0 B;  2VU9 A;  1VB2 A;  5FZ4 A;  5HXM A;  1CZS A;  2D43 A;  3RI8 A;  3IZO A;  1QHD A;  4BQX A;  5ABJ C;  3WEZ A;  4UF0 B;  3HD8 B;  1CN1 A;  4EWD A;  2HWE 2;  2W39 A;  3ZIW A;  3OGG A;  4IEY A;  4MXW A;  1IS4 A;  4CCM A;  4JRA A;  1OT5 A;  5EIY B;  1E57 A;  5IVE A;  1DFQ A;  2ERF A;  5LA9 A;  2QE3 A;  2G19 A;  1PVX A;  4LJH A;  1W9T A;  1H4H A;  1OF4 A;  3OG2 A;  2ZML A;  3ZKY A;  4CEY B;  1SDD B;  2WT2 A;  3O1R A;  2UYA A;  4AF9 A;  4XIL A;  1UMI A;  4COW A;  1W99 A;  5FXZ A;  4LR4 A;  3BTX A;  1UXZ A;  1YJK A;  2BWC A;  1GLH A;  4ASL A;  3RJ2 X;  2VZU A;  4K21 A;  4BDV B;  4F7Z A;  2VQT A;  5F5Q A;  1KRI A;  5A3T A;  4UW6 A;  4UXA A;  1QJX 1;  4BQY A;  1A8M A;  3T2Q A;  3BB6 A;  3EHK A;  5CFC C;  2EA7 A;  2WQ4 A;  4HL0 A;  4PLN A;  2H0V A;  4OLL A;  4UFM A;  3BN6 A;  2WFF 3;  3BCW A;  4LIT A;  5FOB B;  2J1V A;  2VMF A;  3C7F A;  4XFF A;  3VDD C;  3IPV B;  4XJW A;  2VCC A;  2Y6J A;  3H8U A;  3L2Y A;  5EWS A;  4A3X A;  2CGP A;  2ZMN A;  1RVF 2;  2FDH A;  3VHN A;  1BMV 2;  3A4U A;  5FQ0 A;  2B9U A;  3ROU A;  2Q5T A;  5H9Q A;  3M3Q A;  3MUZ 1;  2EXJ A;  4CDW C;  3Q8A A;  1YFY A;  2W94 A;  3K46 A;  3PME A;  1PX3 A;  4C8D A;  2C1F A;  4H7M A;  4CXX A;  1I3H A;  2XGX A;  4JKK A;  3WNM A;  2DWR A;  2HWB 3;  3ACG A;  1RGS A;  4BLJ A;  1GFF 2;  1Q8Q A;  5C7G A;  4XEZ A;  2JG9 B;  5EPA A;  4LQR A;  3CL1 A;  4E4H A;  5FPV A;  1IG3 A;  3JBG 3;  2DTY A;  2QZ2 A;  1UAI A;  2VR4 A;  3MFA A;  1WBL A;  2WBK A;  5JLV A;  3RZM A;  4JKL A;  1E5S A;  3LEG A;  1U12 A;  3MV0 1;  4HG6 B;  4CP2 A;  2A7A A;  2WN2 A;  2D7F A;  5C8C B;  4I3P A;  1MS9 A;  4AQS A;  5FYZ A;  4XFA A;  3UL2 A;  5JSO A;  3DEC A;  4CDX B;  5L36 A;  3OD4 A;  1W0P A;  4HBN A;  4QDQ A;  1HV1 A;  2RS1 3;  2VGD A;  3SIS A;  4HK9 A;  5J09 A;  3AKP A;  1H1M A;  2GAU A;  2ZKN A;  2MNG A;  5L9B A;  4FOY A;  2GMP A;  2YHJ A;  1Y4W A;  1MS0 A;  5CFD A;  1WWY A;  3KM5 A;  1KGY A;  4JDM A;  1W6Q A;  1PM7 A;  4YVW C;  5FLJ A;  5JMO A;  3A22 A;  3U10 A;  2PLV 3;  4N9H A;  2CYF A;  3PNA A;  1OKQ A;  4ZU5 A;  4XJZ A;  2E7T A;  1YIP A;  2WAA A;  5JPN B;  1GP4 A;  3H8O A;  2WQ8 A;  1R1A 2;  3FHQ A;  5GLU A;  1FNZ A;  1RUG 1;  4E2G A;  4CA9 A;  1UW8 A;  2CDO A;  3AL5 A;  4D6R A;  1ZRD A;  2P17 A;  1YFU A;  4BYY A;  5IK4 A;  3CHX A;  3VHO A;  5I0T A;  4QXH A;  1UO9 A;  5BNN A;  3W5N A;  4COV A;  4JRL A;  2A3W A;  4D8M A;  1CWP A;  3D3A A;  1W39 A;  4KL1 A;  3B00 A;  5ACA 1;  1CAU A;  4MSV A;  4IGQ A;  4URA A;  2OW4 A;  4EN7 B;  2IXH A;  2JIJ A;  3HAG A;  5F8P A;  3CEW A;  3JU9 A;  5CKQ A;  3GXU A;  1LHN A;  2HBT A;  3CMG A;  1UYP A;  2Y26 A;  4GD4 A;  4PF1 A;  3U4S A;  2ZEW A;  4IEV A;  5G04 L;  4AGV A;  5I91 A;  5IAX A;  3PJY A;  4LNV A;  4AFM A;  4EZH A;  1BVP 1;  3CNA A;  2YG0 A;  3WF0 A;  2D40 A;  2NZ9 A;  4JDN A;  1ZRE A;  2PA7 A;  4J6G A;  1RJ7 A;  1C5H A;  1GOG A;  1TEI A;  2QTW B;  2JEN A;  4QHB A;  4XDO A;  3VD3 A;  3VBU B;  4C1X A;  4CUB A;  5LRS A;  4QXB A;  4XPV A;  4CPB D;  4QB2 A;  5LK5 A;  2VCM A;  3A7Q A;  2G1M A;  3WF2 A;  4ZU7 A;  3S5Q A;  3LAG A;  1EV1 2;  5EXO A;  3T0A A;  1XJA A;  1C8M 3;  2YC0 A;  3FFQ A;  5SV5 A;  4JGZ A;  1F2N A;  5CG9 A;  4Q4W 2;  1VRH 2;  1ZBA 2;  1CAW A;  2RR1 1;  2NMO A;  1CPM A;  3RYR A;  1RUD 2;  5FBZ A;  4LTA A;  4QDR A;  1XNC A;  3M3O A;  4FAH A;  5D21 A;  5FLH A;  1C4R A;  2VTF A;  4XF9 A;  2VZP A;  1GZ9 A;  5T5O A;  1NUK A;  1Q8V A;  2OZ6 A;  1S0B A;  5C4W C;  3KB5 A;  3B5L B;  1UF2 C;  4HPK B;  2WYS A;  1T2X A;  1PGL 1;  3TAY A;  3A0N A;  3KT4 A;  3LB9 A;  2PN5 A;  3MLK A;  2E6V A;  3NAP C;  5D1I A;  4N8M A;  1POQ A;  1ZVF A;  2J1S A;  3H9A A;  3VHR A;  4JQT A;  4MGQ A;  2HWB 2;  1WCK A;  2QQW A;  1B09 A;  4O65 A;  4Q4Y 1;  1YFX A;  2VOT A;  1X8M A;  1DBN A;  1ALY A;  3WZ1 A;  4CCC A;  2EXK A;  1WMF A;  3FJS A;  5EJ1 B;  1POV 1;  1PZ7 A;  3POE A;  2XON A;  2WIN B;  3EBR A;  4QPI C;  4QKD A;  2IFW A;  5E8A A;  3S5A A;  5F3I A;  4YPJ A;  4LEJ A;  1UOG A;  2D6K A;  2OQ7 A;  1NX9 A;  1OPM A;  3VBS C;  1CZT A;  1ONA A;  1UY4 A;  4A6S A;  2B7Y A;  4AI2 A;  1DGR A;  4FBF A;  1WLD A;  2ORZ A;  1N3Q A;  4KU7 A;  1H0B A;  1FYU A;  1UPS A;  1DGR N;  2JWP A;  2E53 A;  2XJS A;  2OS2 A;  3MYX A;  5FK7 A;  3DYM A;  2YFU A;  1CON A;  1Y7B A;  2YZ4 A;  4LKE A;  5A7O A;  5I8T A;  2XLG A;  1W8W A;  3U75 A;  3FWE A;  1L3J A;  1TVG A;  5EP9 A;  1LR5 A;  3LFM A;  4HLT A;  2GH8 A;  5LWB A;  2XPJ A;  1BXH A;  1ST8 A;  1XBF A;  2XQR A;  4DEV A;  3AKQ A;  3Q8F A;  1VJ2 A;  4A42 A;  1LHU A;  2FDJ A;  3WDY A;  3OPZ A;  5KXB A;  4XOG A;  1G9A A;  2Z69 A;  2FD8 A;  5FZG A;  1XU1 A;  1OLM E;  3B69 A;  5FXX A;  4WVM A;  5I8S A;  3R6S A;  1LHV A;  4H7L A;  1DQ4 A;  1W2T A;  1EV1 3;  5IVJ A;  2WRA A;  2QQV A;  4TN7 A;  1NOV A;  2FQP A;  1RUJ 3;  2VNG A;  2LM3 A;  4XDQ A;  4LHN A;  5LAT A;  4OMD A;  1HIX A;  1J83 A;  1SFP A;  5ABJ B;  2WL1 A;  5I8Y A;  3W58 A;  2XLA A;  3FLT A;  1DGW A;  1RUI 1;  4P5Y A;  2EAA A;  3VBR B;  1ZRC A;  3AZY A;  3CZJ A;  3ENR A;  2JEM A;  4G9S B;  3WNN A;  1PX4 A;  4RYD A;  5FZE A;  3CJI C;  2YRO A;  3FBY A;  2BQP A;  2OII A;  5F32 A;  1I9R A;  2JJ6 A;  5KWR A;  4M0N A;  2WFP A;  4Y5Z 0;  1W6P B;  3SH5 A;  2K9Z A;  4F8A A;  1O8S A;  4OVE A;  3TEZ A;  5GZC A;  3ORJ A;  3GCX A;  1OXC A;  1XC6 A;  2B45 X;  3J8F 2;  1LOF C;  3OOX A;  4HMZ A;  2XBO 1;  3B9C A;  2R07 3;  1GWK A;  4G3Y C;  4CDU A;  5LEK A;  1JZ5 A;  2DU1 A;  4M01 A;  5KHG A;  1W9W A;  2RS5 2;  4IXL A;  3VN4 A;  1F5F A;  1HB1 A;  1R09 2;  1KFU L;  4DY5 A;  1EUU A;  3VBS A;  1PO1 1;  3VDC A;  1OOP A;  1NQJ A;  4R9A A;  5FWE A;  5ABJ A;  1W6M B;  3WF4 A;  5KR7 A;  4BQ5 A;  4IEO A;  2PHW A;  5C9A C;  4QQL A;  5D8A B;  5FKC A;  1W9F A;  3WDW A;  4MGY E;  1VRH 1;  1ZBA 1;  3P3P A;  5JPM B;  5FYM A;  1S1A A;  2BEO A;  2XML A;  2VOX A;  2YDE A;  4AI3 A;  4MHU A;  2Q8D A;  3WP3 A;  2EXI A;  4AG4 A;  1CX1 A;  4QAW A;  1AL2 2;  1SZB A;  2F6B A;  2WNU C;  4WM8 C;  1FPN 2;  4BME A;  1DHK B;  4KGQ A;  4Q8L A;  5FZI A;  2A6V A;  1IPJ A;  3NNF A;  4R9D A;  2ZHM A;  3HOB A;  3AMH A;  4IEZ A;  4CCJ A;  5DAB A;  3LOI A;  4QX3 A;  3RRD A;  2Y6L A;  1AXZ A;  1RJ8 A;  1CES A;  2K46 A;  2C6S A;  3MIE A;  3ZXJ A;  1XNT A;  5I0R A;  4QWN A;  4WM8 B;  1QWR A;  3KD4 A;  3MIC A;  4YLZ A;  5ERL A;  2DBN A;  3VDD A;  1NZC A;  1W05 A;  3PUQ A;  1UY1 A;  5F2W A;  4RHV 2;  5A7W A;  1H2L A;  2BNO A;  2HEY F;  2YPD A;  4HXC A;  4UFH A;  5FY8 A;  1PM4 A;  2P3K A;  3PTR B;  3R4D B;  4RQP C;  4N53 C;  3HNY M;  4ZS3 A;  1QJF A;  2VJX A;  3M3C A;  4XUN A;  3LFI A;  4TLG A;  2VZO A;  1W2A X;  2R04 3;  5CBL A;  3ZSK A;  1HRI 2;  3X29 B;  3N9M A;  5JXG A;  1POV 0;  4Q0U A;  1TME 1;  2B8M A;  3POW A;  4KQ7 A;  4Q4X 2;  1W3X A;  1AYM 1;  3MI8 A;  3UGG A;  3WNO A;  5AFE A;  5KXE A;  1QY4 A;  2ZGP A;  4FQZ A;  1R1A 1;  3RNS A;  2A71 A;  4B1L A;  1NQD A;  2WZP P;  1UU5 A;  2D5H A;  4DPN A;  1W28 A;  5IK5 A;  2W08 A;  1HXS 3;  1MS1 A;  1XE8 A;  5FPB A;  2DVB A;  2R07 2;  3G7D A;  4KG0 A;  2BPA 2;  4XFH A;  2ID4 A;  1YI7 A;  1N3P A;  2V73 A;  1NCR A;  1RUC 1;  3OJB A;  2QBX A;  4GMP 0;  5C8C A;  1CAU B;  2JD4 A;  1JOB A;  1QQP 2;  4AZZ A;  4CVU A;  2ES3 A;  4DXZ A;  3CIH A;  1C3H A;  4GJZ A;  4CDX C;  5D2A A;  5FY9 A;  2VE1 A;  5LK7 B;  3PUR A;  3SNM A;  4IV1 C;  3KWV A;  3SHR A;  5C9A A;  4DB5 A;  3AYE A;  2VL4 A;  4XIO A;  1SHW B;  1ND3 B;  3B94 A;  1KS4 A;  3NJX A;  1RUF 3;  3ZVX A;  4Y26 A;  3AFG A;  5EJ3 A;  4AFA A;  3HQX A;  2VQ0 A;  5DAP A;  3SLI A;  4YW4 A;  1NYW A;  4CUA A;  2HBU A;  1HV0 A;  3BOW A;  3NQH A;  2CU5 A;  4AW7 A;  3ELN A;  4IV1 B;  1NLQ A;  1QKQ A;  3MF9 A;  1OLR A;  4XXP A;  3BUC A;  3VZL A;  4B4Q A;  4B7E A;  4LO7 A;  4CSW A;  4Q8K A;  4BA6 A;  2GDF A;  3J8F 3;  1FPN 1;  1AL0 G;  1C8M 2;  2RJ2 A;  2VOV A;  2VXR A;  3AKT A;  4J25 A;  4A45 A;  1G9F A;  3VGI A;  1ZYB A;  3OB8 A;  1AVB A;  1V70 A;  3LDK A;  4FT8 A;  5FZO A;  4LE3 A;  5IVC A;  4FO9 A;  2E32 A;  4OI4 A;  2JB8 A;  4H2A A;  2PAM A;  4NPM A;  1ODN A;  5ACA 2;  1E5H A;  3WUC A;  3I3B A;  1OH4 A;  2E7Q A;  4OQ9 A;  4HKO A;  2RS3 3;  5DAV A;  2HYX A;  4QM8 A;  3SKJ E;  3U14 A;  1Z78 A;  3RSJ A;  1Q8S A;  2WO1 A;  4ISR A;  4PIX A;  3ECQ A;  3ZDV A;  3MGU A;  2ZHK A;  5FZ3 A;  4HVQ A;  4RFR B;  2P3J A;  4CE8 A;  4W6W A;  4FTS A;  5BNP C;  4LBQ A;  1X9T A;  1S0F A;  1AR7 1;  3P3N A;  5T55 A;  5IAT A;  3AL6 A;  3AM2 A;  2W46 A;  5KHK A;  3I3Q A;  1VMF A;  2OUH A;  1U5X A;  3M1H A;  1JYV A;  3FN9 A;  3N4M A;  1IPK A;  2R6Q A;  3AMQ A;  3O0V A;  4FP3 A;  3ZFF C;  2WN3 A;  3LPG A;  5DDJ 2;  2W1W A;  5BNO B;  4DUX A;  1SG3 A;  3H1W A;  3KS7 A;  1AL2 3;  5FZK A;  2EID A;  5CFD B;  4LO6 B;  3O0X A;  4KWJ A;  4U2A A;  4YVS A;  3UGH A;  3BIE A;  2W91 A;  5K8S A;  4GUL A;  2LUW A;  2O8O A;  4XE9 A;  5A33 A;  1JUH A;  2ZCW A;  4UF0 A;  5LEJ A;  2VBD A;  2XUM A;  3BPS A;  4FPC A;  4S2H A;  4CXY A;  2ZEY A;  1SBD A;  3R0R A;  1GNZ A;  3B7M A;  3POF A;  4FI9 A;  5EV7 A;  3BU7 A;  5HPO A;  3ZFF B;  1COV 2;  1HB4 A;  4MH0 E;  5T52 A;  1H1A A;  1VAV A;  2C9K A;  1W8F A;  3WP5 A;  4CDX A;  3KCX A;  3BTZ A;  1VBA 1;  3GJA A;  3J7N A;  4LUM A;  1ND2 C;  4W50 A;  1PZ9 A;  1R09 3;  3WDU A;  3JBG 1;  4XBQ A;  1QXR A;  4MUV A;  1UY3 A;  1GQP A;  5EHD A;  5FTT C;  3HN3 A;  3VZN A;  1RUO A;  3K4A A;  5EJZ B;  1ZZB A;  4XF0 A;  3JQX A;  1GQH A;  2BDR A;  3HBZ A;  5FZ7 A;  5FZC A;  3ZN5 A;  1OBN A;  3RGB A;  2ZMK A;  1KDM A;  2P3I A;  4Q4X 3;  2PHD A;  3LEM A;  2J1T A;  2WA4 A;  1ND2 B;  3WP4 A;  3JXS A;  3M2M A;  3M7A A;  3NST A;  5IAV A;  2L9L A;  3F95 A;  2WR9 A;  4UFL A;  5J36 A;  4X6Q B;  4Q0V A;  1LGC A;  2X5I C;  3ABZ A;  2O14 A;  4P9G A;  1RMU 3;  4PBO A;  2XVL A;  1BMV 1;  3GJB A;  1FI2 A;  1DZT A;  3N9L A;  1TZO A;  5CVR A;  1F8V A;  1LOE A;  1WA6 X;  3NO8 A;  4OHV A;  2ZJC A;  3BU0 A;  3GGL A;  5DN2 A;  5FY7 A;  3I59 B;  2GNT A;  4NRM A;  4ORF A;  3IPV A;  1HQL A;  1UZW A;  4NHX A;  2GNB A;  2YUE A;  3BOP A;  1F9K A;  3I3D A;  4RHV 1;  4XCB A;  3ZN6 A;  4ZS2 A;  3AP7 A;  3V0A B;  2RM2 1;  2X5I B;  3ACI A;  5BNP A;  3KCY A;  1ZRR A;  1PNF A;  1ULE A;  3N7M A;  4L8Q A;  3K3O A;  3GYD A;  1UZY A;  5KC6 A;  1SAC A;  3GDB A;  4P5H A;  2D3R A;  4NAO A;  4WV8 A;  3RFR A;  2XKO A;  3KHB A;  3ZOI A;  2Y34 A;  5JR7 B;  2DUP A;  2W0X A;  2QQO A;  3JD7 3;  4FFI A;  3HBK A;  1NAE A;  2P5B A;  4NHY A;  5DQ0 A;  4CEY A;  4AYU A;  2RR1 3;  5A80 A;  4L9B A;  5LB6 A;  2WS9 1;  2RM2 2;  4M4R A;  3WX5 A;  3ZN6 B;  1PZ8 A;  4E4S A;  2D93 A;  3HNB M;  4MXW B;  3AP9 A;  2F4P A;  3BIW E;  1F35 A;  2XB6 C;  1OC1 A;  2XBO 3;  2XL9 A;  3H0O A;  4K1Y A;  4UAP A;  3ZFF A;  2VVF A;  3K4Z A;  1ASJ 3;  3O7O A;  1ZM1 A;  2BGC A;  1QQP 1;  4GMP 3;  1LHW A;  3MF6 A;  2OT7 A;  5C5U A;  3A0K A;  4DMI A;  4JX0 A;  1BQP A;  4AVB A;  4K9S A;  2N7G A;  4OQ8 A;  5FPL A;  3THD A;  4AED A;  1JTZ X;  2ZHL A;  3CJI A;  2ZAC A;  5FBJ A;  3WNX A;  3WSO A;  1S0G A;  4ZZ8 A;  1BK1 A;  1DG6 A;  1PGW 2;  1JXN A;  4JVA A;  1PMH X;  5DAW A;  1LOD A;  5IVY A;  4L99 A;  1FMD 3;  1V6M A;  1AL2 1;  2PHL A;  3N9Q A;  5DG1 A;  5AVA A;  3JCI A;  3U4X A;  1ND3 A;  4AK3 A;  2JG8 C;  1K3I A;  3GHN A;  5F6L B;  2I2S A;  3ZMN A;  1S2B A;  2F4L A;  1TG7 A;  2WNV C;  4DRR A;  2BBA A;  1AR7 3;  2JKB A;  4GA9 A;  5K4L A;  3FE5 A;  4B3N A;  1VAM A;  3JQW A;  3MIG A;  4QPY A;  4LK7 A;  3LWC A;  2P6H A;  5JUV A;  1O4Y A;  4NWV A;  1UQX A;  3FBM A;  5LAS A;  5CKM A;  2ILM A;  3NNL A;  1NCR B;  3HVD A;  2V5D A;  4XHB A;  3ZXK A;  2YBP A;  3KV5 A;  1RUE 1;  4L2N A;  2R16 A;  5AVP A;  2HEW F;  3SH3 A;  4DY3 A;  2DBI A;  5FDB A;  3WDT A;  5CFC B;  4IDZ A;  4AL9 A;  4Q5O A;  1WZX A;  1Q43 A;  3AFK A;  1HRI 3;  5FUN A;  5FYT A;  1MVQ A;  1V6K A;  4RR3 C;  3ILF A;  1EAH 2;  5KXC A;  3POS A;  2XBO 2;  2YMZ A;  3WG3 A;  4FOV A;  4H3W A;  1RXG A;  2XJQ A;  2O1Q A;  4GQ7 A;  5F5I A;  2Z42 A;  5BNN C;  1ULD A;  3SQO A;  1DYP A;  1KIT A;  1O4Z A;  4A7Y A;  3ZSE A;  4CDQ C;  3OYW B;  1HRV 3;  5BNO A;  2ZXQ A;  3LA3 A;  3JBG 2;  3I3M A;  2W5F A;  4AXO A;  2HWF 2;  5LCW L;  5LBC A;  4CEY C;  1WA4 A;  5EFU A;  2YC4 A;  3IM0 A;  4AE2 A;  4CU8 A;  3C3V A;  4BK5 A;  2F17 A;  5GKA C;  4XUP A;  1COV 1;  4Q29 A;  3MPB A;  1OFS A;  1PIV 3;  2OUJ A;  3H1Y A;  1HX6 A;  3NW4 A;  1R08 3;  2UUR A;  2ZKL A;  4C90 A;  4LIV A;  4AEJ A;  2VNO A;  1JI6 A;  4BB3 A;  4YYO A;  1REF A;  4DXS A;  2ZEX A;  4SLI A;  4E27 A;  4Z8B A;  4Z82 A;  3N7J A;  4ZXK A;  3FLP A;  5C8C C;  4H55 A;  4CCL A;  4J1X A;  5JSR A;  2A6X A;  2E9Q A;  3CQO A;  5B4X A;  2ZZQ A;  4PHZ A;  1N1V A;  2JE9 A;  1UY2 A;  1JYT A;  4IV1 A;  4OUL A;  2VZT A;  4QKF A;  1AHS A;  2D98 A;  3AYA A;  1G7Y A;  2MEV 3;  4Y20 B;  4YFZ A;  3KV4 A;  4OYU A;  1V9U 2;  3UT0 A;  1FX5 A;  1NG0 A;  2V5Y A;  2VBB A;  2WKK A;  3MIF A;  4NAM A;  3WF3 A;  4NHL A;  1BVV A;  3GM8 A;  3ZSJ A;  1YYN A;  3OBR A;  2GN3 A;  1ZZ8 A;  1FXZ A;  2W87 A;  1J1L A;  1W8U A;  5FIX A;  2BP6 A;  5A7W B;  5BYN A;  1LB2 A;  2Y6K A;  2WS9 3;  1VBB 3;  2D3S A;  3QAC A;  2WWU A;  4AAX A;  2LRO A;  2CWM A;  2VMD A;  2W1Q A;  4V2V A;  4YZ5 A;  2H0B A;  1YXW A;  2VZQ A;  4EQV A;  3RZK A;  4RGG A;  4GH4 C;  1ND3 C;  3TNP B;  1V9U 3;  4N7I A;  5CYY A;  4W6X A;  2WNV A;  4BCU A;  3O1P A;  5A6X A;  2OQ6 A;  5J1X A;  5A3M A;  2X29 A;  3AZW A;  1JYN A;  3K51 A;  1MS5 A;  1BK0 A;  3SXW A;  1S0I A;  1SLI A;  4QX8 A;  5ANN A;  5BNO C;  4A7K A;  1QJE A;  1DP0 A;  1YC6 1;  1FMD 2;  1UWW A;  4X8P A;  1NLR A;  5FZ1 A;  3HPN A;  1W8Z A;  3J7M A;  1SDW A;  2RDN A;  4KBZ A;  3H3Z A;  4BQ3 A;  2Y6F A;  3LQC A;  3RZZ A;  3E5Q A;  5T5J A;  3VBF B;  4NRO A;  2HWD 1;  4FPJ A;  3SEP A;  1XYO A;  1IHM A;  3DPR C;  1WLC A;  3MIH A;  1VBE 2;  5JZG B;  2R04 2;  2C5D A;  3OGJ A;  4XET A;  5F3E A;  5FAX A;  4CDQ A;  3J4U H;  2HWE 1;  1XRU A;  2ZGQ A;  4QX7 A;  1EPZ A;  2R0F A;  4NII A;  1JZ3 A;  2FDG A;  3OEA A;  1F4H A;  1QF3 A;  5K0U C;  1JZ4 A;  2XWB B;  1NCQ C;  4NPL A;  2FMY A;  4QT6 A;  5CZK A;  4B4P A;  3USU B;  2QDR A;  1PGS A;  5LY1 A;  1ZA7 A;  5IUQ A;  2E63 A;  3DEM A;  2ZX0 A;  2VD7 A;  1P8J A;  2E26 A;  1HQW A;  3RS6 A;  4WM7 A;  4NRP A;  2J7M A;  1S0J A;  4FPY A;  4MGK E;  3KT7 A;  3VD5 A;  1PGW 1;  5KXD A;  3GZE A;  3JB4 C;  2I07 B;  2KM2 A;  1PHM A;  1ZBE 1;  4EWE A;  4ZHN A;  5K0U B;  2GU9 A;  1S0C A;  1QJY 3;  1UZV A;  3M70 A;  3V65 A;  3VBR A;  5JXJ A;  3ZXA C;  1F4A A;  1YI9 A;  2YYO A;  4I30 A;  1QOS A;  1UMZ A;  3DGT A;  3PHM A;  3VUO A;  2FDK A;  4EWA A;  5BV6 A;  2PXJ A;  2PAK A;  4Q4V 2;  4XVH A;  3VKM A;  1US2 A;  3OBT A;  2P4E A;  1NKG A;  1AYN 1;  1RUJ 1;  1CGP A;  5TSW A;  2VNV A;  4Y24 A;  1CJP A;  1HJG A;  4UW3 A;  1D4M 3;  1X8E A;  2A70 A;  1RIN A;  1N1Y A;  1UL9 A;  1K5J A;  2FCU A;  3ZYB A;  2B9V A;  4P08 A;  2BGO A;  2DCZ A;  2G9G A;  5GLT A;  1MZF A;  1TE1 B;  5JI9 A;  3KZ4 C;  5CFD C;  2IWG B;  5CKN A;  3NV3 A;  4YVW A;  5HCF A;  5JWP A;  2JE8 A;  1ZX5 A;  4LBM A;  5FWJ A;  2ZX2 A;  3J9S A;  3I3E A;  1O6U A;  4MV2 A;  4MVT A;  5C4W B;  2DFC A;  3I4I A;  5L7O C;  1HN1 A;  3MBW A;  4GH4 A;  2FDF A;  3S57 A;  1D2Q A;  3AXD A;  4XTP A;  1S2E A;  4W6Y A;  1L7L A;  1HQN A;  5FYV A;  3BAL A;  5A32 B;  5BUV A;  2QNK A;  3OY8 B;  3PUH A;  5FXW A;  3VD4 A;  1CAW B;  5FO7 B;  5C3S A;  5C3O A;  4DOU A;  5K7P A;  4YW5 A;  4FPF A;  2HLE A;  1J3P A;  1OA2 A;  4QKN A;  4W65 A;  1W3V A;  5JZG A;  3DPR A;  3RG0 A;  4CTE A;  2I74 A;  3JD7 1;  2P37 A;  4L11 A;  2XJU A;  5C5T A;  2R30 A;  3ZR5 A;  2ZOE B;  3KVB A;  2SBA A;  2D6O X;  3DXU A;  2A1X A;  2Y38 A;  1UKG A;  2KXL A;  5JXI A;  1YLL A;  4D7Y A;  3JD7 2;  3BVC A;  3VBS B;  1XE7 A;  3VBU A;  4CCO A;  2QQI A;  1R09 1;  5DAQ A;  5K0U A;  5J48 A;  1EAH 3;  1VMJ A;  4WVM B;  1L7R A;  1MQT A;  3CF6 E;  3NV1 A;  3VZJ A;  4CEW A;  4AI0 A;  1MEC 1;  1RUF 1;  2QQU A;  5A32 A;  3LOB A;  1VBC 2;  5ANQ A;  5JMC A;  2ARA A;  1QJX 2;  1VBA 3;  3ZLI A;  2QCS B;  3VBO C;  1LJ7 A;  5FMB A;  5FUP A;  2RHP A;  5F3C A;  1UXX X;  2V4A A;  2WUH A;  2WNV B;  5DUV A;  4N43 B;  2WAB A;  3OPW A;  1JZ6 A;  3PLQ A;  5FPU A;  1NZI A;  3DUI A;  4FPL A;  1C1L A;  3GCW A;  2CWS A;  2O8Q A;  2XVK A;  3IN9 A;  3ZXE A;  2GMM A;  1PIV 1;  3UNP A;  4Q0P A;  4WVZ A;  4QX2 A;  1FV2 A;  2Y8K A;  3W21 A;  5BY5 A;  1ULP A;  2P34 A;  2VUL A;  3RWK X;  5LA0 A;  1ZBE 3;  3J26 N;  4Y20 A;  3U0Z A;  1W6Q B;  4Q4V 3;  1YEW A;  4WZC A;  5AC9 2;  4QQP A;  1DQ6 A;  2BNM A;  1U5Y A;  2P1B A;  2MEV 1;  2RV9 A;  3RYP A;  4BE3 A;  5C3R A;  1XXN A;  1RIR A;  3TEY A;  1ENX A;  2JG8 B;  4IGP A;  1WW6 A;  2R06 3;  4LBK A;  4OUE A;  4DNY A;  1B35 C;  2W1S A;  5D8A C;  4JTN A;  4Z1V A;  4I09 A;  2WLP A;  2JIG A;  3VKO A;  1C57 A;  2BNN A;  1SCS A;  2VUJ A;  3ZXG A;  2CHH A;  4IE4 A;  1HLC A;  1PMJ X;  1TMF 2;  2ZX3 A;  5APA A;  4HN1 A;  3H3U A;  3WDX A;  1QJZ A;  2JDZ A;  2DTW A;  3VZK A;  4BPZ A;  4PLM A;  1H9W A;  5A3P A;  1AR6 1;  3WNL A;  3CZU A;  5GZE A;  4JGZ B;  3T08 A;  4P14 A;  4FXG B;  5CIS A;  3H7J A;  4DXT A;  4XFG A;  3VHP A;  2X53 S;  1QU0 A;  4RR3 A;  4D7S A;  4LBJ A;  3AP6 A;  3ZYR A;  2BUK A;  4CZS A;  1JN2 P;  4NID A;  3ZYG A;  1MS3 A;  3B01 A;  3I2D A;  3OUJ A;  4YG3 A;  3N36 A;  4P00 B;  3W20 A;  4AED B;  4D7T A;  1YQ6 A;  4PF5 A;  1MAC A;  1RC6 A;  5KHJ A;  3WP6 A;  1FMD 1;  3E5X A;  1UZZ A;  4K1Z A;  3T2P A;  3P1I A;  3T0D A;  2CAU A;  4NOT A;  5C3P A;  2VMC A;  1E5R A;  4WBB A;  4Z92 B;  1GP6 A;  3EB7 A;  1AZD A;  3WIN E;  1R1Z A;  3AJZ A;  3PUA A;  1LEN A;  4QD2 A;  3N9P A;  4V1P A;  3GHM A;  1MQT C;  4CEW C;  2WA3 A;  3ALQ A;  2QKD A;  1TQ5 A;  4X6R B;  3O14 A;  3ACF A;  2ZPX A;  5JR2 A;  4IEQ A;  2VZR A;  2E31 A;  2E7A A;  4CU9 A;  4PCR A;  1X36 A;  1H6Y A;  2WC2 A;  1RUC 2;  2JX9 A;  2WFF 1;  4J1W A;  3J7L A;  4R4X A;  3ILN A;  5BNQ A;  1D0G A;  1APN A;  4AI1 A;  1VIW B;  2WYF A;  1RHI 3;  3ZKU A;  2ZGN A;  4QX5 A;  1Z7S 3;  1OMI A;  3TEX A;  2DCK A;  5BXX A;  5FYC A;  4I0A A;  1LUL A;  1RUF 2;  1YWK A;  4XMA A;  1LAJ A;  2PFW A;  1MPX A;  4TZD A;  1LOF A;  3AMN A;  3S6P A;  1HRI 1;  1GZT A;  1K5M B;  3AVS A;  5B4N A;  1NA1 C;  4YNI A;  4Y5T A;  4NIG A;  2QDN A;  4YZ1 A;  3KQ4 B;  4PLO A;  3RWN A;  1POV 3;  5F9T A;  4JKM A;  2Y6H A;  3LZZ A;  4C1W A;  1RED A;  4LA3 A;  2QJV A;  2NN8 A;  4UBH A;  2UWB A;  1Z7S 1;  1UOF A;  3ACH A;  3LEK A;  3JB8 A;  3MW2 A;  1LTE A;  1RUN A;  4BQW A;  4S2D A;  4ZU4 A;  3N7L A;  4I02 A;  4DIN B;  3KV9 A;  1UYX A;  1OPO A;  4PDW A;  3ON7 A;  3AMM A;  3GZU C;  3H7Y A;  4CUC A;  5J3U A;  4IET A;  4X8N A;  3KF5 A;  4XF3 A;  1OLM A;  1WD3 A;  2WWJ A;  3GBF A;  4E8C A;  4ERO A;  5FY0 A;  5FP7 A;  2XH6 A;  1DLL A;  1J84 A;  2BVV A;  4KGG A;  3NNM A;  5EQU A;  2XOM A;  1G9B A;  1NLS A;  3IKW A;  3K75 B;  3ZDS A;  1I6X A;  3ZYF A;  1PK6 C;  2V09 A;  3POI A;  3POY A;  1QH7 A;  5BNP B;  3I54 A;  4QHZ A;  4Y33 A;  3AP5 A;  5DPN A;  2MHF A;  1LGB A;  3ZYI B;  4BOW A;  2EXH A;  1IOA A;  4BXS V;  5T5P A;  4A2U A;  2YBK A;  1O5U A;  1YHF A;  2ATF A;  1U5Z A;  4OHW A;  3Q8C A;  1OUS A;  3EQE A;  3NJV A;  5FPZ A;  3PTY A;  5F3G A;  1LES A;  1QNW A;  4EZ4 A;  2YY1 A;  2GH2 A;  5E1R A;  3I2G A;  3IBM A;  2RJK A;  1W6O A;  2Q1F A;  2HWC 3;  3LSD A;  4WVV A;  4Y1Z A;  4K6B A;  1RVF 3;  3URF A;  1W6N B;  3WNK A;  1NCQ B;  3C7E A;  1X33 A;  3RZJ A;  2OA2 A;  3T30 A;  3ILR A;  1IS5 A;  1IQA A;  1D4M 1;  2CSG A;  4XQW A;  4MGT A;  1K12 A;  2WT1 A;  1ZA4 A;  1LNS A;  1ASJ 2;  3WR0 A;  1VBC 3;  1AYN 3;  4XJU A;  3TNQ A;  4PI2 A;  3C7G A;  2DVD A;  1F5J A;  1R08 1;  2AZ5 A;  4UT5 A;  4PQ9 A;  4YZ4 A;  2AYH A;  3IIA A;  3TN9 2;  4SBV A;  5L9R A;  3VBF C;  5L19 A;  4K40 A;  4HKW A;  1RVF 1;  1PO2 1;  1BBT 2;  1I5Z A;  1UX7 A;  3HT1 A;  2HWC 1;  1QQP 3;  4GMP 1;  2GC2 A;  3BOD A;  3V0B B;  2VZ3 A;  1ODM A;  2R1D A;  4IND A;  4GWI A;  3IWZ A;  3MFC A;  4UBG A;  1N47 A;  3NKG A;  1DIW A;  3IAP A;  1HDK A;  2BFU S;  3FHA A;  1W9Y A;  5G05 L;  5JCT A;  5A3U A;  3OGS A;  3NV4 A;  3LA7 A;  2ZGT A;  4BLI A;  4EE2 A;  4M0H A;  1FPN 3;  1XB9 A;  2R32 A;  5A6Z A;  1ZBE 2;  5T50 A;  2YGL A;  2W47 A;  3OGR A;  2KR2 A;  2LS6 A;  3R4S A;  5FRA A;  1N1T A;  3BPZ A;  2WZR 1;  5FYB A;  1TNF A;  2UYB A;  2W95 A;  5LA2 A;  4Z2W A;  2GP5 A;  4NJ4 A;  2OKX A;  2HWD 3;  4MAD A;  3DKW A;  3OGV A;  4QPI B;  4XFI A;  1CX4 A;  2BRT A;  4P02 B;  3KLS A;  2C0Z A;  4HKL A;  2LTN A;  4Z07 A;  1DQ1 A;  4TSV A;  3AKR A;  4RSU A;  4CCE A;  4DFS A;  5FCC A;  4PDW B;  1JW6 A;  3HMY A;  5EZW A;  2VG9 A;  1V0A A;  5FO8 B;  4MG2 A;  4Q4Y 3;  2BW8 A;  1C8N A;  4JGY A;  4NVP A;  5IYY A;  4GB3 1;  3VL9 A;  1MEC 3;  1QEX A;  1J3R A;  5A7S A;  1W6O B;  2RMU 3;  4JDO A;  4RGK A;  1SLC A;  2R1B A;  2RDR A;  5FZO B;  5HV4 A;  1HJF A;  5H9R A;  3KGL A;  3BYW A;  2VM9 A;  1JYX A;  3SCG A;  2PLV 1;  2CGO A;  4MGZ E;  4Y22 A;  1V9U 1;  3PVE A;  2PHT A;  4BU2 A;  2WQZ C;  5A33 B;  2VY0 A;  1GUI A;  4LO5 B;  3N3H A;  1TME 2;  1NT0 A;  3T2T A;  5JXH A;  4YM0 A;  2IZW A;  1QJY 1;  4BIS A;  2XVG A;  1FNY A;  2QFE A;  1RHI 1;  2D6M A;  3FC0 A;  3MLJ A;  3TRS B;  4HZF A;  4PQQ A;  5FR3 A;  3ATG A;  5C6C A;  1QGL A;  1DYK A;  5IW0 A;  3P6B A;  4QX0 A;  2DFB A;  3T4V A;  1O8P A;  4HN0 A;  3QCW A;  2X09 A;  2QQJ A;  3RMY A;  1W06 A;  1DU3 D;  3WCS A;  3RI9 A;  2DCT A;  4AFC A;  3LIH A;  3H1M A;  5FMC A;  2HYK A;  4IEP A;  1STM A;  3WCR A;  4NR1 A;  2RS1 2;  3SH4 A;  2A5Z A;  1DGL A;  3ZIX A;  1OQE A;  2XJP A;  5A7P A;  1PIV 2;  4CCK A;  5FY5 A;  3PIG A;  2AUY A;  3VV1 A;  5A7Q A;  5DUX A;  1F15 A;  2VC9 A;  1AR9 1;  3DV8 A;  4CRQ A;  2LRP A;  1SLB A;  4DZG A;  4LUL A;  4XUR A;  4K8R B;  3LE0 A;  4YW1 A;  2XDV A;  5FYI A;  4LOT A;  5FZ9 A;  3BTY A;  4RHV 3;  3HQR A;  2YB7 A;  5IK7 A;  5ACA 3;  2PHF A;  1OOP C;  4N43 C;  5DZF A;  3T1L A;  4BIO A;  3GZT B;  2QZ3 A;  4ATF A;  4HOO A;  3PUS A;  4LMF A;  4DO0 A;  5D8A A;  5FPX A;  2WNO A;  4Y1V A;  5JOW A;  3T4H B;  4IER A;  2DUO A;  2ENR A;  1YQ2 A;  2JE7 A;  4RR3 B;  4UFK A;  4AR2 A;  2TUN A;  4CPB A;  1OD3 A;  1G86 A;  4LXL A;  3VZM A;  1ZRI A;  3LIG A;  5GLV A;  1PO1 2;  1RUG 3;  1VRH 3;  1ZBA 3;  4LBQ B;  1QJU 2;  4L92 A;  5JOY A;  5HCH A;  5C9A B;  5J37 A;  2JIC A;  3FUQ A;  3VD9 A;  4WM8 A;  3OY8 A;  4A6O A;  3LSE A;  1JOJ A;  4LE4 A;  4Q27 A;  3RDI A;  2J1A A;  4LUK A;  1CAX B;  4C0H A;  3D6E A;  5SV8 A;  4AEK A;  1V6O A;  1JZ2 A;  4UW4 A;  3CLP A;  1AXK A;  1UY0 A;  4UFI A;  4KU8 A;  2Z4F A;  4FAG A;  3PUI A;  4ZY9 A;  2VNR A;  1ASJ 1;  1VB4 A;  1B35 B;  4PJY A;  1GOH A;  4IE7 A;  1YQ5 A;  4YGC A;  4NUB A;  1BJQ A;  2ZAA A;  4FCA A;  1Q5O A;  4B7K A;  4Y3O A;  1XND A;  1JYI A;  2D44 A;  1W8O A;  4Y4Y A;  3LDR A;  5LY2 A;  5FYH A;  4MYE A;  3ETP A;  4AOC A;  1D2S A;  1FAY A;  2AGS A;  3LGR A;  3OF1 A;  1AYN 2;  3N35 A;  5FMO S;  3GBW A;  4FSJ A;  5GAL A;  4N90 A;  2VOK A;  2WNE A;  4Y4R A;  3PVO A;  1URX A;  4DEQ A;  1OH3 A;  2WZE A;  4Q4W 3;  1H30 A;  1WCQ A;  4UW5 A;  4F83 A;  3O1O A;  3JUU A;  5K9Y A;  1W6M A;  2J22 A;  2UU8 A;  4EV0 A;  4JGZ C;  3IMN A;  4N53 B;  1QDO A;  1F31 A;  3WY6 A;  3ZR6 A;  1WLW A;  5I93 A;  2G4I A;  3VDD B;  4R52 A;  4IEW A;  5AC9 3;  3AC0 A;  3ZFE B;  4YZ2 A;  2A6Z A;  1NA1 A;  3ME2 A;  4K7J A;  4YGB A;  1QNY A;  4AQ6 A;  4WM7 B;  1US3 A;  5KHI A;  2CV6 A;  4EN9 B;  4Z2A A;  4A44 A;  4AVV A;  1IG0 A;  1GZC A;  2DU0 A;  4AED C;  3UJO A;  4M3C F;  1RMU 2;  5C4W A;  4BQ1 A;  1LEC A;  4K8F A;  2LW8 A;  1M4W A;  1MS4 A;  3UK9 A;  2BV4 A;  4IW3 A;  1EAH 1;  2R07 1;  1DZR A;  4Y5S A;  1W6P A;  1TME 3;  3C8X A;  1HB3 A;  5LA1 A;  2ET7 A;  3E1F 1;  3NAP A;  1CVN A;  1GAN A;  2ZS6 B;  5FMO L;  4B4R A;  1AYM 3;  1NA1 B;  1O5L A;  4RL7 A;  2JG8 A;  1K45 A;  4XZU G;  2IFR A;  1MQT B;  3AZZ A;  4CEW B;  2HKX A;  5L73 A;  1BEV 2;  1YRZ A;  2R04 1;  4IGO A;  3OUI A;  4MLO A;  1UU4 A;  4ES8 A;  1VP6 A;  2HJI A;  4JHZ A;  4F3J A;  2CDP A;  4HT1 T;  3KHC A;  3WUD A;  3T0B A;  1U0A A;  3AKS A;  1LU2 A;  2VPV A;  3AZV A;  4YW7 A;  3I49 A;  2H6B A;  4UOJ A;  1O7F A;  5A3N A;  2QQP A;  5JAX A;  2Q1M A;  1IS6 A;  5L7O A;  2CL2 A;  3GNE A;  4AAP A;  1H2K A;  3WD5 A;  1M06 G;  1VBE 1;  3C7O A;  2Q8O A;  4R9B A;  1PNG A;  2GC3 A;  3VKF C;  1H8T B;  3ZPO A;  2XR4 A;  1SFN A;  4M4P A;  5A3O A;  4GH4 B;  4DIQ A;  4WVW A;  1QXP A;  5JZG C;  1RYY A;  4BZ4 A;  1XU2 A;  4XW3 A;  4KBB A;  2O0O A;  2VUA A;  3PJQ A;  3MW3 A;  4YVW B;  3ZSL A;  1ENR A;  4P9L A;  2VCB A;  2EIG A;  2EAK A;  3VKL A;  3UJQ A;  3GF6 A;  4ATE A;  5C71 A;  2X05 A;  3U1X A;  3VBU C;  3WDV A;  1O3R A;  4QB1 A;  4AI8 A;  4QU1 A;  1QJX 3;  2EF6 A;  2BER A;  2ADD A;  4UWD A;  5FP9 A;  4LO8 A;  3VBH B;  4MET A;  2D3P A;  2ARX A;  1EV1 1;  5FJK A;  2ZTN A;  1OUR A;  1AX1 A;  3HWJ A;  3MW4 A;  3PU3 A;  3VBF A;  4OI0 A;  1W0N A;  4EJR A;  2AC1 A;  4RQP A;  4XUO A;  3ZN4 A;  4QPW A;  2ZAB A;  1C28 A;  3DPR B;  3O5S A;  2PYT A;  4JQR A;  1QJU 1;  3MID A;  4NE9 A;  5GZF A;  1YNA A;  1SEF A;  2DUQ A;  1UKR A;  3VZO A;  5KC5 A;  2BBV A;  1H4G A;  2PQS A;  2NP0 A;  5C70 A;  1H2N A;  3III A;  4A3Z A;  2VW2 A;  4W4Z A;  1WGP A;  3DN7 A;  4YWA A;  1PO2 2;  1I5P A;  1KD7 A;  4AEM A;  1O91 A;  3EYP A;  3I2K A;  4MGI E;  1JUI A;  4OUM A;  3TN9 1;  4CDU B;  3UET A;  5AC9 1;  4N7U A;  4Q0Q A;  4XAE A;  5FLI A;  2AEY A;  4XXA A;  5F6K A;  2OZJ A;  4XAA A;  4B8E A;  1UPI A;  1ULG A;  4CU7 A;  3FLR A;  4HSJ A;  5CEH A;  4LT5 A;  2NMN A;  4XJ9 A;  4RA0 A;  3IT8 A;  2MPF A;  2WO7 A;  2LAL A;  3BTA A;  1X50 A;  2VQU A;  1ZZC A;  2YFZ A;  1GMM A;  3IDA A;  4P9I A;  1Y9G A;  1ENQ A;  3RPQ A;  2GP3 A;  1C5I A;  3K3N A;  5L7O B;  1V00 A;  3RQ0 A;  4PBP A;  1JS9 A;  3OEB A;  2NQY A;  3RZH A;  4AGG A;  1GU3 A;  2BOI A;  5FPA A;  3D5O A;  3ZXF A;  3AB0 A;  4LKS A;  4QQ2 A;  4EN6 B;  5DMY A;  1RTV A;  1EUT A;  4OCT A;  5IVB A;  1V6J A;  2JB4 A;  1G6N A;  4IE0 A;  1HRV 1;  4C91 A;  4ASM B;  1VBD 1;  2XJR A;  4JGY C;  5F7U A;  2Z5W A;  3KGZ A;  4LKF A;  1RMU 1;  4GZ9 A;  3ST7 A;  2Q1Z B;  5AFB A;  1REE A;  1O3S A;  2RS5 3;  2XHN A;  3PMS A;  4E4Z A;  3O1T A;  5T54 A;  1U5I A;  1MEC 2;  2A75 A;  3NAP B;  4NMI A;  4YM1 A;  4YGD A;  5DZE A;  3UES A;  5GM0 A;  3F2Z A;  4B29 A;  5CFC A;  4HPK A;  4I2O A;  2FZ2 A;  1DGW X;  4ZZ5 A;  1QIQ A;  2XJV A;  4QPG B;  3USU A;  1SPP A;  5E89 A;  2BZD A;  4JGY B;  1RUE 3;  1V6I A;  4QB6 A;  1W8N A;  2FMD A;  4YRD A;  2PLV 2;  4CP1 A;  4IE5 A;  3NVC A;  3LKJ A;  4YW6 A;  1N3O A;  3Q9O A;  3J7H A;  3O1V A;  1TMF 3;  4YW2 A;  4EN0 A;  3ZSM A;  1UU6 A;  4HAN A;  2ZX4 A;  4N53 A;  4ZPI A;  1OVP A;  2J1E A;  2YGM A;  1PMI A;  2AAC A;  2JG9 A;  4GKY A;  2WJS A;  3WW1 A;  4YSF A;  3I8T A;  1SLL A;  1VBB 2;  2FBE A;  3TBD A;  3BKZ A;  4E2S A;  1FT9 A;  2A6W A;  2QQM A;  3AYC A;  3IAQ A;  3CJI B;  1WMD A;  2FHR A;  2G9F A;  4FPK A;  5T5L A;  2HWB 1;  3K4D A;  1MVE A;  1VMH A;  2R7E B;  1JHJ A;  2WWS A;  2ZEZ A;  1KEX A;  2UY8 A;  3E6B A;  4GJY A;  4LOS A;  1YUD A;  2ZGO A;  4AGR A;  1IGO A;  1OF3 A;  1D0H A;  1HXS 1;  2C9A A;  3H3L A;  1PVC 3;  3T09 A;  4TTG A;  1LOC A;  1NCR C;  3MO4 A;  4ISQ A;  2CTV A;  2I45 A;  1XSR A;  3D4K A;  3PIJ A;  5IWF A;  3V0B A;  2PTM A;  3PDQ A;  2VW1 A;  4NN0 A;  5CG8 A;  4OI2 A;  2HWD 2;  4P9J A;  1NY7 1;  1C8M 1;  4XCA A;  1CIW A;  2JDP A;  2ZAH A;  4XC9 A;  3VKN A;  3WF1 A;  3IDC B;  1EPW A;  1LRH A;  1GWL A;  2DF7 A;  2WT0 A;  4LBQ D;  4YGE A;  3ZYP A;  1MZE A;  1A8D A;  1VAK A;  2VZ1 A;  3PL0 A;  4M3C E;  3WQ1 A;  4XMI A;  2QQN A;  4YM2 A;  5H9P A;  1W04 A;  3IB3 A;  3RMX A;  3WQB A;  2WDB A;  2XQX A;  2SLI A;  3I2H A;  4PI0 A;  2QUO A;  5FRE A;  2XXZ A;  1A78 A;  5IT6 A;  4TYS A;  5FZB A;  3WHT A;  3ES4 A;  1O59 A;  5J96 B;  2JDY A;  1O3Q A;  1AYM 2;  2E33 A;  4PIZ A;  3INA A;  4Q0S A;  4WZF A;  3T2O A;  2B5H A;  2ZGU A;  2UWC A;  2WNU B;  4LHK A;  3KCC A;  4Q1P A;  1AXY A;  2ZHN A;  4GB3 3;  2DCY A;  3AK0 A;  4Y22 B;  4E4D X;  4B1M A;  1KQR A;  5IJR A;  2ZX1 A;  3S7I A;  4BK4 A;  3POG A;  2JDU A;  2XKP A;  3U11 A;  2RR1 2;  4BWO A;  4XZP A;  4KWK A;  4AWD A;  4GWM A;  4COY A;  2Z2S B;  3ZFG B;  2DCJ A;  3SIT A;  4XTM A;  4ONU A;  4MZU A;  1NE6 A;  2Z79 A;  1PK6 A;  4L0P A;  2B4K A;  1XNB A;  3ZFE C;  1AR6 3;  1BYH A;  5BNN B;  3W5M A;  2JG9 C;  3E97 A;  4G4F A;  4OI1 A;  5CAZ A;  1O3T A;  4XAC A;  1SQ4 A;  1T6B X;  3AYD A;  5HV0 A;  1R08 2;  3A23 A;  5IFP A;  4Q4Y 2;  1RUC 3;  4ARX A;  4ZKT B;  1NXM A;  2GC1 A;  5F39 A;  2AEN A;  5FP4 A;  3ZPY A;  4AHW A;  1WW5 A;  1LKN A;  1NE4 A;  2A6Y A;  3OYW A;  4D6Q A;  3ZYH A;  3HJR A;  1QOT A;  2UY9 A;  1VLN A;  2VXJ A;  2PEL A;  3DYP A;  4JHT A;  4YVS C;  3THC A;  2R06 1;  1LGN A;  2FCT A;  3ETQ A;  4IV3 B;  3OTF A;  5FUI A;  2DUR A;  2P6C A;  1IKQ A;  1UOJ A;  3AJY A;  3I2J A;  1HRV 2;  1UZ0 A;  3RZL A;  4KG8 A;  2W92 A;  4QQH A;  3BGA A;  3I59 A;  2K0G A;  1S2K A;  2Q30 A;  2X10 A;  1WMX A;  2BJS A;  3B02 A;  3WG4 A;  4QU2 A;  5CA6 A;  5J98 B;  1UCX A;  4IE6 A;  1W8H A;  4GKX A;  4XQD A;  3DKQ A;  1ACC A;  2IC1 A;  4M00 A;  5DG2 A;  4YVS B;  3LD8 A;  4AVC A;  5IK8 A;  4O9G A;  4IV3 A;  4LBL A;  1Q3E A;  3WG1 A;  2TBV A;  3GBG A;  4FFF A;  4GAL A;  4GIQ A;  2DVF A;  4LBO A;  3L2H A;  1ZRF A;  1H8T C;  1BBT 1;  1UN1 A;  1VBC 1;  4ZON A;  1VAL A;  4YW3 A;  4CCD A;  3SCF A;  1I1E A;  1CIY A;  1XPW A;  4ITC A;  1RUI 3;  4IUG A;  3U37 A;  3UYJ A;  2D6P A;  2KA3 A;  5IVV A;  4QMA A;  5ISL A;  1W8T A;  3V64 A;  4QDS A;  1KJR A;  1AR8 3;  4XF1 A;  3LDB A;  1UD1 A;  4C0B A;  4HET A;  3OSD A;  5JI7 A;  1AJK A;  2RM2 3;  4XJA A;  2JDM A;  1SMV A;  4ET7 A;  1MZ6 A;  1T6G C;  3H42 B;  3MZH A;  1W2N A;  5EYX A;  1NXD 1;  1VPH A;  1W6N A;  1OUX A;  4LLF A;  3S7E A;  2X5I A;  1RB8 G;  5HBA A;  3MIB A;  3EXU A;  4UI9 L;  1H9P A;  1RXF A;  1RUI 2;  1WKY A;  2E51 A;  2XWJ B;  3ASI A;  5HCB A;  1K5M C;  5M0T A;  3AMP A;  3BI3 A;  2VO5 A;  2D97 A;  5C33 A;  1CD3 G;  2EAL A;  4XUQ A;  3WLU A;  4KNC A;  5JIU A;  4O61 A;  3AZX A;  1BHG A;  2W3J A;  2Q4S A;  2Q8C A;  5DXD A;  2YU1 A;  4P9X A;  2GZW A;  1OD5 A;  2JDK A;  5FYS A;  5CB7 A;  1JU3 A;  1Y3T A;  3KMH A;  2EIC A;  4XJ8 A;  1V6L A;  4XHX A;  1BCX A;  1GWM A;  2ORX A;  4CCN A;  5A7N A;  2A73 B;  1A6C A;  3SCH A;  2VZS A;  1PO1 3;  1RUG 2;  4E2Q A;  1CR7 A;  1HKD A;  3O1U A;  2XG3 A;  1WBF A;  2ZGM A;  1OFN A;  3PU8 A;  1AR7 2;  2A3Y A;  4FVV A;  1WLT A;  3AXE A;  4Q2F A;  2JKX A;  1UIK A;  2ZA9 A;  2ZGR A;  3NMB A;  2ZGL A;  1W2O A;  3CBN A;  1S0E A;  4KMQ A;  4CP9 A;  3M3I A;  3O0W A;  3WW4 A;  4LIU A;  5L9V A;  2J1R A;  5FP8 A;  3VBH C;  5IVF A;  1NCQ A;  1PK6 B;  2QQK A;  2OPK A;  3LPF A;  1R64 A;  3E6C C;  5FO9 B;  2VUD A;  3B93 A;  4QPG A;  1GV9 A;  4RFT 0;  2R06 2;  3D8C A;  3KVA A;  3AP4 A;  3C2U A;  3N9N A;  4R4Z A;  4LK6 A;  4QX1 A;  2WS9 2;  5LBE A;  5HI0 A;  1JH5 A;  1LOA A;  1RIT A;  2DYC A;  1OI6 A;  2OPW A; 
#chains in the Genus database with same CATH homology
 1CZV A;  1GUI A;  1KGY A;  1UMH A;  5JXH A;  5JMO A;  3A22 A;  2WAA A;  2ZXQ A;  4PQQ A;  1D7P M;  4MOA A;  4E8D A;  2W5F A;  5LCW L;  1UYZ A;  2WQ8 A;  3P6B A;  3FHQ A;  4QX0 A;  2YC4 A;  1O8P A;  2X09 A;  4CU8 A;  2QQJ A;  2CDO A;  4BK5 A;  4XUP A;  4OZO A;  3W5N A;  4D8M A;  3D3A A;  1JI6 A;  4DXS A;  2ZEX A;  3GXU A;  3CMG A;  2VME A;  4PF1 A;  2ZEW A;  2VC9 A;  5G04 L;  4XUR A;  3LE0 A;  1GNY A;  2YG0 A;  3WF0 A;  3CQO A;  5B4X A;  2YB7 A;  1GOG A;  1UY2 A;  3VD3 A;  4CUB A;  2VZT A;  3ZM8 A;  4OYU A;  1JZ8 A;  4QB2 A;  3A7Q A;  3WF2 A;  1YQ2 A;  3WF3 A;  3WNP A;  3GM8 A;  3T0A A;  1OD3 A;  2W87 A;  2Y6K A;  3VDA A;  4AAX A;  2W1Q A;  2VMD A;  3VD9 A;  4A6O A;  2J1A A;  2VZQ A;  4QDR A;  2W9X A;  1JZ2 A;  3C7H A;  5CYY A;  2VTF A;  1UY0 A;  2VZP A;  2Z4F A;  1NUK A;  5J1X A;  3PUI A;  4ZY9 A;  2WYS A;  1T2X A;  1GOH A;  1JYN A;  2J1S A;  1DP0 A;  4MGQ A;  1UWW A;  1W8O A;  3HPN A;  2VOT A;  1GOF A;  3ETP A;  4DUV A;  3LQC A;  5EJ1 B;  4DUW A;  2XON A;  4DEQ A;  2WZE A;  1WCQ A;  4YPJ A;  3SEP A;  2J22 A;  1NX9 A;  1CZT A;  1UY4 A;  3VDB A;  3SEE A;  2C26 A;  2ORZ A;  3AC0 A;  2DDU A;  1US3 A;  1JZ3 A;  4Z2A A;  3DYM A;  2YFU A;  4A44 A;  3OEA A;  1F4H A;  1JZ4 A;  1K42 A;  5CZK A;  2LW8 A;  1TVG A;  2Y6G A;  1JU4 A;  3C8X A;  5LA1 A;  4DEV A;  3E1F 1;  1P8J A;  2E26 A;  4A42 A;  3I2I A;  2J7M A;  3VD5 A;  2EIE A;  1XNA A;  1K45 A;  4XZU G;  4OMC A;  2J1U A;  3MV1 1;  5JXJ A;  4JHZ A;  1H6X A;  2CDP A;  1F4A A;  3T0B A;  3FL7 A;  2QQL A;  2KD7 A;  4UOJ A;  4XVH A;  4OMD A;  1J83 A;  1US2 A;  5IHR A;  1NKG A;  2W1U A;  4P5Y A;  3CZJ A;  3C7O A;  3WNN A;  1PX4 A;  4RYD A;  2B9V A;  4P08 A;  2BGO A;  4M4P A;  3CDZ B;  1O8S A;  1RYY A;  1UYY A;  4ARY A;  2JE8 A;  1XC6 A;  3I3E A;  2Y64 A;  2VCB A;  1JZ5 A;  1HN1 A;  3MBW A;  3I2F A;  5C71 A;  1W9W A;  2X05 A;  3VD4 A;  3PUH A;  3DYO A;  4QB1 A;  4W8J A;  2HLE A;  2BER A;  4XUT A;  1EUU A;  3VDC A;  4PT6 A;  3WF4 A;  1W0N A;  4XUO A;  3VD7 A;  5JXI A;  4QPW A;  1IQD C;  2QQI A;  1L7R A;  4BJ0 A;  2PQS A;  5I0D A;  5C70 A;  3III A;  4A3Z A;  4AG4 A;  1CX1 A;  4QAW A;  4W4Z A;  2JD9 A;  1I5P A;  3EYP A;  3I2K A;  3OBA A;  3UET A;  3HOB A;  3CKH A;  1UXX X;  2WUH A;  4CU7 A;  4TXW A;  4QX3 A;  2WAB A;  2Y6L A;  1JZ6 A;  3NNG A;  4ZXE A;  2VQU A;  1XNT A;  2YFZ A;  3IDA A;  1GMM A;  2BGP A;  2C4X A;  1UY1 A;  3UNP A;  3SKV A;  3MUY 1;  3OEB A;  4QX2 A;  3HNM A;  4MGS A;  2Y8K A;  3HNY M;  2VJX A;  1GU3 A;  4XUN A;  5DMY A;  4LKS A;  1ULP A;  2VZO A;  2YC2 A;  1EUT A;  5LA0 A;  1DLC A;  1W9S A;  5JXG A;  5F7U A;  3WNO A;  2RV9 A;  4GZ9 A;  4OUE A;  2XHN A;  2W1S A;  3UES A;  3F2Z A;  1JYW A;  4ZZ5 A;  2ID4 A;  2BZD A;  1PMJ X;  2QBX A;  4QB6 A;  1W8N A;  4CVU A;  4KI5 M;  3CIH A;  3WNL A;  3CZU A;  3J7H A;  3HEI A;  3T08 A;  2VL4 A;  1SHW B;  2WAO A;  4GWJ A;  4DXT A;  1JZ7 A;  3NJX A;  2J1E A;  4LPL A;  2WO3 A;  4LHS A;  5IFT A;  4CUA A;  3NQH A;  2QQM A;  4P00 B;  3K4D A;  2R7E B;  3T2P A;  1JHJ A;  2ZEZ A;  3P1I A;  1KEX A;  4A45 A;  2RJ2 A;  3T0D A;  2VMC A;  1OF3 A;  3EB7 A;  3OB8 A;  3T09 A;  4TTG A;  2E32 A;  2VCA A;  3MO4 A;  3ACF A;  3I3B A;  5JR2 A;  1OH4 A;  2VZR A;  2E31 A;  4A41 A;  2HYX A;  3SKJ E;  4A4A A;  4CU9 A;  1H6Y A;  3WF1 A;  2WO1 A;  3ECQ A;  4D0Q A;  2VZ1 A;  2QQN A;  3IB3 A;  3WQB A;  4DXR A;  1L7Q A;  2WDB A;  2W46 A;  2XQX A;  4MO3 M;  3NRU A;  3I2H A;  1JYV A;  3FN9 A;  2DCK A;  4DUX A;  2WN3 A;  3LPG A;  2JDA A;  2W1W A;  2V4V A;  1SG3 A;  1O59 A;  1MPX A;  1ULO A;  2E33 A;  2EID A;  2VZV A;  3T2O A;  5B4N A;  2W91 A;  2ZEY A;  4FI9 A;  2Y6H A;  4JKM A;  5IJR A;  5HPO A;  4BK4 A;  2C9K A;  3ACH A;  3LEK A;  2DCJ A;  3I97 A;  4KWU A;  5A1A A;  4W50 A;  4L0P A;  2EIB A;  2B4K A;  1UYX A;  1UY3 A;  1GQP A;  4CUC A;  3W5M A;  3HN3 A;  3K4A A;  5EJZ B;  2WO2 A;  4E8C A;  3A23 A;  5IFP A;  4RN5 A;  1J84 A;  4ARX A;  2XOM A;  2J1T A;  3K75 B;  2WZ8 A;  2V72 A;  3JXS A;  3K77 A;  2L9L A;  3HJR A;  3DYP A;  3THC A;  3A21 A;  5DPN A;  1DYO A;  2RVA A;  5FUI A;  4CU6 A;  3I2J A;  3ABZ A;  4BXS V;  1UZ0 A;  3LEI A;  2W92 A;  3BGA A;  5HXM A;  2X10 A;  1CZS A;  3NJV A;  3WEZ A;  3GGL A;  5DN2 A;  3I2G A;  3I3D A;  1OT5 A;  5EIY B;  3ACI A;  3WNK A;  1W9T A;  3C7E A;  1OF4 A;  3OG2 A;  1SDD B;  1CIY A;  1K12 A;  1XPW A;  4IUG A;  1LNS A;  1UMI A;  3GDB A;  3U37 A;  1W99 A;  1UXZ A;  3C7G A;  4BDV B;  4QDS A;  2QQO A;  2VZU A;  2VQT A;  1NAE A;  5DQ0 A;  4ET7 A;  3T2Q A;  1UX7 A;  2VZ3 A;  4M4R A;  3BN6 A;  4UI9 L;  4GWI A;  1WKY A;  2J1V A;  2VMF A;  3C7F A;  3HNB M;  2VO5 A;  2VCC A;  2Y6J A;  4UAP A;  4XUQ A;  3K4Z A;  3IAP A;  1BHG A;  2W3J A;  3FHA A;  5G05 L;  1JU3 A;  3OGS A;  4JX0 A;  2EIC A;  3MUZ 1;  3THD A;  2ORX A;  2W94 A;  3K46 A;  2VZS A;  3WSO A;  4ZZ8 A;  2W47 A;  1PX3 A;  3OGR A;  2LS6 A;  1PMH X;  4JKK A;  3WNM A;  3ACG A;  2W95 A;  5LA2 A;  5C7G A;  4LQR A;  2OKX A;  4MAD A;  3OGV A;  1K3I A;  4P02 B;  1TG7 A;  2JKX A;  2VR4 A;  2BBA A;  2WBK A;  4KMQ A;  4JKL A;  3LEG A;  3MV0 1;  4HG6 B;  5JUV A;  2J1R A;  2QQK A;  2WN2 A;  5IYY A;  3LPF A;  1R64 A;  2V5D A;  3DEC A;  4QX1 A;  4QDQ A;  2VM9 A;  1JYX A;  3IAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...