4ZXEA

X-ray crystal structure of chitosan-binding module 1 derived from chitosanase/glucanase from paenibacillus sp. ik-5.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
132
structure length
132
Chain Sequence
HHNLALNKTATASSIEGAGFEASRAFDGSSTTRWASAEGVDPQWIYVNLGSSQTVNRVKLNWEAAYASSYTIQVSNDSGTPTNWTTVYTTTTGDGGIDDITFTARTAKYVRVHGTVRGTPYGYSLWEFEVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of chitosan recognition by CBM32 carbohydrate-binding modules from a Paenibacillus sp. IK-5 chitosanase/glucanase
pubmed doi rcsb
source organism Paenibacillus fukuinensis
molecule tags Hydrolase
molecule keywords Glucanase/Chitosanase
total genus 31
structure length 132
sequence length 132
chains with identical sequence B, C
ec nomenclature ec 3.2.1.132: Chitosanase.
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4zxeA00
5LA0A 5EIYB 1JYWA 1CX1A 4QDQA 2QQOA 4P02B 3K46A 3T0BA 2Y6HA 4D0QA 4A6OA 5JXHA 3W5MA 5JXIA 1O8SA 5C70A 5HXMA 2XONA 3WNLA 3WNMA 4ZXEA 3SEEA 1TVGA 2J7MA 4P00B 3VD4A 1XNTA 1I5PA 4XZUG 1CIYA 1GMMA 2E26A 1SHWB 2RVAA 2V5DA 1UY1A 3CIHA 5DQ0A 3IB3A 2VZOA 3HNBM 2VCBA 2Y6KA 4UAPA 1JZ4A 2VMFA 2Y8KA 1W99A 2J1TA 4QX3A 4DXSA 4ZZ5A 1JZ5A 4QX0A 3WEZA 3THDA 3LEKA 4M4PA 1L7QA 1UY0A 2J1AA 3SEPA 3CMGA 4CVUA 3OG2A 3OGRA 1OH4A 1SDDB 3SKVA 1OD3A 4TTGA 1UYXA 4CU9A 1H6XA 2QQNA 1R64A 3T2OA 4AG4A 5CZKA 2WN3A 4FI9A 1UXZA 4KWUA 5DPNA 3ACFA 2VZSA 3LEGA 2W91A 2W5FA 5G04L 1IQDC 4GZ9A 4W4ZA 5J1XA 3VDAA 3ETPA 1PX4A 2J1SA 3UETA 3WF1A 2W46A 3T2QA 1CZSA 5DN2A 2VO5A 2V72A 1F4HA 4HG6B 4E8CA 2VC9A 1UY2A 4XUQA 2BGOA 1NAEA 2EIEA 3PUHA 1MPXA 3CKHA 3OGSA 4A45A 4LQRA 2Z4FA 1K42A 4XVHA 5C71A 2B9VA 2Y64A 4GWIA 2WDBA 3BGAA 1UMIA 3A22A 3WNKA 2WUHA 2JKXA 5A1AA 2VMDA 3ACHA 5IHRA 1PMHX 5JR2A 3ECQA 1UZ0A 1DP0A 4P08A 5JXJA 2L9LA 4XUNA 1W9TA 4BJ0A 3GXUA 3I3BA 1TG7A 2RJ2A 4CU7A 2VCCA 2JE8A 2VM9A 2VTFA 3MO4A 3AC0A 4DUXA 2Y6JA 4JHZA 4JKLA 4A4AA 4OZOA 2OKXA 4A44A 3LPFA 4QB2A 1PMJX 1NUKA 2R7EB 3CQOA 1GOHA 1K3IA 2WO1A 2WZEA 4LPLA 1GQPA 2W94A 4BK5A 1UX7A 1HN1A 3D3AA 1UWWA 1GOFA 3I2IA 1UYZA 4D8MA 3T0DA 3GM8A 1JHJA 2Y6LA 2C9KA 3ACGA 2VZ1A 1T2XA 2WN2A 4XUOA 4QB1A 3GGLA 2J1VA 4QX2A 4Z2AA 4UOJA 5JMOA 3MV11 3T0AA 3I2HA 2X09A 3WF4A 3C7OA 3OB8A 1J83A 2VZQA 3I2JA 3IDAA 4CU6A 1CZTA 3I2FA 3MUY1 4JKMA 1CZVA 2QQLA 5CYYA 3LPGA 4XUPA 2BERA 5F7UA 4DUVA 5B4NA 1RYYA 1KGYA 2W3JA 3I3DA 2ZXQA 1EUUA 1JYXA 1US2A 2J1RA 3HJRA 4KMQA 2CDOA 4CUBA 1OF4A 2VOTA 3LQCA 3DYPA 1XC6A 4BDVB 5DMYA 2W1WA 2HLEA 4W50A 2QQJA 3CDZB 2QQIA 4OUEA 4ZZ8A 1K12A 1UY3A 3P6BA 3C7GA 3I2GA 3WQBA 4DEQA 4RYDA 1DLCA 2VL4A 1O8PA 2PQSA 4QPWA 1OT5A 1BHGA 3HEIA 5JXGA 3I2KA 1GUIA 3NNGA 2VZ3A 4XUTA 1EUTA 2KD7A 1YQ2A 2QBXA 2W1UA 3GDBA 1K45A 3EB7A 4QDSA 4DXRA 4QB6A 1W0NA 1O59A 2X10A 4DXTA 2W47A 4LHSA 1JU3A 3IIIA 5LCWL 4ARXA 3U37A 3F2ZA 2B4KA 2J1EA 1D7PM 4ET7A 1NX9A 3NQHA 2VJXA 2V4VA 2ZEWA 3VDCA 2EIDA 2LS6A 2XOMA 1J84A 3C7EA 3C7HA 2VMEA 2VMCA 2W87A 1GOGA 3VD5A 2WYSA 2Y6GA 3SKJE 3T08A 1ULOA 4CU8A 4A42A 2DDUA 1JYNA 2XHNA 4OMDA 5JUVA 2WAOA 4KI5M 3MV01 4GWJA 3OBAA 2BBAA 3NJXA 3A7QA 1W8NA 1JU4A 2QQKA 3HOBA 3P1IA 1OF3A 2VZVA 3DYMA 3BN6A 2C26A 1L7RA 4QX1A 5HPOA 3DYOA 3FHQA 2WO3A 5G05L 2DCKA 3VDBA 3K77A 5IFPA 2CDPA 2WBKA 4PT6A 4YPJA 2VQUA 3J7HA 3A21A 3K4AA 2WO2A 4JX0A 3UESA 1WCQA 3W5NA 1WKYA 2XQXA 1F4AA 1XPWA 3I97A 3NRUA 3PUIA 2YFUA 2ZEYA 3I3EA 2W95A 4UI9L 1P8JA 3THCA 1JZ8A 2E31A 2ZEXA 4PQQA 3ZM8A 3VD7A 5EJ1B 3CZUA 3VD3A 3T2PA 3ABZA 4P5YA 1UXXX 3OEBA 1JZ2A 3ACIA 2JDAA 2ZEZA 2VR4A 2BGPA 3LE0A 1JYVA 1JZ7A 3VD9A 3FN9A 2VZTA 5IFTA 2WABA 3WF2A 4TXWA 2WZ8A 3IAQA 4JKKA 1LNSA 4PF1A 2ID4A 3WNOA 4BK4A 1H6YA 2W1SA 1GU3A 3OGVA 3IAPA 4MO3M 1SG3A 2DCJA 2RV9A 4A41A 4AAXA 1GNYA 3WNNA 1W9WA 2W1QA 3EYPA 3T09A 4MOAA 3HNYM 3FHAA 2YFZA 4LKSA 1ULPA 4IUGA 1NKGA 3A23A 2BZDA 5B4XA 2VZUA 5LA2A 4MGSA 2E32A 4OYUA 3MUZ1 2X05A 2EIBA 2WAAA 1W9SA 3K4ZA 4ARYA 5IYYA 3CZJA 2EICA 3K75B 3C7FA 4CUCA 1KEXA 4RN5A 5EJZB 2J22A 3K4DA 3DECA 3OEAA 4CUAA 4MGQA 3HN3A 1US3A 3WNPA 2W9XA 2YC2A 1DYOA 5LA1A 4M4RA 3UNPA 3C8XA 2YG0A 2JD9A 4E8DA 3WF0A 1JZ6A 3WF3A 4MADA 2VZPA 3NJVA 3LEIA 2LW8A 3E1F1 3HPNA 2W92A 1W8OA 4A3ZA 4QAWA 3FL7A 4OMCA 2ORXA 3HNMA 4DUWA 1UY4A 2YC4A 2VCAA 4BXSV 2E33A 1PX3A 2C4XA 5C7GA 4ZY9A 4XURA 4QDRA 2VQTA 4W8JA 1XNAA 3WSOA 1UYYA 1JZ3A 2YB7A 5IJRA 4L0PA 2HYXA 5I0DA 2VZRA 2WQ8A 1UMHA 2QQMA 3MBWA 4DEVA 3JXSA 2ORZA 5FUIA 1JI6A 2J1UA
chains in the Genus database with same CATH superfamily
3ILRA 1OLME 1BBT1 1RIRA 1UX6A 4CCEA 4AYUA 1GQHA 4XCAA 1PGL1 5JIUA 1IZ3A 2LUWA 2OA2A 3JQWA 1Q56A 3GNEA 2A3WA 2YU1A 3RNSA 5J37A 1WZXA 4D0QA 5KXCA 1NA1C 1YFYA 4CCCA 2RHPA 2Y33A 2Y6FA 5JR7B 2ZKNA 4FVVA 4UF0A 5HXMA 4COZA 5JZGC 5DUXA 1XYOA 2RMU2 3NAPC 4OI2A 2Q8CA 3SEEA 4AI0A 1JXNA 4AW7A 4XBLA 3VD4A 5I0TA 5IATA 4YZ1A 1I5PA 3UK9A 2XL7A 4K40A 1TME2 3LA3A 5KHJA 5KXDA 1V6LA 2ARCA 5FWJA 3CLPA 2E26A 4NWWA 2BEOA 3RWKX 3AMNA 5DQ0A 2BRTA 3AL5A 4WM7B 2BTVC 3HNBM 3OUJA 3O1OA 1H4GA 5F2SA 5FZOA 2UWCA 1YNAA 1JZ4A 1V6IA 3APBA 2Y8KA 4CCDA 3ZOIA 2J1TA 5J7MA 1JUIA 2F4LA 2Z69A 3JB8A 2JDZA 5FZFA 4J6GA 4QX0A 3WEZA 3KB5A 5FZMA 4DXSA 5KXBA 2Y0OA 3LEKA 1WBFA 3KGZA 1NE6A 1I6XA 1QJZA 1YEWA 1VB4A 3S7EA 1QH6A 2X8KA 4NJ4A 3CMGA 2JXAA 2QZ2A 2VW2A 3OOXA 5D1IA 5A7WA 3ZXDA 4K8RB 2P2KA 4PLOA 5C4WA 3N7KA 4RQPB 3WQ1A 4IV1B 2GC1A 3U4XA 3NAPA 1IS4A 1HX6A 2XQRA 1SLBA 1WCKA 3LGRA 3FZ3A 1RL3A 4FPYA 4Q1RA 3ZXAC 5A1FA 1QQP2 2LTNA 2JDNA 5L9VA 3T2OA 5CZKA 1DZTA 1RUE2 1D2SA 1UXZA 2RS32 1NG0A 2WN3A 2ZX3A 3I54A 4KWUA 5FP8A 2ZMLA 2VZSA 3Q8AA 4KBBA 4E4HA 2Y0IA 2LM3A 4AVSA 5FKBA 1IKPA 2PHTA 2W5FA 4GZ9A 2WKKA 3E5UA 2C0ZA 4BYYA 4CP2A 3CO2A 3ZKUA 4ASKA 4W4ZA 4M3CE 2K9ZA 1PO23 4IETA 5J1XA 2VNRA 3DF0A 3ETPA 5CKMA 4JGYA 3P3NA 2J1SA 2RM21 2WFF3 4XEZA 4QPGA 2GH2A 1QKQA 1RUOA 4HOOA 2G9FA 4YGCA 3AZYA 3URFA 3KMHA 4TN7A 3AJYA 3SITA 4AI3A 2P3JA 4KU7A 3W20A 5A7SA 1DQ0A 4Q4W3 3U4SA 1IGOA 2V72A 1WD3A 4QPIC 2VC9A 1XRUA 4XUQA 2EIEA 3GZUC 1W8ZA 2H6CA 1MPXA 1G6NA 1NCRC 4BHPA 4A45A 4ISRA 2Z4FA 3P5BA 3RZZA 3AYAA 4F83A 4Q5OA 1K42A 1NCRB 5JVVA 3I59B 1UW8A 4K1ZA 5A7NA 2A70A 1X7NA 4QPGB 1LCLA 4LA2A 3WW2A 3BGAA 3WG2A 3OBTA 2MEV2 3HWJA 1MACA 1VIWB 4I09A 3RS6A 3AZVA 1X9TA 4LUMA 3ACHA 2VUJA 4FPEA 1XXNA 1PMHX 2ZGLA 5JR2A 3FLPA 2HEVF 2QQVA 3J7NA 1XE0A 1I5ZA 3OY8A 1EY2A 4CCJA 4CDUA 2IUWA 2VGDA 4JQTA 5IVFA 1W9TA 4E4ZA 4QHBA 4DFSA 5A32B 3VKMA 2XXZA 4JC1A 3LEMA 2VTFA 3PVBB 5HI0A 2QVSB 2Y60A 1OPOA 2YGLA 2Y6JA 4JHZA 1N1SA 4W6XA 1H30A 3ZXKA 1XJAA 1W6PA 3LSEA 4BZ4A 4PLNA 3RZLA 5FJHA 1AL0G 4B7EA 3ZR5A 3KQRA 3QH6A 3TEXA 3UGFA 5FLHA 5C3RA 1MZ6A 2CWMA 2R7EB 3ZFGA 5FZIA 2WZEA 1IKQA 1HRV1 4YVWB 3MI8A 1GR3A 2RMU1 2ZZJA 3W9AA 4BK5A 3RPQA 2PAKA 4PHZA 4RS5A 5FOJB 1UWWA 1GICA 2Q4SA 5A70A 1GFF2 1H2LA 3I2IA 5FZ9A 1BK1A 1UYZA 3OUIA 4IEXA 4WM7A 4D8MA 3U07A 4R4ZA 1YYNA 1OQDA 2Y6LA 2TBVA 3ACGA 1KS5A 3NW4A 5DDJ2 3GCWA 4RS5C 3T3YA 1YLLA 5CA6A 3ZN6B 4COWA 3HMYA 1T2XA 3H1YA 4XUOA 3LF7A 4HFSA 1QOTA 3N9QA 4FOQA 4WM7C 3WG4A 1BZWA 1BBT2 4Z2AA 3BTXA 3DUIA 5A33B 3FUOA 4P14A 3ZFEA 2JIJA 3OB8A 4HLTA 1UPSA 3UL2A 2ZHKA 4XJAA 1E5HA 1G9FA 2XLGA 1RXFA 4YW3A 5GZCA 2HH9A 1GNHA 4QKNA 1CZTA 2Y26A 4I0WB 3U11A 3MUY1 3TWIA 3AXEA 1HB1A 3MGUA 4Q0PA 4BM8A 3ZDVA 1C28A 2JB4A 1W6QB 2BERA 1VMFA 1AVBA 2ZABA 2VMIA 3OCPA 2NP0A 5F7UA 1SDWA 4L8QA 4LORA 5FCCA 5J98B 2BPA2 1KGYA 2W3JA 4EN9B 2XWBB 2P3IA 2CGNA 4GULA 2XUMA 2CAUA 3JBG1 3NV2A 5DUVA 5FZ0A 4HVQA 1S0CA 2JDKA 4Q0QA 2VOTA 3T1MA 3EHKA 4YLZA 3BKZA 4TZDA 2XJUA 3MIEA 4DINB 4OHYA 4JGYB 2P1BA 1XC6A 2ZACA 3BOPA 5HCHA 5FYYA 4W50A 2MNGA 3ZYFA 2QQIA 2XB6C 4KWKA 3P6BA 5FLJA 3E6CC 1Z0HA 3C7GA 1NCQA 1EPWA 3RVHA 1XYPA 5EHDA 5LASA 3WCSA 5L7OC 4IEYA 3ZFFC 4LIUA 3S5QA 1ALYA 5DG2A 4W6WA 5FYBA 4NIIA 2GDFA 3NNGA 4QX8A 3NNLA 1IG0A 2DCZA 2W1UA 5LW9A 5T55A 1FXZA 1QH7A 1W0PA 1UNBA 1UZWA 3FBMA 4RHV2 5F5CA 1H8TA 5BNPB 5T5PA 3H0OA 2QQWA 4JRAA 2ZHNA 4QD2A 5A3OA 2HWD1 3DPRA 2VQ0A 4FT8A 4XFAA 5FYSA 2XKOA 5JSRA 1D4VB 2X10A 5JCTA 2OUJA 2CY6A 1VALA 1S0DA 5FXVA 2WWUA 1AR82 4HKLA 4PI0A 5A3WA 4OCTA 1JU3A 2QJVA 2TUNA 5GZFA 2XH6A 4F8AA 5ACA2 4CEYA 1YC61 2HJIA 2JIGA 2ZHMA 1HDKA 3E5QA 3ENRA 4KG8A 2B4KA 2J1EA 2B42B 3RFRA 1NX9A 1AL21 3NQHA 4RA0A 5BNOB 1DU3D 4NO4A 5ACA1 4R9BA 1MQTA 2LS6A 2XJTA 2GN7A 1UOGA 4NN0A 4R4XA 4Z07A 2P6CA 1PIV1 3LIGA 1LHUA 1PO11 2Q0AA 4JAAA 3IWZA 2DTWA 3VBRB 1N1YA 1X33A 1ULOA 1PGW1 4A42A 1FV3A 1O3QA 2OT7A 3WUCA 4EWDA 1I9RA 3O1RA 1GKBA 5C8CB 1W3XA 4KI5M 1SZBA 3MEPA 3N7MA 3MV01 4GWJA 4IEPA 1C1FA 4OHXA 4UYBA 3MPPG 1N47A 3NJXA 4LNVA 3ZX7A 1C3HA 3A7QA 2QQKA 4ORFA 4N53C 4GQ7A 2Q8OA 1OF3A 2ADDA 5KXEA 4Z92B 3EMRA 3BVCA 3T2TA 3V56A 1KXGA 1OQEA 2IXLA 2WRAA 3J8F3 3BPZA 2DUOA 4AE2A 3UKNA 4UF0B 1L7RA 2JECA 2ZGPA 5FMOL 1OA3A 4GMP0 1VBB3 3KHBA 1DCSA 4BISA 5C33A 3V64A 3BB6A 4M3CB 4PLMA 4DPNA 3FWEA 1W28A 3VDBA 1YI7A 4M01A 3K77A 2ZOEB 4D69A 4FPLA 4LKFA 4YW6A 2WBKA 2JD4A 3J9SA 2E6VA 2O8QA 2W68A 5I8SA 5JIAA 1W3VA 4Q4X2 1RUG2 3K4AA 5FXXA 3AFGA 3VV1A 2R6QA 2QNKA 2VG9A 3IN9A 4ASMB 4NHYA 5LEKA 3AMQA 4L11A 2DU1A 1JW6A 3I97A 1W6NB 3NRUA 3PUIA 4J1XA 1GZWB 2CYFA 2YFUA 3TNQA 4LITA 3V0BB 1JYIA 4BB3A 2G19A 5J09A 2W95A 4UI9L 3NMBA 3UGHA 4YFWA 5DUWA 3N9NA 4YVSA 5FZAA 4A7ZA 3VZJA 4Y1XA 5A7OA 1ENXA 2R1DA 3M8LA 4PQQA 3ZM8A 1F31A 2DU0A 3B5LB 3HQXA 1AX1A 1KDMA 1NCRA 1WBLA 4CE8A 4XDOA 5JSOA 4IEZA 3MIFA 3ABZA 3RYRA 1UIKA 2XJRA 1COV2 4U36A 2GC3A 3OEBA 2JEMA 3OF1A 1ULDA 4XF3A 2YV8A 1NZIA 1BVVA 1VBA1 2YBKA 2Z42A 1SBFA 1YFWA 3S0MA 2ZEZA 2BUKA 4MXWA 4YW2A 5FZEA 2P17A 1WMFA 3PLQA 2WFPA 2VVEA 4OHWA 2GC0A 4LULA 4RL7A 1JYVA 4G4FA 1POV1 3FFZA 4ONUA 1N1TA 5HCBA 3VZKA 3WDYA 4CDWA 4MG2A 4KBZA 4I30A 1N3PA 4JKKA 4EE2A 3OD4A 1R082 4PF1A 5IWFA 1PO13 4MXWB 5IVEA 4NHKA 4QM9A 4NPLA 5LBCA 5F6LB 4EROA 2RV9A 1AYN3 2IFRA 1WLTA 2CV6A 3POWA 5A7QA 5HBAA 4FFHA 3PURA 1WMEA 3BIWE 3WNNA 3RZKA 4MX3A 3T09A 1CIWA 4M0HA 1GLHA 3B7MA 4IERA 4MOAA 3N7LA 1O3SA 1R1A3 1S4CA 2X5IC 4LA3A 1C57A 5LBEA 3HN1A 3ZMNA 1HKDA 2R32A 2DURA 4FCAA 4FQ4A 4R52A 5B4XA 4N9HA 2ZHLA 4MGSA 4Y3OA 3MUZ1 2X05A 4EN8B 4O9EA 3KV6A 1AJKA 2O0OA 1H1IA 1HB2A 4DXZA 3CZJA 4CCOA 5GM0A 4Y5TA 2W08A 1NOVA 1O6UA 4CDQA 2EXKA 1MZEA 2ARAA 1UO9A 1XNCA 1RINA 2ZMKA 4CUCA 1W90A 5C3OA 5JAXA 5EJZB 5FY0A 3P3PA 1A8DA 1WW5A 1UPIA 2SLIA 3K4DA 1U12A 1V00A 3W59A 2IC1A 2GMEA 1VAKA 4K6BA 4Y5SA 5F39A 4ITCA 5EP9A 4DS0A 2DVAA 2QCSB 2WSVA 4XFGA 5IAVA 1US3A 3JBG3 5FMDA 2MEV1 5FP7A 4M3CF 1QMJA 3RMYA 2W9XA 3M3QA 5KHHA 3PL0A 5FY7A 4CXXA 4A7YA 3RI8A 5LA1A 2YBSA 3J7MA 3PHMA 4YG0A 2IXCA 2WFF2 2R043 4PBOA 3WDVA 3QD6A 2WLQA 2WZR3 2YG0A 2CAVA 3ALQA 4JDOA 1BBT3 1YJKA 4MGZE 3H3ZA 4BXFA 5F6KA 5LB6A 2NMOA 4E8DA 4BIOA 4EJRA 3RJ2X 3GZTB 4JV4A 5A1LA 1MS5A 4PI2A 2P37A 1ZBE3 2XKPA 2JG9B 1QNYA 3LEIA 4CDXC 2P3YA 2XJPA 3AZWA 5F3CA 4V1PA 3KV5A 1YIPA 1W8OA 3JZVA 4XHBA 4QAWA 2VUAA 3ZN5A 5JI9A 4XXPA 4Q8KA 2H6BA 2YC4A 4FTBA 1PZ7A 2G1MA 2VCAA 1F5FA 2ZGSA 3PUAA 4BXSV 1GSLA 2E33A 4Y22B 2C4XA 2O1QA 2RS31 3AP5A 3RRDA 1JHNA 3WSOA 1J59A 1LOGA 1TE1B 2YB7A 3GF6A 3VBHB 5D2AA 5I0DA 2BDRA 2VZRA 3CHXA 3MBWA 3WW3A 1UL9A 2ORZA 5FY9A 4BMEA 2FHRA 2VOVA 5D21A 4BU2A 3VUOA 2XR4A 5JPNB 4OHZA 4I3PA 1PZ9A 2ZAAA 1W6OA 2AC1A 2VOKA 4H3WA 4MH0E 3WINE 4S2DA 3MIDA 3M3EA 1CX1A 4XQWA 3VHRA 4XIKA 4P02B 1O5LA 1WGPA 2Y6HA 1QJY1 2ZGTA 4FP3A 4LHKA 5C3SA 4R9CA 1FMD2 2JKBA 4NPRA 2HBTA 1X8EA 2XBO3 1Z78A 3O0WA 5H9RA 5JXHA 3W5MA 1PVC1 1GP6A 3L2YA 3KT1A 1PM4A 1AUYA 3VBUA 5C3PA 1AXKA 4CA9A 1QDOA 4XAEA 5FPAA 1TVGA 5FY8A 4I2OA 1XNDA 4P00B 4E4DX 4GD4A 3OSDA 1XQNA 2WINB 5KHIA 1TME1 1DZQA 3ZSEA 1GMMA 1YXWA 1SHWB 2RVAA 1U5XA 3LA2A 3ZYGA 2VUDA 3OYWA 3IB3A 5FPBA 2H0BA 2VCBA 1NXMA 4LJHA 4LR4A 1FAYA 2Y6KA 1CWPA 2PFWA 2RS12 4UAPA 4XE9A 5JOZA 4YW5A 5K0UC 3ZXGA 1YQ6A 2BVBA 4N43B 4OULA 4L9BA 4QX3A 3FE5A 2Q1ZB 4LLFA 1WCDJ 1RMU1 5FP4A 1WW6A 1C1LA 1GQGA 1L7QA 2E7AA 4GALA 3KCCA 1UY0A 2FDKA 1WW4A 4MGKE 2YDEA 1NLQA 4FPHA 1BK0A 1DQ2A 3OYWB 3VKOA 3KSCA 1COV1 1UOBA 1WD4A 3LA7A 4NR1A 5FWEA 3H42B 1V6KA 2X29A 3KZ4C 1OLMA 1QNWA 3BOWA 5FZDA 2BNNA 1SDDB 3IBMA 1DBNA 2A7AA 4FOWA 1KDKA 1OD3A 4N43A 4TTGA 4CU9A 3UKTA 1RC6A 1FPN2 3KLSA 4XDQA 3DL3A 1NY72 4W6YA 2QKDA 1RJ8A 1AXYA 3D82A 2R072 5JI7A 4AG4A 5L36A 4FPFA 2AH2A 3ZVXA 3ACFA 1SPPA 3KS7A 3LEGA 2YBPA 2XDVA 5T3NA 2BBVA 1O5UA 2JG8C 1ZBA3 5F9TA 1SCSA 1LENA 2D98A 4EWEA 1HRV3 1LKNA 3I49A 4Z82A 3VDAA 3ZFFB 3KHCA 1PX4A 5DAWA 3PMEA 4AQ6A 2BNMA 1S1AA 4N8MA 4IV1A 5CKQA 2VBBA 4QQOA 1OLQA 3T2QA 5GALA 5DN2A 2JG8A 3ON7A 3TEZA 2HKXA 3K48A 4FTSA 1HQNA 2YXSA 4YWAA 2ETEA 3MLLA 2BWAA 4XQDA 1ULGA 4HG6B 4E8CA 2WA3A 1VMHA 3E5XA 3VBHA 1W8FA 2BGOA 1NAEA 4K20A 3VBOC 2DVBA 4RQPC 5KWRA 2YU2A 1CONA 3CKHA 4YG6A 4XVHA 1W8WA 3R4SA 5GLUA 5FUNA 4LT5A 3T30A 4S2GA 3WP4A 2B46X 3ZSKA 4O9GA 1UMIA 1WLCA 3A22A 4AK3A 2WUHA 1RUE3 4IE7A 2VMDA 1M4WA 1LU1A 3ECQA 1UZ0A 1LTEA 4NMIA 1ZZ8A 2ZGNA 3V0BA 3KD4A 4PF5A 2W52A 4P08A 1QEXA 3AYDA 4META 1AYM2 4YG3A 2ES3A 3KV4A 4KNCA 4HMZA 5T50A 3GXUA 2XVGA 4FPGA 4BJ0A 5DZEA 1HV0A 3GJBA 2NLRA 2W2IA 4BQ1A 2WIIB 3BTAA 3VBFA 4CP1A 1C5HA 4XF9A 1SLTA 4XF0A 3ZPYA 1BJQA 1KJRA 1AR71 2RJKA 3CJXA 4Q4Y3 2BWCA 4EV0A 3MIBA 3DGTA 2AACA 4LE4A 1RUJ2 4JKLA 1RUE1 3WW4A 4LMFA 1YWKA 3VZLA 1Y9QA 1S2KA 3U75A 3LPFA 5SV5A 1PMJX 5C3QA 4AWDA 3CQOA 4RS5B 1GOHA 1W8TA 2WO1A 1ST8A 3EJKA 3PIGA 3RZJA 3H7JA 4DO0A 4WZCA 3ME2A 1XU1A 4IGQA 4LLOA 4QKFA 3AP6A 1GOFA 5T5LA 4CCLA 3PVOA 1ND2C 5AC92 1VB2A 4GB33 4QXCA 4XF4A 5LK7B 3GM8A 4IEOA 1GWLA 3H8XA 3JUUA 1JHJA 3ZSLA 1RUD2 2C9KA 1OD5A 2HYKA 4HANA 4K7JA 1VR3A 4DIQA 3GBFA 3IKWA 3NV1A 2WN2A 4I0BA 1WA4A 2N7GA 3VBOB 5FY1A 3LOBA 5FZKA 4BLIA 4AFCA 3MV11 3IPVA 5CFCB 1PVXA 2FBEA 2R062 4QPIA 5FYUA 1J83A 1RTVA 2WR9A 3DKQA 3VL9A 5E8AA 4Q2FA 2FZ2A 2VE1A 3B94A 2A75A 2AGSA 4KWLA 4LK6A 2XBO2 4D7YA 5CFCA 4JKMA 4HN0A 4LBNA 5L9RA 1XSRA 2ARXA 1LULA 1QJX3 2RR13 2QQLA 3C2UA 1G9BA 3O1MA 3OUHA 4FQZA 5K9YA 5CYYA 3ZMOA 3WNXA 4XUPA 1DYPA 2WNVC 4NROA 3WY6A 4ZXKA 3O5SA 1RUD3 1NCQB 2G9ZA 3J7LA 3FBYA 1S0GA 2R0HA 3ATGA 4XMAA 1L3JA 3POSA 1EUUA 1XE8A 4D3WA 1JYXA 2BJSA 4KMQA 4OI0A 2CDOA 4K9SA 1BEV2 3MICA 4GKYA 1ODNA 3LQCA 3PU8A 1UOFA 4F3JA 1DDLA 4B29A 4A2UA 1XE7A 3VBSC 1DZRA 5DMYA 3F95A 1ZRDA 5LY1A 1OHFA 2F6BA 3VHNA 4IESA 1MVQA 1Q8VA 4Z8BA 3GALA 2B39A 5E16A 3T4VA 2D6KA 4OUEA 1IPKA 4ZZ8A 4YGEA 4DEQA 2QUOA 3SH5A 5CIRA 1AR73 4Q4Y1 4XABA 1MS9A 1QIQA 2PQSA 2YPJA 2G4IA 1OT5A 3HIFA 3N3HA 4PIZA 1LEDA 4AI2A 4BQWA 3HEIA 4RR3C 1TMF2 4BA6A 5JXGA 3I2KA 1EUTA 1LESA 2QBXA 3GDBA 2VMHA 1BVP1 4FPKA 4D7SA 5BPXA 4AGGA 1ASJ3 1C8M3 3QCWA 4XBQA 3PDQA 4NHMA 4QB6A 1W0NA 3MHZA 1M06G 1MS0A 1H9WA 2VNVA 4GB31 1CAUB 2W47A 3TAYA 5J48A 1H2MA 1F15A 2D6OX 2WNEA 4XFFA 5F3IA 2WZPP 1HXS1 3VBRA 5JOYA 5A3LA 1IS6A 1RUG3 1ZA7A 3F2ZA 2JENA 2PHFA 2D6NA 2VQAA 4XJ9A 2D6LX 4GB32 3TYJA 4IE5A 3WP3A 1CQ9A 1VRH1 3K2OA 4SBVA 2V4VA 4XF1A 4E27A 1Y9GA 3HVDA 1F9KA 1LJ7A 4PIYA 3O1TA 2NZ9A 3MFAA 4CZSA 1MR5A 3B9CA 1WWYA 3C7HA 4EQVA 4LBMA 2VCMA 3BU7A 1GOGA 3HAGA 3VD5A 2WYSA 3AMHA 4N90A 1AZDA 4FAHA 3J8F2 3DKWA 2Y6GA 1YQCA 2I45A 2VOWA 4LBJA 2DDUA 4Q4Y2 1PGW2 3FUQA 4OMDA 4AQSA 4OQ9A 4XQ4A 3BUCA 5JUVA 1N3QA 1REEA 5CG8A 1TMF1 2PYTA 3OBAA 2BBAA 1SFNA 3J26N 1NZCA 5K7PA 1W8NA 1JU4A 5JZGB 4Y4YA 4C1WA 2VOXA 2VZVA 2JDMA 2PLV1 3ZYBA 1RHI1 3H8OA 3DYMA 4IEVA 2WZR1 4JHTA 1DQ1A 1PO12 2C26A 3I59A 4LO5B 4YM0A 5GZEA 4QX1A 1AR92 5HPOA 1HRI2 3DYOA 5L7OB 4BOWA 1IS5A 1WLDA 5BNNC 4PDWC 2F17A 3X29B 3LDBA 4OFGA 1OQ1A 2W0XA 1QGLA 3VKLA 1HN0A 3WUDA 3U78A 2EALA 3K3OA 3T1LA 1JS9A 2ARBA 2CDPA 5BNPA 5C8CC 4FFGA 4Q4W1 3OGGA 1ZA4A 4PCRA 3SLIA 2VQUA 1Y43B 3MYXA 3SH4A 3A21A 5ANNA 4P9JA 1AR83 3W5NA 1RUI1 3WOGA 3OPZA 1WKYA 4AFBA 4CCMA 1XNBA 1ZBA1 2XQXA 3AB0A 1UKRA 1F4AA 4YM2A 1XPWA 1CD3G 1CVNA 2VD7A 2XHKA 5LEJA 1WMXA 1P8JA 3THCA 1JZ8A 1QJU1 2HWC1 3LSDA 1BMV2 2FMYA 3LCPA 3AL6A 3RMXA 2A3XA 3CZUA 3JU9A 2GU9A 2WSUA 4XYXA 1G86A 4FTEA 5FBJA 2IXKA 4CUGA 3GHNA 5DG1A 5GLWA 5CFDC 2EF6A 2FDHA 2HWE1 3N9LA 4HPKB 4LUKA 3ZSJA 5KBFA 1L7LA 1WW7A 2Q5TA 4LK7A 2A5ZA 1ZREA 1NCQC 1Q8SA 5BNPC 2OZJA 4FSJA 5FUPA 4E2GA 3I3QA 1MEC2 3VD9A 5FPXA 5CFDA 5IK4A 2VZTA 5FZ8A 1VBC2 5BNQA 1NLSA 3WF2A 3WLUA 4CTEA 5IFTA 3H8RA 4AVAA 4AHZA 3IAQA 4AEMA 2V4AA 2ID4A 5IK8A 1W2TA 4HK9A 2Y34A 2C1FA 3IAPA 5FREA 3KGLA 1UKGA 2XUEA 3MLJA 4IE6A 4R8HA 3O1PA 2VVDA 2CGOA 1FATA 1GNYA 1QY4A 1E5IA 2HWB2 3NKTA 2ZAHA 4O61A 1Q8PA 4AF9A 2K0GA 3BI3A 3PMSA 1MZ5A 3FHAA 1TZOA 3HBZA 3BIEA 1ULPA 1O4ZA 2FDJA 4IUGA 4IV1C 5CVRA 5EPAA 4MSVA 4BQXA 5C9AA 4C8DA 1LGNA 1LOAA 2Z5WA 1QOSA 1RUF2 1VBB1 3LAGA 4DY3A 5DZGA 4F7ZA 5CG9A 1UU4A 2WS92 1AXZA 4CCKA 2OS2A 1ZBE2 1QJY3 1ZBE1 1KEXA 2AZ5A 1GP4A 2ZCWA 5F3EA 4E2SA 4H55A 4RGAA 2J22A 4YFZA 5AVAA 3WG1A 5DAVA 2A6WA 3OEAA 4CUAA 2WL1A 1G9AA 1OVSA 1CR7A 3DXUA 2A6ZA 5FYHA 5KR7A 2QFEA 2E7QA 5DDJ3 1ND3A 2GP5A 4AEKA 3BTZA 1B09A 2R0FA 1HW5A 2XLAA 5FZ6A 3ZYIB 4AOCA 3JBG2 1EV12 2K2SA 4X6RB 3ZPOA 4ZPIA 3S30A 2CSGA 4RFRB 5CBLA 1ONAA 1IPSA 4Y22A 3GCXA 1LB2A 5CFDB 1JZ6A 4JCKA 1FNYA 2ZA9A 1V6NA 4XBNA 1Z7S3 2LALA 3AKSA 3HD8B 4QX7A 2R49A 4OZXA 3NNFA 4ZU7A 2UU8A 4HZFA 3ASIA 2IVIB 2W92A 5FOBB 4ZS3A 3HT1A 4A3ZA 2WT2A 5GZGA 2R073 5FLIA 4UT5A 4CDWC 1PVC2 3ZIXA 5I0RA 3DEMA 1T6BX 1UY4A 5IVYA 3AMPA 5FPVA 3I7DA 4OHVA 4B4QA 1KD7A 5C7GA 1LOEA 2Y38A 3M70A 4ZY9A 4XURA 2WNUB 4QDRA 2UWAA 4W8JA 1ZRFA 3FJSA 3ZYJB 3MW4A 2OVUA 4L0PA 2CWSA 4Y20A 3JD71 1PK6C 2QQMA 4QX5A 1BMV1 3JXSA 4KWJA 2PXJA 4I3GA 3FMGA 5FUIA 4NIHA 4G3YC 1JI6A 4XOGA 1RXGA 4FPCA 1ZVFA 4ATFA 3VBOA 1OKOA 3ZXJA 5EIYB 1JYWA 4QDQA 2QQOA 3WP6A 3H50A 3JD73 3K46A 4NPMA 3T0BA 4B8EA 4AAPA 4QHZA 2WWSA 4XPVA 4RSUA 5EQUA 4Q0VA 4A6OA 4COYA 2EIGA 5A6YA 5C70A 4Q4W2 2XONA 1GZ9A 4GMP3 3WNMA 2WC2A 2D3PA 3KM5A 4ZXEA 3WCRA 4YW4A 1ENSA 2MPFA 3HQUA 2ZX0A 1VBD2 4Q8LA 2UY8A 2J7MA 5DXDA 1XNTA 1FNZA 2YHJA 4XILA 4EN0A 2PQQA 4XZUG 5BV6A 1TNFA 1CIYA 1OI6A 4BLJA 3LDRA 4YYOA 3ILNA 3IMMA 2V5DA 1AHSA 4EZHA 2BP6A 1APNA 1RGSA 1J3QA 3CIHA 4CEYC 4CP0A 1QJY2 4UBHA 1AYN1 2VZOA 3MZHA 4UFKA 4D6RA 3IPVB 2RS33 2EAKA 5IVVA 1F35A 2CL2A 2VMFA 2NPIA 3E6BA 3ELNA 1W99A 5F5QA 4ZZ5A 2D7FA 3W58A 4EN7B 4GXLA 3THDA 4MV2A 2BOIA 3I3MA 4M4PA 4BIFA 4MHUA 2OIIA 2RS53 2DCYA 3POYA 2BW8A 1SFPA 1CAVA 4CDXB 1V6OA 2J1AA 2AYHA 4GAZA 3SEPA 2OXBA 2GH8A 4CVUA 1O4TA 1ND3B 3ZYRA 1H0BA 1K5JA 1S0BA 1ND2A 3OPWA 3OGRA 4JDMA 4LO8A 5L7OA 1BQPA 3PUSA 3RZMA 1Z7S2 1OH4A 1RUI3 1ZNPA 4RGGA 2DUQA 2DF7A 5I0UA 3SKVA 2RG4A 3AZXA 3J8F1 3QACA 5FO8B 1DQ6A 1H6XA 3O0VA 2EAAA 2TEPA 1HV1A 3T4HB 4TSVA 5CEHA 3ZXFA 1VBE1 1R64A 2JE9A 4WM8A 3WDTA 3B69A 1PNGA 4E4SA 2C24A 1VBC3 3LD8A 3ES1A 5DPNA 2IWGB 3TOJA 1HB3A 2JDUA 3AKQA 1JODA 4Y1ZA 1KRIA 1CESA 3D0SA 5LATA 2H0VA 5IT6A 1IQDC 3ZFEB 4KGGA 3UT0A 1OPMA 5E6HA 4P9YA 4DOUA 3Q8BA 4KG0A 5ERLA 1OUXA 1BKZA 3TB0A 4HT1T 1OOPB 4K8FA 2HEWF 3ZN6A 1CZSA 1JH5A 1VLNA 3AFKA 1F5JA 2D3SA 2WT1A 3B01A 1R081 2VO5A 5EYXA 4C1XA 1YO8A 1LHWA 4Z1VA 1DGLA 3HT2A 1CJPA 2O14A 5GJ6A 4CDXA 1UY2A 3ZO0B 2NYYA 2E63A 4QU1A 5A3NA 1RUC1 4ZHNA 1BXHA 3PUHA 3RGBA 2LROA 2RM23 1DQ4A 2WFF1 2X5IB 5FBZA 4XETA 4Y1UA 1J1TA 2P3KA 2VNGA 3JD72 5FZGA 2B9VA 4MLOA 5IW0A 3WHTA 2EVXA 4GWIA 3ZXEA 2WDBA 3VZNA 1YFUA 1LOFC 4WBBA 1IS3A 2GAUA 3IDEA 3WNKA 1JZ5A 4MGIE 5FZCA 5A1AA 1GWKA 5IHRA 5AC93 2X53S 1CAVB 1DP0A 3CEWA 1SACA 4LBQB 3RYPA 5CKNA 2JG9C 5JXJA 1OFSA 2L9LA 3AK0A 1FV2A 3WQ0A 1BYHA 2RJ2A 4HKOA 4CEWB 1MZFA 2GNBA 4AXOA 4CU7A 2JE8A 4XAAA 2VM9A 1ZZ7A 2OQ7A 3AP7A 4AHYA 5DAPA 3IDBB 3AC0A 1KITA 4GH4A 5FMOS 4LO6B 4HN1A 1IG3A 3ACLA 3EXUA 2A1XA 2DVFA 2GSYA 1KFXL 2FCUA 4OUSA 3R6SA 2ZMNA 3N36A 5BNOA 5I8TA 4N7UA 4OZOA 1YCIA 4A44A 4QB2A 1S0IA 5GZDA 1NUKA 1AL23 1K3IA 5JLVA 1NY71 1RMU3 1GQPA 2ENRA 3Q8EA 4NIAA 4L92A 1QJU3 2HWC3 2ET1A 3M7AA 4RGKA 3Q8CA 4CDWB 5F2WA 1OA2A 5LWBA 4YZ3A 1X82A 1I1EA 4GMP1 4MXVA 1PIV3 4CDQB 3I2OA 3FFQA 3OPTA 4YZ4A 4ZS2A 1EV13 5K4LA 5JDBA 2BFUS 2GC2A 2VZ1A 2OUHA 4I02A 2WS91 3AKRA 1QXPA 1W2AX 5FDBA 5I0SA 4HVRA 4DB5A 4YVSC 4AI8A 4QXHA 1QHDA 3NV3A 2XJQA 2E53A 3GGLA 1B35B 4UOJA 3WDUA 4YGDA 5JMOA 2YMZA 2YUEA 3T0AA 1POV0 2X09A 3NNMA 4IEWA 2DYCA 3C7OA 1QWRA 5FY5A 2J42A 3DXTA 3WF4A 1BCXA 2A3YA 1RUF1 4C90A 3I2JA 2IZWA 2VXJA 3IDAA 4CU6A 3AKPA 4UFLA 3WXPA 1UN1A 2BNOA 2CGPA 1PIV2 2VPVA 4Q4X3 2Q1FA 4DQAA 1RUG1 5DAQA 5FRAA 3PIJA 1ZM1A 3LIHA 1YFXA 1JN2P 1UIJA 4ZKTB 3EBRA 4H14A 1OLRA 1U5YA 2D43A 5D8AB 5HCFA 2G9GA 3FHIB 3M2MA 1TMF3 4DUVA 3U1XA 5B4NA 1RYYA 4MYEA 5ABJB 1O3RA 2HWB3 4YSFA 3I3DA 4JRLA 2ZXQA 3KV9A 1AR72 2PHUA 3ILFA 4JVAA 3USUA 3SCGA 3W21A 5FKCA 4AVBA 1LOCA 4XZPA 2J1RA 3VBRC 3HJRA 4IL7A 2XG3A 1XSQA 3SXWA 2CTVA 4YM1A 1K5MC 1VAVA 4B1MA 2JJ6A 3TBDA 2W1WA 1OH3A 3USUB 4GWNA 3ETQA 5IK7A 5LBFA 4QQHA 2WNUC 3NL1A 4CDUC 3J4UH 4IDZA 1K12A 1W6MA 3AYEA 3FC0A 4LO4B 3I2GA 4V2WA 2VULA 5K8SA 3POBA 1AJOA 3TEYA 3TN91 1QXJA 4QPWA 2GNDA 2WLPA 1LU2A 4Y33A 2SBAA 2I74A 3DCQA 3UYJA 1YQ5A 5FPZA 2RMU3 3O1VA 4B3NA 4IE0A 1MVEA 3RI9A 2VY0A 3A0KA 2B8MA 5LRRA 1E57A 2HWD3 3FX3A 1ZZ9A 3EB7A 2DVDA 2A6VA 2ERFA 2ZGQA 3KCYA 3OY8B 2Q30A 4QPGC 5GLTA 1PM7A 1UU6A 4DXRA 3HQRA 2FDGA 1ULCA 3D0JA 4YRDA 1G8WA 3U14A 1O4YA 5A3MA 1X36A 3POEA 2MEV3 1AR61 4Q4V1 2ZJCA 4IW3A 1H9PA 1POQA 5F1RA 3L2HA 4JGZC 3U37A 1W2OA 2QE3A 3GZEA 3GBGA 1D7PM 1C5IA 4ET7A 4H7MA 4N53B 2HWB1 3LZZA 5JSPA 2VJXA 2HWD2 3JB4C 3VDCA 1G7YA 2FZ1A 4Q0UA 5FZ4A 1A6CA 1VAMA 4QGLA 1S55A 4XMIA 5CISA 3C7EA 3MLKA 4A3XA 2FCVA 4D6QA 1HRI3 3HR9A 5IVJA 2ZX1A 4Y4RA 1BLZA 2DWRA 1R1A1 3SKJE 3T08A 3E6DA 3WV6A 2PHXA 5FYCA 4AHXA 4CU8A 5FYVA 3D5OA 3L9JT 4B1LA 4LHLA 3FLRA 4CPBA 4CXWA 2QQPA 4CP9A 2DV9A 5C4WC 1XOYA 4QMAA 5LY2A 5F5IA 5BNNB 4OVEA 2EXHA 3H9AA 1H8TB 3RJRA 4QU2A 3UKVA 1CX4A 3INAA 5KC5A 1H2KA 5H9SA 3HOBA 3P1IA 5FZ1A 2CU5A 2JDPA 5L19A 2VW1A 5BXXA 3VBUB 3BN6A 1W9FA 1GNZA 3BYWA 1XU2A 2JDHA 1VMJA 3BALA 3VZMA 4BCUA 4COVA 2WO3A 1HB4A 2KXLA 3ZN4A 1JTZX 5G05L 2DCKA 2VU9A 3ZXLA 4KU8A 2YZ4A 4MVTA 4BMBA 5FYMA 1DGWX 3J7HA 2R16A 4KH9A 3ITQA 3SISA 1UMZA 2PHDA 4C0BA 5FXZA 3AKTA 4QM8A 3THPA 4C91A 1CN1A 1CPNA 2WO2A 4JX0A 4L99A 1VBA3 1W04A 1LHNA 4QXBA 1VBA2 2LRPA 1XYNA 3PJYA 5IUQA 2JICA 1LGBA 5T52A 1WA6X 4AVCA 2ZEYA 3ZFEC 3VDDC 5KHKA 3I3EA 4CXYA 2WJSA 4URAA 1TME3 1W6QA 1MS3A 4TWTA 4YNIA 3N9PA 1E5RA 5A33A 3TEWA 1AX0A 4EN6B 1F2NA 5EJ3A 5AVPA 2PTMA 5FO7B 2OPKA 3VD7A 3N35A 1D4M2 4Q27A 4XFHA 5A6ZA 1AR63 4INDA 1ENRA 4MGYE 4Q4V3 1OA4A 5FP9A 3T2PA 4X8NA 1RUJ3 4P5YA 1W6NA 1UQXA 5K0UA 2D5FA 1A78A 5C8WA 3WZ1A 5FZ7A 4NVPA 1QJU2 2HWC2 2QDNA 4Q1PA 2JDAA 1QF3A 2VNOA 2VR4A 4JTOA 4M00A 4WM8B 1RMU2 3LE0A 1W6OB 1SBEA 2YYOA 4AR2A 2P4EA 3NKGA 5EYYA 1ACCA 1LNSA 3VB9A 4IV3C 1LRHA 5E1RA 1RUH2 2HWF2 5FZOB 4BK4A 1S2EA 1PVC3 3VHOA 4MO3M 4NAMA 5DAXA 1URXA 4AQ2A 4NRPA 4A41A 1R083 1OUSA 1W06A 4AAXA 4D7TA 4JGZB 2AR6A 4AFDA 1RVF3 1V9U3 2RDNA 4OI1A 3DPRC 3EYPA 4BQ2A 4FXGB 5JOWA 2A6YA 4GIQA 4CEYB 1D0HA 1FX5A 3HNYM 3RG0A 5F37A 2YFZA 4LKSA 1PGSA 4HETA 2BV4A 4PDWA 3A23A 4BH9A 2OPWA 2VZUA 1C8NA 1J3RA 2BFUL 2GP3A 2EIBA 3Q8FA 4IGPA 1I3HA 2KM2A 1V6MA 1W9SA 1XNKA 2UWBA 1Q8QA 2RS51 2WO7A 3LWCA 5IYYA 2EICA 2F4PA 4ATEA 4LOSA 5EXOA 2XGXA 1AF9A 1G9CA 4LBLA 1IOAA 1A3KA 4RN5A 4RFT0 1SQ4A 1ZRCA 5CAZA 1C4RA 3ZKYA 5DABA 4YW7A 4A6SA 3ZDSA 4CDUB 1LHOA 2A71A 3UJOA 5I91A 1WMDA 2BYVE 3H7YA 3R4UA 3WNPA 3NJZA 4QGNA 3RZHA 2YC2A 1ENQA 4LBQD 5K0UB 1RUF3 3B9IA 4FFFA 2P6HA 3VZOA 2B7YA 1DG6A 4URTA 4XACA 3C8XA 4AFAA 3UNPA 4JGYC 1NLRA 3M3CA 1ZZ6A 3VN4A 4DZGA 1H1MA 1SLAA 1JBCA 4KQ7A 2IFWA 1ULFA 1Q8OA 1Q5OA 2QDRA 2ZPXA 1RUH1 2HWF1 2ZS6B 1W03A 2UURA 3H3LA 4NHXA 3H1WA 3SQOA 2VZPA 3TNPB 3VLBB 2DBIA 3NJVA 1KQRA 2D5HA 1UZZA 1VBD1 3E1F1 4AFMA 2NQYA 1Q3EA 2VTXJ 2ILMA 1HXS2 4COUA 2C6SA 3FL7A 1E5SA 2WNVA 1ODMA 2VTXA 5BYNA 1VPHA 5EV7A 2JDYA 2ORXA 3ZYHA 1SBDA 4WV8A 1NYWA 1RUH3 2HWF3 2ZGMA 3K51A 1TNRA 1TQ5A 5FIXA 3MF9A 2XVKA 2XBO1 5FZLA 3M1HA 4XFIA 1QQP1 1XNAA 2QZ3A 1JUHA 1UYPA 1GWMA 1ZZBA 1K5MA 1NXD1 3GYDA 4ISQA 1ZRIA 2HYXA 1WUVA 3POFA 4QPIB 5IJRA 4K21A 3SCFA 3VBSB 5I93A 4AVTA 1OSGA 2DFBA 3ROUA 1SEFA 3AP4A 4HSLA 4P9XA 1RUD1 4IQPA 4OUMA 2J1UA 1D4M1 1JMUB 4YM3A 1W8UA 3VBHC 3UJQA 1CJDA 1WCSA 4WVZA 1WCUA 1UZVA 5I8YA 3CBNA 5AFEA 5LA0A 1DQ5A 5JZGA 1HQWA 2R30A 3POJA 1UCXA 4H7LA 2KA3A 4BQYA 3A0NA 4HXCA 5C5TA 1VJ2A 1W2NA 2EXIA 2IVJA 2YGMA 4LOTA 5AC91 5JXIA 1O8SA 4U2AA 2ZX4A 3JCIA 3THTA 1MS8A 3I4IA 4EWAA 2ZGRA 5T5JA 3WNLA 1OOPA 2OQ6A 4D94A 4CEWA 4B4RA 2GALA 1VE0A 4AI1A 2RDRA 2W39A 2R071 4Y1VA 4AHWA 1KFUL 2AEYA 3B93A 3NSTA 4GKXA 4UW3A 4LBQA 1FOD3 4MHRA 4JGZA 1UY1A 3ES4A 2DBNA 2GMMA 1YI9A 2GMPA 2VBPA 3HBKA 3O0XA 4NE9A 1AYM1 3VGIA 5LRSA 5CADA 1AR93 3WHUA 3SC7X 4G9SB 5BNOC 3EO6A 3LB9A 1YRZA 3MW3A 5H9QA 1LEMA 4WZFA 5FR3A 1N3OA 1YJLA 2IXHA 2WA4A 4FPOB 2IXIA 3VKNA 1RVF1 1V9U1 2MHFA 2QQUA 2P5BA 4RHV1 1D0GA 3BU0A 4XTMA 3WG3A 2D6PA 1ND2B 3H8UA 1R1A2 3KVAA 5GKAC 4PIXA 3RQ0A 2XL9A 3OG2A 3PTYA 2FDIA 4PJYA 2RS11 1HLCA 4BPZA 5FO9B 4UXAA 3TN92 4LXLA 2ZGOA 4QGMA 4B7KA 2VW0A 1UYXA 1BEV3 2BOJA 3IMNA 3MIGA 4LIVA 3SMHA 1IQAA 3V0AB 2D3RA 2QQNA 3NVCA 1RUI2 3AVRA 5FK7A 4ES8A 1OKQA 4FI9A 2XVLA 4J25A 3U0ZA 2RS13 5J3UA 4P9IA 3U10A 1NA1B 4XTPA 5EWSA 3BCWA 4XIOA 4LBOA 4QQPA 2W91A 5G04L 1LOBA 3R4DB 4AGRA 1W05A 1Y7BA 4X8PA 4QHOA 1EAH2 2UYAA 2BGCA 1DIWA 3ST7A 1F8VA 3RWNA 4CCNA 1R093 3UETA 3WF1A 1O3TA 3OTFA 1DHKB 3IZOA 5CNAA 2W46A 3N9OA 1RB8G 1AR91 4NUBA 2VH9A 2VXRA 1STMA 4GH4C 4K3UA 4FPJA 4QWNA 4AL9A 5C6CA 4J1WA 1X50A 5FK8A 1OXCA 1FMD1 1F4HA 3WVJA 5ABJA 1QXRA 3MDPA 1K5MB 3WW1A 4AEJA 4Q26A 2XPJA 1ASJ2 1C8M2 3OGSA 4LHNA 4LQRA 5A80A 1NE4A 5D8AA 1PO21 5C71A 1UF2C 2Y64A 2WQ4A 2WWJA 4AEDA 1OMIA 2D6MA 3SNMA 3AXDA 3D4KA 2UYBA 5B2GB 2JKXA 4UFJA 1REDA 1R092 1DYKA 2HWE3 4Q29A 3VBSA 2C5DA 1EAH3 4TLFA 2WNUA 3O1SA 4OI4A 4XUNA 1OURA 5FZ3A 4LE3A 1RHI3 3I3BA 3OD0A 1TG7A 4DMIA 3CL1A 3PVEA 1V70A 1VBB2 2PHRA 1DGRA 5FMBA 1VRH2 2VCCA 2V09A 1RUC3 3SH3A 2BVVA 2GZWA 2RE9A 3B00A 3MO4A 4DUXA 4L97A 3R0RA 1MQTC 4N7IA 4RD7A 3N4MA 2D93A 3OBRA 1COV3 4A4AA 1SFYA 5LBBA 4HONA 1UU5A 3O14A 3AMMA 5F3GA 5E88A 1J58A 2OKXA 4NRMA 5FFOC 1VBE2 1GANA 1GYKA 2NMNA 2PLV3 3A4UA 3NAPB 5FYTA 4LPLA 1LHVA 4XC9A 3VBUC 5AFBA 5ISLA 2W94A 3NO8A 3OJBA 1AYM3 3LDKA 1UX7A 1HN1A 1NQJA 1PZ8A 4H2AA 3D3AA 1HRI1 4SLIA 4CDQC 1S0JA 1Q43A 5T54A 2YPDA 3GZAA 3S57A 2WZR2 4Y20B 3T0DA 1VBC1 5E89A 2AEZA 1H8TC 4P9LA 4L2NA 1QJEA 1VBD3 2EXJA 3ZSMA 4NIGA 2D97A 4N43C 3O1UA 1W39A 2R063 2Z79A 3EQEA 2ADEA 4LTAA 4QB1A 1FOD2 2A73B 1PK6B 3AP9A 3O12A 3ZFGB 2J1VA 4QX2A 2P34A 3WT3A 1UD1A 1ULEA 1YQ8A 3RDIA 5JPMB 4NRQA 3I2HA 4O7XA 4Z2WA 4RR3B 5ACA3 1UZYA 3IM0A 1FI2A 2IXJA 3N9MA 2PHLA 2WYFA 1GZWA 2VZQA 4FOYA 5ANQA 4N9IA 5C8CA 4XJZA 1X8MA 1CAWB 3M3OA 4LKEA 5FYZA 5FXWA 3I2FA 3QOPA 2XJSA 4PDWB 5FP3A 3KF3A 4Y5Z0 1CZVA 3V0AA 3ZYPA 2NM1A 1S0EA 1H8VA 3ORJA 4JZRA 4AEDC 1HRV2 5C5UA 1ZBA2 3KWVA 3LPGA 3CF6E 3VL8A 1KS4A 2KR2A 4PBPA 1JOJA 1FYUA 4NHLA 2VMGA 3VDDB 3WP5A 2XJVA 3IT8A 3KCXA 4QPYA 2BU9A 2R041 4S2HA 2BQPA 3WD5A 4M3CA 1S0FA 3MFCA 4WVMB 1US2A 4M0NA 1SLLA 3USSA 2JX9A 1H1AA 1FPN3 3N7JA 5L73A 3OGJA 4IV3A 4CUBA 1OF4A 3OBZA 3DYPA 2PLV2 1LGCA 5APAA 4HKWA 2PAEA 3B02A 5H9PA 4BDVB 1X9PA 1TEIA 1CAUA 2HLEA 2NN8A 2R061 4CPBD 3ZLIA 5BUVA 2GNTA 2JE7A 3S7IA 2QQJA 2RDSA 2RDQA 3CDZB 3BODA 3DPRB 3POIA 2FD8A 4JTNA 4HPKA 1W6PB 1UY3A 4I0AA 5FJKA 1FOD1 1OVPA 3WQBA 1U5IA 5GLVA 1U0AA 1QDCA 5C9AB 4RYDA 1DLCA 2VL4A 2FCTA 1CPMA 1JYCA 1O8PA 1RUC2 3KT7A 1JOBA 1LODA 4YZ2A 4WVWA 1DGWA 4XJ8A 1BHGA 2V5YA 3BPSA 5A32A 2GNMA 1D4M3 3PUQA 4JDNA 4XUTA 1GUIA 1PK6A 2VZ3A 4K1YA 2PHWA 5JWPA 2K46A 2E51A 1YQ2A 2KD7A 3D6EA 3LFIA 1GZCA 5EZWA 1K45A 3CJIA 2PA7A 4XFCA 3QH7A 5J96B 1N1VA 4OQ8A 4UWDA 4Q4X1 4QDSA 4BQ4A 2RM22 3Q9OA 3LKJA 2OW4A 5F32A 2Q1MA 4O65A 1MS1A 1V6JA 4CP9B 1W8HA 1GZTA 3LFMA 1JYTA 1O59A 4HK8A 4XHXA 1Y3TA 2DCTA 4X6QB 4DXTA 1MS4A 1QOOA 1Y4WA 3UV9A 5F8PA 4DNYA 5FZBA 4IEUA 1OC1A 4LHSA 3IIIA 5HXVA 5IVBA 4NAOA 1UAIA 2WS93 3G7DA 4ARXA 3IIAA 5LCWL 3AX4A 4RQPA 1ND3C 2PN5A 4ES9A 1ZX5A 1POV3 5C9AC 1OBNA 4OLLA 4XW3A 4R9AA 5A3UA 4XJWA 1EV11 1ZYBA 5FAXA 3VBFC 4UFIA 4MGTA 4ZU4A 4MZUA 2ZEWA 5M0TA 2EIDA 4WVVA 1UOJA 2XOMA 4LBKA 1J84A 2B5HA 2JB8A 1Z7S1 4GJZA 4AZZA 1LAJA 2VMEA 2VMCA 3CJIB 1W9YA 2W87A 2ZGKA 3NJYA 1QJX1 2RR11 4MUVA 1YUDA 1B35A 4AI9A 5FQ0A 5J36A 3CU7A 4XDPA 1YHFA 2AUYA 4FFIA 3LOIA 4TLGA 1RUNA 2VUCA 1JYNA 2D40A 3CJIC 4LKDA 1XBFA 2XHNA 3H1MA 3AYCA 1PGL2 4QQLA 1NT0A 2WAOA 4C0HA 4HL0A 2JWPA 1G9DA 4ZONA 4AGVA 2PELA 5FPUA 3CNAA 3MF6A 2E9QA 1MEC3 5CB7A 3VBFB 4BQ5A 4Y1YA 3RZGA 1VRBA 1ZRRA 1JOPA 1SLIA 3RSJA 2A6XA 2DTYA 2RS52 3NNJA 2C9AA 5GLZA 3SCHA 4AEDB 4DY5A 5A6QA 4A7KA 4XXAA 5TSWA 1BEV1 3B3QE 2TNFA 4IE4A 3AM2A 3IDCB 3AVSA 5FZHA 3FHQA 1GP5A 4WVMA 3WX5A 4UW5A 4YVWC 4DRVA 1W2UA 1RUJ1 1W6MB 4AQTA 3POGA 3I2DA 4XJUA 4UW4A 3AZZA 5DUUA 4ZU5A 4QXKA 5FV3A 5IFPA 1EAH1 3H3UA 4PT6A 1CGPA 3ZFGC 3S6PA 4YPJA 4FBFA 2AENA 2YY1A 4YVWA 2AREA 5CFCC 2FQPA 3KVBA 4UFMA 4CYDA 4YZ5A 4CEWC 2R042 4Q4V2 1AR62 1LECA 3UESA 1WCQA 5FMCA 4DRRA 3WDXA 3WR0A 1PHMA 1H2NA 1KJLA 4NWVA 4PQ9A 1SMVA 2Z2SB 3ZR6A 2ZBJA 3PJQA 5DZFA 4YW1A 1HJGA 2ZGUA 4CRQA 2HEYF 4Y24A 3QLQA 5IVCA 2JG8B 4CSWA 3AJZA 1FMD3 5KHGA 4RR3A 5IAXA 2Q8EA 4GWMA 1DF0A 2EA7A 1YIFA 2E31A 4RHV3 1XB9A 4UW6A 5L9BA 2XWJB 2ZEXA 2D44A 3GJAA 4TYSA 5CU1A 4I01A 5EJ1B 1R091 2VBDA 2XMLA 3VD3A 5HCAA 3NV4A 5SV8A 2Q8DA 3M4FA 1RVF2 1V9U2 2QTWB 1SPPB 3PTRB 5A7PA 1QU0A 2WT0A 5LA9A 3JQXA 4JQRA 1UXXX 1MQTB 3VHPA 3R05A 1JZ2A 1LOFA 3ACIA 4UBGA 5JMCA 4YARA 4LO7A 1ASJ1 1C8M1 5FY4A 3KQ4B 1B35C 3RYKA 2BGPA 2ET7A 5T5OA 1JZ7A 1OFNA 2CHHA 3FN9A 1VBE3 2WABA 4TXWA 2WZ8A 1O91A 2VECA 2ZZQA 4FOVA 3WNOA 4EYUA 2YC0A 1H6YA 2W1SA 1GU3A 3OGVA 1AYN2 1SG3A 3GHMA 1CAWA 2DCJA 4FP2A 5FYIA 5LK5A 4KL1A 4E2QA 1DGRN 2WNOA 2HBUA 1AR81 2B9UA 4QQ2A 1CAXB 2ZTNA 1S2BA 3GBWA 1VRH3 1W9WA 2W1QA 4XFBA 5LZ6A 4WM8C 1LR5A 1RITA 2I2SA 3NWKA 2XLFA 3K3NA 1EP0A 1RHI2 3ZFFA 2FDFA 4NIDA 1MEC1 1H4HA 1VP6A 3BTYA 1NKGA 4YGBA 2OX0A 2BZDA 4R9DA 5LA2A 1HIXA 4BE3A 2E32A 4OYUA 1SLCA 1DFQA 2UY9A 1SCRA 4GA9A 3MIHA 5EFUA 3DV8A 2HWE2 2ATFA 2WAAA 3K4ZA 3PNAA 4GH4B 1EPZA 3I8TA 4ARYA 4AVVA 4EZ4A 2E7TA 3WDWA 5ABJC 3UGGA 1PMIA 3K75B 3C7FA 3KF5A 3O7OA 4NOTA 5FQ0B 4E9KA 5BY5A 1A34A 5D8AC 1J1LA 3DECA 4HSJA 5HV4A 1QJX2 2RR12 3PU3A 1PO22 1V0AA 2R1BA 1A8MA 4BQ3A 4MGQA 4IGOA 4LEJA 1CAXA 1GBGA 2CNAA 4GJYA 4P9GA 3HN3A 3WQ7A 4XCBA 4QT6A 2YROA 5A7WB 1DYOA 2ZKLA 1HJFA 4W65A 3D8CA 1FT9A 3TRSB 5FPLA 2OZ6A 1D2QA 1IPJA 1NQDA 2ZX2A 4M4RA 5A6XA 2DVGA 4UFHA 2V73A 4P9WA 1AX2A 1O7FA 4QKBA 3V65A 5JOXA 1QQP3 1W0OA 2VVFA 4BWOA 1RJ7A 2JD9A 3VKFC 2DUPA 1J3PA 2GN3A 4HBNA 3WF0A 1HQLA 5HV0A 2PAMA 2X5IA 3G6JB 2B45X 3S5AA 4Y26A 2WQZC 3WF3A 4YVSB 1AL22 4B4PA 4S2FA 4MADA 5FTTC 5F5AA 3PVNA 1GV9A 1R1ZA 2WNVB 2RJLA 2LW8A 3C3VA 1WLWA 3HPNA 4D6SA 5BNNA 1NA1A 3E97A 4KGQA 1U5ZA 2O8OA 1OOPC 1Y9MA 4OMCA 5A3PA 3HNMA 4DUWA 4FXKB 2PMWB 4IXLA 1FPN1 3QBQA 1ZZCA 1HXS3 4FAGA 4Q0SA 2DFCA 2VAUA 3M3IA 3TN93 3KT4A 1PX3A 5C4WB 4V2VA 3DN7A 4IV3B 1QJFA 2OYZA 4HVOA 3SHRA 2VQTA 1UYYA 3ZIWA 5KC6A 1JZ3A 5IK5A 3FLTA 4ASLA 1IHMA 1T6GC 2JG9A 1EYBA 2WQ8A 1UMHA 4P5HA 4DEVA 4QKDA 1PNFA 2FMDA 2I07B 4IEQA 4N53A 1REFA 5DDJ1 3MPBA 1DLLA 3MW2A 3VDDA 5A3TA 4FO9A
chains in the Genus database with same CATH topology
5LA0A 5EIYB 1JYWA 1CX1A 4QDQA 2QQOA 4P02B 3K46A 3T0BA 2Y6HA 4D0QA 4A6OA 5JXHA 3W5MA 5JXIA 1O8SA 5C70A 5HXMA 2XONA 3WNLA 3WNMA 4ZXEA 3SEEA 1TVGA 2J7MA 4P00B 3VD4A 1XNTA 1I5PA 4XZUG 1CIYA 1GMMA 2E26A 1SHWB 2RVAA 2V5DA 1UY1A 3CIHA 5DQ0A 3IB3A 2VZOA 3HNBM 2VCBA 2Y6KA 4UAPA 1JZ4A 2VMFA 2Y8KA 1W99A 2J1TA 4QX3A 4DXSA 4ZZ5A 1JZ5A 4QX0A 3WEZA 3THDA 3LEKA 4M4PA 1L7QA 1UY0A 2J1AA 3SEPA 3CMGA 4CVUA 3OG2A 3OGRA 1OH4A 1SDDB 3SKVA 1OD3A 4TTGA 1UYXA 4CU9A 1H6XA 2QQNA 1R64A 3T2OA 4AG4A 5CZKA 2WN3A 4FI9A 1UXZA 4KWUA 5DPNA 3ACFA 2VZSA 3LEGA 2W91A 2W5FA 5G04L 1IQDC 4GZ9A 4W4ZA 5J1XA 3VDAA 3ETPA 1PX4A 2J1SA 3UETA 3WF1A 2W46A 3T2QA 1CZSA 5DN2A 2VO5A 2V72A 1F4HA 4HG6B 4E8CA 2VC9A 1UY2A 4XUQA 2BGOA 1NAEA 2EIEA 3PUHA 1MPXA 3CKHA 3OGSA 4A45A 4LQRA 2Z4FA 1K42A 4XVHA 5C71A 2B9VA 2Y64A 4GWIA 2WDBA 3BGAA 1UMIA 3A22A 3WNKA 2WUHA 2JKXA 5A1AA 2VMDA 3ACHA 5IHRA 1PMHX 5JR2A 3ECQA 1UZ0A 1DP0A 4P08A 5JXJA 2L9LA 4XUNA 1W9TA 4BJ0A 3GXUA 3I3BA 1TG7A 2RJ2A 4CU7A 2VCCA 2JE8A 2VM9A 2VTFA 3MO4A 3AC0A 4DUXA 2Y6JA 4JHZA 4JKLA 4A4AA 4OZOA 2OKXA 4A44A 3LPFA 4QB2A 1PMJX 1NUKA 2R7EB 3CQOA 1GOHA 1K3IA 2WO1A 2WZEA 4LPLA 1GQPA 2W94A 4BK5A 1UX7A 1HN1A 3D3AA 1UWWA 1GOFA 3I2IA 1UYZA 4D8MA 3T0DA 3GM8A 1JHJA 2Y6LA 2C9KA 3ACGA 2VZ1A 1T2XA 2WN2A 4XUOA 4QB1A 3GGLA 2J1VA 4QX2A 4Z2AA 4UOJA 5JMOA 3MV11 3T0AA 3I2HA 2X09A 3WF4A 3C7OA 3OB8A 1J83A 2VZQA 3I2JA 3IDAA 4CU6A 1CZTA 3I2FA 3MUY1 4JKMA 1CZVA 2QQLA 5CYYA 3LPGA 4XUPA 2BERA 5F7UA 4DUVA 5B4NA 1RYYA 1KGYA 2W3JA 3I3DA 2ZXQA 1EUUA 1JYXA 1US2A 2J1RA 3HJRA 4KMQA 2CDOA 4CUBA 1OF4A 2VOTA 3LQCA 3DYPA 1XC6A 4BDVB 5DMYA 2W1WA 2HLEA 4W50A 2QQJA 3CDZB 2QQIA 4OUEA 4ZZ8A 1K12A 1UY3A 3P6BA 3C7GA 3I2GA 3WQBA 4DEQA 4RYDA 1DLCA 2VL4A 1O8PA 2PQSA 4QPWA 1OT5A 1BHGA 3HEIA 5JXGA 3I2KA 1GUIA 3NNGA 2VZ3A 4XUTA 1EUTA 2KD7A 1YQ2A 2QBXA 2W1UA 3GDBA 1K45A 3EB7A 4QDSA 4DXRA 4QB6A 1W0NA 1O59A 2X10A 4DXTA 2W47A 4LHSA 1JU3A 3IIIA 5LCWL 4ARXA 3U37A 3F2ZA 2B4KA 2J1EA 1D7PM 4ET7A 1NX9A 3NQHA 2VJXA 2V4VA 2ZEWA 3VDCA 2EIDA 2LS6A 2XOMA 1J84A 3C7EA 3C7HA 2VMEA 2VMCA 2W87A 1GOGA 3VD5A 2WYSA 2Y6GA 3SKJE 3T08A 1ULOA 4CU8A 4A42A 2DDUA 1JYNA 2XHNA 4OMDA 5JUVA 2WAOA 4KI5M 3MV01 4GWJA 3OBAA 2BBAA 3NJXA 3A7QA 1W8NA 1JU4A 2QQKA 3HOBA 3P1IA 1OF3A 2VZVA 3DYMA 3BN6A 2C26A 1L7RA 4QX1A 5HPOA 3DYOA 3FHQA 2WO3A 5G05L 2DCKA 3VDBA 3K77A 5IFPA 2CDPA 2WBKA 4PT6A 4YPJA 2VQUA 3J7HA 3A21A 3K4AA 2WO2A 4JX0A 3UESA 1WCQA 3W5NA 1WKYA 2XQXA 1F4AA 1XPWA 3I97A 3NRUA 3PUIA 2YFUA 2ZEYA 3I3EA 2W95A 4UI9L 1P8JA 3THCA 1JZ8A 2E31A 2ZEXA 4PQQA 3ZM8A 3VD7A 5EJ1B 3CZUA 3VD3A 3T2PA 3ABZA 4P5YA 1UXXX 3OEBA 1JZ2A 3ACIA 2JDAA 2ZEZA 2VR4A 2BGPA 3LE0A 1JYVA 1JZ7A 3VD9A 3FN9A 2VZTA 5IFTA 2WABA 3WF2A 4TXWA 2WZ8A 3IAQA 4JKKA 1LNSA 4PF1A 2ID4A 3WNOA 4BK4A 1H6YA 2W1SA 1GU3A 3OGVA 3IAPA 4MO3M 1SG3A 2DCJA 2RV9A 4A41A 4AAXA 1GNYA 3WNNA 1W9WA 2W1QA 3EYPA 3T09A 4MOAA 3HNYM 3FHAA 2YFZA 4LKSA 1ULPA 4IUGA 1NKGA 3A23A 2BZDA 5B4XA 2VZUA 5LA2A 4MGSA 2E32A 4OYUA 3MUZ1 2X05A 2EIBA 2WAAA 1W9SA 3K4ZA 4ARYA 5IYYA 3CZJA 2EICA 3K75B 3C7FA 4CUCA 1KEXA 4RN5A 5EJZB 2J22A 3K4DA 3DECA 3OEAA 4CUAA 4MGQA 3HN3A 1US3A 3WNPA 2W9XA 2YC2A 1DYOA 5LA1A 4M4RA 3UNPA 3C8XA 2YG0A 2JD9A 4E8DA 3WF0A 1JZ6A 3WF3A 4MADA 2VZPA 3NJVA 3LEIA 2LW8A 3E1F1 3HPNA 2W92A 1W8OA 4A3ZA 4QAWA 3FL7A 4OMCA 2ORXA 3HNMA 4DUWA 1UY4A 2YC4A 2VCAA 4BXSV 2E33A 1PX3A 2C4XA 5C7GA 4ZY9A 4XURA 4QDRA 2VQTA 4W8JA 1XNAA 3WSOA 1UYYA 1JZ3A 2YB7A 5IJRA 4L0PA 2HYXA 5I0DA 2VZRA 2WQ8A 1UMHA 2QQMA 3MBWA 4DEVA 3JXSA 2ORZA 5FUIA 1JI6A 2J1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LA0 A;  5EIY B;  1JYW A;  1CX1 A;  4QDQ A;  2QQO A;  4P02 B;  3K46 A;  3T0B A;  2Y6H A;  4D0Q A;  4A6O A;  5JXH A;  3W5M A;  5JXI A;  1O8S A;  5C70 A;  5HXM A;  2XON A;  3WNL A;  3WNM A;  4ZXE A;  3SEE A;  1TVG A;  2J7M A;  4P00 B;  3VD4 A;  1XNT A;  1I5P A;  4XZU G;  1CIY A;  1GMM A;  2E26 A;  1SHW B;  2RVA A;  2V5D A;  1UY1 A;  3CIH A;  5DQ0 A;  3IB3 A;  2VZO A;  3HNB M;  2VCB A;  2Y6K A;  4UAP A;  1JZ4 A;  2VMF A;  2Y8K A;  1W99 A;  2J1T A;  4QX3 A;  4DXS A;  4ZZ5 A;  1JZ5 A;  4QX0 A;  3WEZ A;  3THD A;  3LEK A;  4M4P A;  1L7Q A;  1UY0 A;  2J1A A;  3SEP A;  3CMG A;  4CVU A;  3OG2 A;  3OGR A;  1OH4 A;  1SDD B;  3SKV A;  1OD3 A;  4TTG A;  1UYX A;  4CU9 A;  1H6X A;  2QQN A;  1R64 A;  3T2O A;  4AG4 A;  5CZK A;  2WN3 A;  4FI9 A;  1UXZ A;  4KWU A;  5DPN A;  3ACF A;  2VZS A;  3LEG A;  2W91 A;  2W5F A;  5G04 L;  1IQD C;  4GZ9 A;  4W4Z A;  5J1X A;  3VDA A;  3ETP A;  1PX4 A;  2J1S A;  3UET A;  3WF1 A;  2W46 A;  3T2Q A;  1CZS A;  5DN2 A;  2VO5 A;  2V72 A;  1F4H A;  4HG6 B;  4E8C A;  2VC9 A;  1UY2 A;  4XUQ A;  2BGO A;  1NAE A;  2EIE A;  3PUH A;  1MPX A;  3CKH A;  3OGS A;  4A45 A;  4LQR A;  2Z4F A;  1K42 A;  4XVH A;  5C71 A;  2B9V A;  2Y64 A;  4GWI A;  2WDB A;  3BGA A;  1UMI A;  3A22 A;  3WNK A;  2WUH A;  2JKX A;  5A1A A;  2VMD A;  3ACH A;  5IHR A;  1PMH X;  5JR2 A;  3ECQ A;  1UZ0 A;  1DP0 A;  4P08 A;  5JXJ A;  2L9L A;  4XUN A;  1W9T A;  4BJ0 A;  3GXU A;  3I3B A;  1TG7 A;  2RJ2 A;  4CU7 A;  2VCC A;  2JE8 A;  2VM9 A;  2VTF A;  3MO4 A;  3AC0 A;  4DUX A;  2Y6J A;  4JHZ A;  4JKL A;  4A4A A;  4OZO A;  2OKX A;  4A44 A;  3LPF A;  4QB2 A;  1PMJ X;  1NUK A;  2R7E B;  3CQO A;  1GOH A;  1K3I A;  2WO1 A;  2WZE A;  4LPL A;  1GQP A;  2W94 A;  4BK5 A;  1UX7 A;  1HN1 A;  3D3A A;  1UWW A;  1GOF A;  3I2I A;  1UYZ A;  4D8M A;  3T0D A;  3GM8 A;  1JHJ A;  2Y6L A;  2C9K A;  3ACG A;  2VZ1 A;  1T2X A;  2WN2 A;  4XUO A;  4QB1 A;  3GGL A;  2J1V A;  4QX2 A;  4Z2A A;  4UOJ A;  5JMO A;  3MV1 1;  3T0A A;  3I2H A;  2X09 A;  3WF4 A;  3C7O A;  3OB8 A;  1J83 A;  2VZQ A;  3I2J A;  3IDA A;  4CU6 A;  1CZT A;  3I2F A;  3MUY 1;  4JKM A;  1CZV A;  2QQL A;  5CYY A;  3LPG A;  4XUP A;  2BER A;  5F7U A;  4DUV A;  5B4N A;  1RYY A;  1KGY A;  2W3J A;  3I3D A;  2ZXQ A;  1EUU A;  1JYX A;  1US2 A;  2J1R A;  3HJR A;  4KMQ A;  2CDO A;  4CUB A;  1OF4 A;  2VOT A;  3LQC A;  3DYP A;  1XC6 A;  4BDV B;  5DMY A;  2W1W A;  2HLE A;  4W50 A;  2QQJ A;  3CDZ B;  2QQI A;  4OUE A;  4ZZ8 A;  1K12 A;  1UY3 A;  3P6B A;  3C7G A;  3I2G A;  3WQB A;  4DEQ A;  4RYD A;  1DLC A;  2VL4 A;  1O8P A;  2PQS A;  4QPW A;  1OT5 A;  1BHG A;  3HEI A;  5JXG A;  3I2K A;  1GUI A;  3NNG A;  2VZ3 A;  4XUT A;  1EUT A;  2KD7 A;  1YQ2 A;  2QBX A;  2W1U A;  3GDB A;  1K45 A;  3EB7 A;  4QDS A;  4DXR A;  4QB6 A;  1W0N A;  1O59 A;  2X10 A;  4DXT A;  2W47 A;  4LHS A;  1JU3 A;  3III A;  5LCW L;  4ARX A;  3U37 A;  3F2Z A;  2B4K A;  2J1E A;  1D7P M;  4ET7 A;  1NX9 A;  3NQH A;  2VJX A;  2V4V A;  2ZEW A;  3VDC A;  2EID A;  2LS6 A;  2XOM A;  1J84 A;  3C7E A;  3C7H A;  2VME A;  2VMC A;  2W87 A;  1GOG A;  3VD5 A;  2WYS A;  2Y6G A;  3SKJ E;  3T08 A;  1ULO A;  4CU8 A;  4A42 A;  2DDU A;  1JYN A;  2XHN A;  4OMD A;  5JUV A;  2WAO A;  4KI5 M;  3MV0 1;  4GWJ A;  3OBA A;  2BBA A;  3NJX A;  3A7Q A;  1W8N A;  1JU4 A;  2QQK A;  3HOB A;  3P1I A;  1OF3 A;  2VZV A;  3DYM A;  3BN6 A;  2C26 A;  1L7R A;  4QX1 A;  5HPO A;  3DYO A;  3FHQ A;  2WO3 A;  5G05 L;  2DCK A;  3VDB A;  3K77 A;  5IFP A;  2CDP A;  2WBK A;  4PT6 A;  4YPJ A;  2VQU A;  3J7H A;  3A21 A;  3K4A A;  2WO2 A;  4JX0 A;  3UES A;  1WCQ A;  3W5N A;  1WKY A;  2XQX A;  1F4A A;  1XPW A;  3I97 A;  3NRU A;  3PUI A;  2YFU A;  2ZEY A;  3I3E A;  2W95 A;  4UI9 L;  1P8J A;  3THC A;  1JZ8 A;  2E31 A;  2ZEX A;  4PQQ A;  3ZM8 A;  3VD7 A;  5EJ1 B;  3CZU A;  3VD3 A;  3T2P A;  3ABZ A;  4P5Y A;  1UXX X;  3OEB A;  1JZ2 A;  3ACI A;  2JDA A;  2ZEZ A;  2VR4 A;  2BGP A;  3LE0 A;  1JYV A;  1JZ7 A;  3VD9 A;  3FN9 A;  2VZT A;  5IFT A;  2WAB A;  3WF2 A;  4TXW A;  2WZ8 A;  3IAQ A;  4JKK A;  1LNS A;  4PF1 A;  2ID4 A;  3WNO A;  4BK4 A;  1H6Y A;  2W1S A;  1GU3 A;  3OGV A;  3IAP A;  4MO3 M;  1SG3 A;  2DCJ A;  2RV9 A;  4A41 A;  4AAX A;  1GNY A;  3WNN A;  1W9W A;  2W1Q A;  3EYP A;  3T09 A;  4MOA A;  3HNY M;  3FHA A;  2YFZ A;  4LKS A;  1ULP A;  4IUG A;  1NKG A;  3A23 A;  2BZD A;  5B4X A;  2VZU A;  5LA2 A;  4MGS A;  2E32 A;  4OYU A;  3MUZ 1;  2X05 A;  2EIB A;  2WAA A;  1W9S A;  3K4Z A;  4ARY A;  5IYY A;  3CZJ A;  2EIC A;  3K75 B;  3C7F A;  4CUC A;  1KEX A;  4RN5 A;  5EJZ B;  2J22 A;  3K4D A;  3DEC A;  3OEA A;  4CUA A;  4MGQ A;  3HN3 A;  1US3 A;  3WNP A;  2W9X A;  2YC2 A;  1DYO A;  5LA1 A;  4M4R A;  3UNP A;  3C8X A;  2YG0 A;  2JD9 A;  4E8D A;  3WF0 A;  1JZ6 A;  3WF3 A;  4MAD A;  2VZP A;  3NJV A;  3LEI A;  2LW8 A;  3E1F 1;  3HPN A;  2W92 A;  1W8O A;  4A3Z A;  4QAW A;  3FL7 A;  4OMC A;  2ORX A;  3HNM A;  4DUW A;  1UY4 A;  2YC4 A;  2VCA A;  4BXS V;  2E33 A;  1PX3 A;  2C4X A;  5C7G A;  4ZY9 A;  4XUR A;  4QDR A;  2VQT A;  4W8J A;  1XNA A;  3WSO A;  1UYY A;  1JZ3 A;  2YB7 A;  5IJR A;  4L0P A;  2HYX A;  5I0D A;  2VZR A;  2WQ8 A;  1UMH A;  2QQM A;  3MBW A;  4DEV A;  3JXS A;  2ORZ A;  5FUI A;  1JI6 A;  2J1U A; 
#chains in the Genus database with same CATH topology
 3ILR A;  1OLM E;  1BBT 1;  1RIR A;  1UX6 A;  4CCE A;  4AYU A;  1GQH A;  4XCA A;  1PGL 1;  5JIU A;  1IZ3 A;  2LUW A;  2OA2 A;  3JQW A;  1Q56 A;  3GNE A;  2A3W A;  2YU1 A;  3RNS A;  5J37 A;  1WZX A;  4D0Q A;  5KXC A;  1NA1 C;  1YFY A;  4CCC A;  2RHP A;  2Y33 A;  2Y6F A;  5JR7 B;  2ZKN A;  4FVV A;  4UF0 A;  5HXM A;  4COZ A;  5JZG C;  5DUX A;  1XYO A;  2RMU 2;  3NAP C;  4OI2 A;  2Q8C A;  3SEE A;  4AI0 A;  1JXN A;  4AW7 A;  4XBL A;  3VD4 A;  5I0T A;  5IAT A;  4YZ1 A;  1I5P A;  3UK9 A;  2XL7 A;  4K40 A;  1TME 2;  3LA3 A;  5KHJ A;  5KXD A;  1V6L A;  2ARC A;  5FWJ A;  3CLP A;  2E26 A;  4NWW A;  2BEO A;  3RWK X;  3AMN A;  5DQ0 A;  2BRT A;  3AL5 A;  4WM7 B;  2BTV C;  3HNB M;  3OUJ A;  3O1O A;  1H4G A;  5F2S A;  5FZO A;  2UWC A;  1YNA A;  1JZ4 A;  1V6I A;  3APB A;  2Y8K A;  4CCD A;  3ZOI A;  2J1T A;  5J7M A;  1JUI A;  2F4L A;  2Z69 A;  3JB8 A;  2JDZ A;  5FZF A;  4J6G A;  4QX0 A;  3WEZ A;  3KB5 A;  5FZM A;  4DXS A;  5KXB A;  2Y0O A;  3LEK A;  1WBF A;  3KGZ A;  1NE6 A;  1I6X A;  1QJZ A;  1YEW A;  1VB4 A;  3S7E A;  1QH6 A;  2X8K A;  4NJ4 A;  3CMG A;  2JXA A;  2QZ2 A;  2VW2 A;  3OOX A;  5D1I A;  5A7W A;  3ZXD A;  4K8R B;  2P2K A;  4PLO A;  5C4W A;  3N7K A;  4RQP B;  3WQ1 A;  4IV1 B;  2GC1 A;  3U4X A;  3NAP A;  1IS4 A;  1HX6 A;  2XQR A;  1SLB A;  1WCK A;  3LGR A;  3FZ3 A;  1RL3 A;  4FPY A;  4Q1R A;  3ZXA C;  5A1F A;  1QQP 2;  2LTN A;  2JDN A;  5L9V A;  3T2O A;  5CZK A;  1DZT A;  1RUE 2;  1D2S A;  1UXZ A;  2RS3 2;  1NG0 A;  2WN3 A;  2ZX3 A;  3I54 A;  4KWU A;  5FP8 A;  2ZML A;  2VZS A;  3Q8A A;  4KBB A;  4E4H A;  2Y0I A;  2LM3 A;  4AVS A;  5FKB A;  1IKP A;  2PHT A;  2W5F A;  4GZ9 A;  2WKK A;  3E5U A;  2C0Z A;  4BYY A;  4CP2 A;  3CO2 A;  3ZKU A;  4ASK A;  4W4Z A;  4M3C E;  2K9Z A;  1PO2 3;  4IET A;  5J1X A;  2VNR A;  3DF0 A;  3ETP A;  5CKM A;  4JGY A;  3P3N A;  2J1S A;  2RM2 1;  2WFF 3;  4XEZ A;  4QPG A;  2GH2 A;  1QKQ A;  1RUO A;  4HOO A;  2G9F A;  4YGC A;  3AZY A;  3URF A;  3KMH A;  4TN7 A;  3AJY A;  3SIT A;  4AI3 A;  2P3J A;  4KU7 A;  3W20 A;  5A7S A;  1DQ0 A;  4Q4W 3;  3U4S A;  1IGO A;  2V72 A;  1WD3 A;  4QPI C;  2VC9 A;  1XRU A;  4XUQ A;  2EIE A;  3GZU C;  1W8Z A;  2H6C A;  1MPX A;  1G6N A;  1NCR C;  4BHP A;  4A45 A;  4ISR A;  2Z4F A;  3P5B A;  3RZZ A;  3AYA A;  4F83 A;  4Q5O A;  1K42 A;  1NCR B;  5JVV A;  3I59 B;  1UW8 A;  4K1Z A;  5A7N A;  2A70 A;  1X7N A;  4QPG B;  1LCL A;  4LA2 A;  3WW2 A;  3BGA A;  3WG2 A;  3OBT A;  2MEV 2;  3HWJ A;  1MAC A;  1VIW B;  4I09 A;  3RS6 A;  3AZV A;  1X9T A;  4LUM A;  3ACH A;  2VUJ A;  4FPE A;  1XXN A;  1PMH X;  2ZGL A;  5JR2 A;  3FLP A;  2HEV F;  2QQV A;  3J7N A;  1XE0 A;  1I5Z A;  3OY8 A;  1EY2 A;  4CCJ A;  4CDU A;  2IUW A;  2VGD A;  4JQT A;  5IVF A;  1W9T A;  4E4Z A;  4QHB A;  4DFS A;  5A32 B;  3VKM A;  2XXZ A;  4JC1 A;  3LEM A;  2VTF A;  3PVB B;  5HI0 A;  2QVS B;  2Y60 A;  1OPO A;  2YGL A;  2Y6J A;  4JHZ A;  1N1S A;  4W6X A;  1H30 A;  3ZXK A;  1XJA A;  1W6P A;  3LSE A;  4BZ4 A;  4PLN A;  3RZL A;  5FJH A;  1AL0 G;  4B7E A;  3ZR5 A;  3KQR A;  3QH6 A;  3TEX A;  3UGF A;  5FLH A;  5C3R A;  1MZ6 A;  2CWM A;  2R7E B;  3ZFG A;  5FZI A;  2WZE A;  1IKQ A;  1HRV 1;  4YVW B;  3MI8 A;  1GR3 A;  2RMU 1;  2ZZJ A;  3W9A A;  4BK5 A;  3RPQ A;  2PAK A;  4PHZ A;  4RS5 A;  5FOJ B;  1UWW A;  1GIC A;  2Q4S A;  5A70 A;  1GFF 2;  1H2L A;  3I2I A;  5FZ9 A;  1BK1 A;  1UYZ A;  3OUI A;  4IEX A;  4WM7 A;  4D8M A;  3U07 A;  4R4Z A;  1YYN A;  1OQD A;  2Y6L A;  2TBV A;  3ACG A;  1KS5 A;  3NW4 A;  5DDJ 2;  3GCW A;  4RS5 C;  3T3Y A;  1YLL A;  5CA6 A;  3ZN6 B;  4COW A;  3HMY A;  1T2X A;  3H1Y A;  4XUO A;  3LF7 A;  4HFS A;  1QOT A;  3N9Q A;  4FOQ A;  4WM7 C;  3WG4 A;  1BZW A;  1BBT 2;  4Z2A A;  3BTX A;  3DUI A;  5A33 B;  3FUO A;  4P14 A;  3ZFE A;  2JIJ A;  3OB8 A;  4HLT A;  1UPS A;  3UL2 A;  2ZHK A;  4XJA A;  1E5H A;  1G9F A;  2XLG A;  1RXF A;  4YW3 A;  5GZC A;  2HH9 A;  1GNH A;  4QKN A;  1CZT A;  2Y26 A;  4I0W B;  3U11 A;  3MUY 1;  3TWI A;  3AXE A;  1HB1 A;  3MGU A;  4Q0P A;  4BM8 A;  3ZDV A;  1C28 A;  2JB4 A;  1W6Q B;  2BER A;  1VMF A;  1AVB A;  2ZAB A;  2VMI A;  3OCP A;  2NP0 A;  5F7U A;  1SDW A;  4L8Q A;  4LOR A;  5FCC A;  5J98 B;  2BPA 2;  1KGY A;  2W3J A;  4EN9 B;  2XWB B;  2P3I A;  2CGN A;  4GUL A;  2XUM A;  2CAU A;  3JBG 1;  3NV2 A;  5DUV A;  5FZ0 A;  4HVQ A;  1S0C A;  2JDK A;  4Q0Q A;  2VOT A;  3T1M A;  3EHK A;  4YLZ A;  3BKZ A;  4TZD A;  2XJU A;  3MIE A;  4DIN B;  4OHY A;  4JGY B;  2P1B A;  1XC6 A;  2ZAC A;  3BOP A;  5HCH A;  5FYY A;  4W50 A;  2MNG A;  3ZYF A;  2QQI A;  2XB6 C;  4KWK A;  3P6B A;  5FLJ A;  3E6C C;  1Z0H A;  3C7G A;  1NCQ A;  1EPW A;  3RVH A;  1XYP A;  5EHD A;  5LAS A;  3WCS A;  5L7O C;  4IEY A;  3ZFF C;  4LIU A;  3S5Q A;  1ALY A;  5DG2 A;  4W6W A;  5FYB A;  4NII A;  2GDF A;  3NNG A;  4QX8 A;  3NNL A;  1IG0 A;  2DCZ A;  2W1U A;  5LW9 A;  5T55 A;  1FXZ A;  1QH7 A;  1W0P A;  1UNB A;  1UZW A;  3FBM A;  4RHV 2;  5F5C A;  1H8T A;  5BNP B;  5T5P A;  3H0O A;  2QQW A;  4JRA A;  2ZHN A;  4QD2 A;  5A3O A;  2HWD 1;  3DPR A;  2VQ0 A;  4FT8 A;  4XFA A;  5FYS A;  2XKO A;  5JSR A;  1D4V B;  2X10 A;  5JCT A;  2OUJ A;  2CY6 A;  1VAL A;  1S0D A;  5FXV A;  2WWU A;  1AR8 2;  4HKL A;  4PI0 A;  5A3W A;  4OCT A;  1JU3 A;  2QJV A;  2TUN A;  5GZF A;  2XH6 A;  4F8A A;  5ACA 2;  4CEY A;  1YC6 1;  2HJI A;  2JIG A;  2ZHM A;  1HDK A;  3E5Q A;  3ENR A;  4KG8 A;  2B4K A;  2J1E A;  2B42 B;  3RFR A;  1NX9 A;  1AL2 1;  3NQH A;  4RA0 A;  5BNO B;  1DU3 D;  4NO4 A;  5ACA 1;  4R9B A;  1MQT A;  2LS6 A;  2XJT A;  2GN7 A;  1UOG A;  4NN0 A;  4R4X A;  4Z07 A;  2P6C A;  1PIV 1;  3LIG A;  1LHU A;  1PO1 1;  2Q0A A;  4JAA A;  3IWZ A;  2DTW A;  3VBR B;  1N1Y A;  1X33 A;  1ULO A;  1PGW 1;  4A42 A;  1FV3 A;  1O3Q A;  2OT7 A;  3WUC A;  4EWD A;  1I9R A;  3O1R A;  1GKB A;  5C8C B;  1W3X A;  4KI5 M;  1SZB A;  3MEP A;  3N7M A;  3MV0 1;  4GWJ A;  4IEP A;  1C1F A;  4OHX A;  4UYB A;  3MPP G;  1N47 A;  3NJX A;  4LNV A;  3ZX7 A;  1C3H A;  3A7Q A;  2QQK A;  4ORF A;  4N53 C;  4GQ7 A;  2Q8O A;  1OF3 A;  2ADD A;  5KXE A;  4Z92 B;  3EMR A;  3BVC A;  3T2T A;  3V56 A;  1KXG A;  1OQE A;  2IXL A;  2WRA A;  3J8F 3;  3BPZ A;  2DUO A;  4AE2 A;  3UKN A;  4UF0 B;  1L7R A;  2JEC A;  2ZGP A;  5FMO L;  1OA3 A;  4GMP 0;  1VBB 3;  3KHB A;  1DCS A;  4BIS A;  5C33 A;  3V64 A;  3BB6 A;  4M3C B;  4PLM A;  4DPN A;  3FWE A;  1W28 A;  3VDB A;  1YI7 A;  4M01 A;  3K77 A;  2ZOE B;  4D69 A;  4FPL A;  4LKF A;  4YW6 A;  2WBK A;  2JD4 A;  3J9S A;  2E6V A;  2O8Q A;  2W68 A;  5I8S A;  5JIA A;  1W3V A;  4Q4X 2;  1RUG 2;  3K4A A;  5FXX A;  3AFG A;  3VV1 A;  2R6Q A;  2QNK A;  2VG9 A;  3IN9 A;  4ASM B;  4NHY A;  5LEK A;  3AMQ A;  4L11 A;  2DU1 A;  1JW6 A;  3I97 A;  1W6N B;  3NRU A;  3PUI A;  4J1X A;  1GZW B;  2CYF A;  2YFU A;  3TNQ A;  4LIT A;  3V0B B;  1JYI A;  4BB3 A;  2G19 A;  5J09 A;  2W95 A;  4UI9 L;  3NMB A;  3UGH A;  4YFW A;  5DUW A;  3N9N A;  4YVS A;  5FZA A;  4A7Z A;  3VZJ A;  4Y1X A;  5A7O A;  1ENX A;  2R1D A;  3M8L A;  4PQQ A;  3ZM8 A;  1F31 A;  2DU0 A;  3B5L B;  3HQX A;  1AX1 A;  1KDM A;  1NCR A;  1WBL A;  4CE8 A;  4XDO A;  5JSO A;  4IEZ A;  3MIF A;  3ABZ A;  3RYR A;  1UIK A;  2XJR A;  1COV 2;  4U36 A;  2GC3 A;  3OEB A;  2JEM A;  3OF1 A;  1ULD A;  4XF3 A;  2YV8 A;  1NZI A;  1BVV A;  1VBA 1;  2YBK A;  2Z42 A;  1SBF A;  1YFW A;  3S0M A;  2ZEZ A;  2BUK A;  4MXW A;  4YW2 A;  5FZE A;  2P17 A;  1WMF A;  3PLQ A;  2WFP A;  2VVE A;  4OHW A;  2GC0 A;  4LUL A;  4RL7 A;  1JYV A;  4G4F A;  1POV 1;  3FFZ A;  4ONU A;  1N1T A;  5HCB A;  3VZK A;  3WDY A;  4CDW A;  4MG2 A;  4KBZ A;  4I30 A;  1N3P A;  4JKK A;  4EE2 A;  3OD4 A;  1R08 2;  4PF1 A;  5IWF A;  1PO1 3;  4MXW B;  5IVE A;  4NHK A;  4QM9 A;  4NPL A;  5LBC A;  5F6L B;  4ERO A;  2RV9 A;  1AYN 3;  2IFR A;  1WLT A;  2CV6 A;  3POW A;  5A7Q A;  5HBA A;  4FFH A;  3PUR A;  1WME A;  3BIW E;  3WNN A;  3RZK A;  4MX3 A;  3T09 A;  1CIW A;  4M0H A;  1GLH A;  3B7M A;  4IER A;  4MOA A;  3N7L A;  1O3S A;  1R1A 3;  1S4C A;  2X5I C;  4LA3 A;  1C57 A;  5LBE A;  3HN1 A;  3ZMN A;  1HKD A;  2R32 A;  2DUR A;  4FCA A;  4FQ4 A;  4R52 A;  5B4X A;  4N9H A;  2ZHL A;  4MGS A;  4Y3O A;  3MUZ 1;  2X05 A;  4EN8 B;  4O9E A;  3KV6 A;  1AJK A;  2O0O A;  1H1I A;  1HB2 A;  4DXZ A;  3CZJ A;  4CCO A;  5GM0 A;  4Y5T A;  2W08 A;  1NOV A;  1O6U A;  4CDQ A;  2EXK A;  1MZE A;  2ARA A;  1UO9 A;  1XNC A;  1RIN A;  2ZMK A;  4CUC A;  1W90 A;  5C3O A;  5JAX A;  5EJZ B;  5FY0 A;  3P3P A;  1A8D A;  1WW5 A;  1UPI A;  2SLI A;  3K4D A;  1U12 A;  1V00 A;  3W59 A;  2IC1 A;  2GME A;  1VAK A;  4K6B A;  4Y5S A;  5F39 A;  4ITC A;  5EP9 A;  4DS0 A;  2DVA A;  2QCS B;  2WSV A;  4XFG A;  5IAV A;  1US3 A;  3JBG 3;  5FMD A;  2MEV 1;  5FP7 A;  4M3C F;  1QMJ A;  3RMY A;  2W9X A;  3M3Q A;  5KHH A;  3PL0 A;  5FY7 A;  4CXX A;  4A7Y A;  3RI8 A;  5LA1 A;  2YBS A;  3J7M A;  3PHM A;  4YG0 A;  2IXC A;  2WFF 2;  2R04 3;  4PBO A;  3WDV A;  3QD6 A;  2WLQ A;  2WZR 3;  2YG0 A;  2CAV A;  3ALQ A;  4JDO A;  1BBT 3;  1YJK A;  4MGZ E;  3H3Z A;  4BXF A;  5F6K A;  5LB6 A;  2NMO A;  4E8D A;  4BIO A;  4EJR A;  3RJ2 X;  3GZT B;  4JV4 A;  5A1L A;  1MS5 A;  4PI2 A;  2P37 A;  1ZBE 3;  2XKP A;  2JG9 B;  1QNY A;  3LEI A;  4CDX C;  2P3Y A;  2XJP A;  3AZW A;  5F3C A;  4V1P A;  3KV5 A;  1YIP A;  1W8O A;  3JZV A;  4XHB A;  4QAW A;  2VUA A;  3ZN5 A;  5JI9 A;  4XXP A;  4Q8K A;  2H6B A;  2YC4 A;  4FTB A;  1PZ7 A;  2G1M A;  2VCA A;  1F5F A;  2ZGS A;  3PUA A;  4BXS V;  1GSL A;  2E33 A;  4Y22 B;  2C4X A;  2O1Q A;  2RS3 1;  3AP5 A;  3RRD A;  1JHN A;  3WSO A;  1J59 A;  1LOG A;  1TE1 B;  2YB7 A;  3GF6 A;  3VBH B;  5D2A A;  5I0D A;  2BDR A;  2VZR A;  3CHX A;  3MBW A;  3WW3 A;  1UL9 A;  2ORZ A;  5FY9 A;  4BME A;  2FHR A;  2VOV A;  5D21 A;  4BU2 A;  3VUO A;  2XR4 A;  5JPN B;  4OHZ A;  4I3P A;  1PZ9 A;  2ZAA A;  1W6O A;  2AC1 A;  2VOK A;  4H3W A;  4MH0 E;  3WIN E;  4S2D A;  3MID A;  3M3E A;  1CX1 A;  4XQW A;  3VHR A;  4XIK A;  4P02 B;  1O5L A;  1WGP A;  2Y6H A;  1QJY 1;  2ZGT A;  4FP3 A;  4LHK A;  5C3S A;  4R9C A;  1FMD 2;  2JKB A;  4NPR A;  2HBT A;  1X8E A;  2XBO 3;  1Z78 A;  3O0W A;  5H9R A;  5JXH A;  3W5M A;  1PVC 1;  1GP6 A;  3L2Y A;  3KT1 A;  1PM4 A;  1AUY A;  3VBU A;  5C3P A;  1AXK A;  4CA9 A;  1QDO A;  4XAE A;  5FPA A;  1TVG A;  5FY8 A;  4I2O A;  1XND A;  4P00 B;  4E4D X;  4GD4 A;  3OSD A;  1XQN A;  2WIN B;  5KHI A;  1TME 1;  1DZQ A;  3ZSE A;  1GMM A;  1YXW A;  1SHW B;  2RVA A;  1U5X A;  3LA2 A;  3ZYG A;  2VUD A;  3OYW A;  3IB3 A;  5FPB A;  2H0B A;  2VCB A;  1NXM A;  4LJH A;  4LR4 A;  1FAY A;  2Y6K A;  1CWP A;  2PFW A;  2RS1 2;  4UAP A;  4XE9 A;  5JOZ A;  4YW5 A;  5K0U C;  3ZXG A;  1YQ6 A;  2BVB A;  4N43 B;  4OUL A;  4L9B A;  4QX3 A;  3FE5 A;  2Q1Z B;  4LLF A;  1WCD J;  1RMU 1;  5FP4 A;  1WW6 A;  1C1L A;  1GQG A;  1L7Q A;  2E7A A;  4GAL A;  3KCC A;  1UY0 A;  2FDK A;  1WW4 A;  4MGK E;  2YDE A;  1NLQ A;  4FPH A;  1BK0 A;  1DQ2 A;  3OYW B;  3VKO A;  3KSC A;  1COV 1;  1UOB A;  1WD4 A;  3LA7 A;  4NR1 A;  5FWE A;  3H42 B;  1V6K A;  2X29 A;  3KZ4 C;  1OLM A;  1QNW A;  3BOW A;  5FZD A;  2BNN A;  1SDD B;  3IBM A;  1DBN A;  2A7A A;  4FOW A;  1KDK A;  1OD3 A;  4N43 A;  4TTG A;  4CU9 A;  3UKT A;  1RC6 A;  1FPN 2;  3KLS A;  4XDQ A;  3DL3 A;  1NY7 2;  4W6Y A;  2QKD A;  1RJ8 A;  1AXY A;  3D82 A;  2R07 2;  5JI7 A;  4AG4 A;  5L36 A;  4FPF A;  2AH2 A;  3ZVX A;  3ACF A;  1SPP A;  3KS7 A;  3LEG A;  2YBP A;  2XDV A;  5T3N A;  2BBV A;  1O5U A;  2JG8 C;  1ZBA 3;  5F9T A;  1SCS A;  1LEN A;  2D98 A;  4EWE A;  1HRV 3;  1LKN A;  3I49 A;  4Z82 A;  3VDA A;  3ZFF B;  3KHC A;  1PX4 A;  5DAW A;  3PME A;  4AQ6 A;  2BNM A;  1S1A A;  4N8M A;  4IV1 A;  5CKQ A;  2VBB A;  4QQO A;  1OLQ A;  3T2Q A;  5GAL A;  5DN2 A;  2JG8 A;  3ON7 A;  3TEZ A;  2HKX A;  3K48 A;  4FTS A;  1HQN A;  2YXS A;  4YWA A;  2ETE A;  3MLL A;  2BWA A;  4XQD A;  1ULG A;  4HG6 B;  4E8C A;  2WA3 A;  1VMH A;  3E5X A;  3VBH A;  1W8F A;  2BGO A;  1NAE A;  4K20 A;  3VBO C;  2DVB A;  4RQP C;  5KWR A;  2YU2 A;  1CON A;  3CKH A;  4YG6 A;  4XVH A;  1W8W A;  3R4S A;  5GLU A;  5FUN A;  4LT5 A;  3T30 A;  4S2G A;  3WP4 A;  2B46 X;  3ZSK A;  4O9G A;  1UMI A;  1WLC A;  3A22 A;  4AK3 A;  2WUH A;  1RUE 3;  4IE7 A;  2VMD A;  1M4W A;  1LU1 A;  3ECQ A;  1UZ0 A;  1LTE A;  4NMI A;  1ZZ8 A;  2ZGN A;  3V0B A;  3KD4 A;  4PF5 A;  2W52 A;  4P08 A;  1QEX A;  3AYD A;  4MET A;  1AYM 2;  4YG3 A;  2ES3 A;  3KV4 A;  4KNC A;  4HMZ A;  5T50 A;  3GXU A;  2XVG A;  4FPG A;  4BJ0 A;  5DZE A;  1HV0 A;  3GJB A;  2NLR A;  2W2I A;  4BQ1 A;  2WII B;  3BTA A;  3VBF A;  4CP1 A;  1C5H A;  4XF9 A;  1SLT A;  4XF0 A;  3ZPY A;  1BJQ A;  1KJR A;  1AR7 1;  2RJK A;  3CJX A;  4Q4Y 3;  2BWC A;  4EV0 A;  3MIB A;  3DGT A;  2AAC A;  4LE4 A;  1RUJ 2;  4JKL A;  1RUE 1;  3WW4 A;  4LMF A;  1YWK A;  3VZL A;  1Y9Q A;  1S2K A;  3U75 A;  3LPF A;  5SV5 A;  1PMJ X;  5C3Q A;  4AWD A;  3CQO A;  4RS5 B;  1GOH A;  1W8T A;  2WO1 A;  1ST8 A;  3EJK A;  3PIG A;  3RZJ A;  3H7J A;  4DO0 A;  4WZC A;  3ME2 A;  1XU1 A;  4IGQ A;  4LLO A;  4QKF A;  3AP6 A;  1GOF A;  5T5L A;  4CCL A;  3PVO A;  1ND2 C;  5AC9 2;  1VB2 A;  4GB3 3;  4QXC A;  4XF4 A;  5LK7 B;  3GM8 A;  4IEO A;  1GWL A;  3H8X A;  3JUU A;  1JHJ A;  3ZSL A;  1RUD 2;  2C9K A;  1OD5 A;  2HYK A;  4HAN A;  4K7J A;  1VR3 A;  4DIQ A;  3GBF A;  3IKW A;  3NV1 A;  2WN2 A;  4I0B A;  1WA4 A;  2N7G A;  3VBO B;  5FY1 A;  3LOB A;  5FZK A;  4BLI A;  4AFC A;  3MV1 1;  3IPV A;  5CFC B;  1PVX A;  2FBE A;  2R06 2;  4QPI A;  5FYU A;  1J83 A;  1RTV A;  2WR9 A;  3DKQ A;  3VL9 A;  5E8A A;  4Q2F A;  2FZ2 A;  2VE1 A;  3B94 A;  2A75 A;  2AGS A;  4KWL A;  4LK6 A;  2XBO 2;  4D7Y A;  5CFC A;  4JKM A;  4HN0 A;  4LBN A;  5L9R A;  1XSR A;  2ARX A;  1LUL A;  1QJX 3;  2RR1 3;  2QQL A;  3C2U A;  1G9B A;  3O1M A;  3OUH A;  4FQZ A;  5K9Y A;  5CYY A;  3ZMO A;  3WNX A;  4XUP A;  1DYP A;  2WNV C;  4NRO A;  3WY6 A;  4ZXK A;  3O5S A;  1RUD 3;  1NCQ B;  2G9Z A;  3J7L A;  3FBY A;  1S0G A;  2R0H A;  3ATG A;  4XMA A;  1L3J A;  3POS A;  1EUU A;  1XE8 A;  4D3W A;  1JYX A;  2BJS A;  4KMQ A;  4OI0 A;  2CDO A;  4K9S A;  1BEV 2;  3MIC A;  4GKY A;  1ODN A;  3LQC A;  3PU8 A;  1UOF A;  4F3J A;  1DDL A;  4B29 A;  4A2U A;  1XE7 A;  3VBS C;  1DZR A;  5DMY A;  3F95 A;  1ZRD A;  5LY1 A;  1OHF A;  2F6B A;  3VHN A;  4IES A;  1MVQ A;  1Q8V A;  4Z8B A;  3GAL A;  2B39 A;  5E16 A;  3T4V A;  2D6K A;  4OUE A;  1IPK A;  4ZZ8 A;  4YGE A;  4DEQ A;  2QUO A;  3SH5 A;  5CIR A;  1AR7 3;  4Q4Y 1;  4XAB A;  1MS9 A;  1QIQ A;  2PQS A;  2YPJ A;  2G4I A;  1OT5 A;  3HIF A;  3N3H A;  4PIZ A;  1LED A;  4AI2 A;  4BQW A;  3HEI A;  4RR3 C;  1TMF 2;  4BA6 A;  5JXG A;  3I2K A;  1EUT A;  1LES A;  2QBX A;  3GDB A;  2VMH A;  1BVP 1;  4FPK A;  4D7S A;  5BPX A;  4AGG A;  1ASJ 3;  1C8M 3;  3QCW A;  4XBQ A;  3PDQ A;  4NHM A;  4QB6 A;  1W0N A;  3MHZ A;  1M06 G;  1MS0 A;  1H9W A;  2VNV A;  4GB3 1;  1CAU B;  2W47 A;  3TAY A;  5J48 A;  1H2M A;  1F15 A;  2D6O X;  2WNE A;  4XFF A;  5F3I A;  2WZP P;  1HXS 1;  3VBR A;  5JOY A;  5A3L A;  1IS6 A;  1RUG 3;  1ZA7 A;  3F2Z A;  2JEN A;  2PHF A;  2D6N A;  2VQA A;  4XJ9 A;  2D6L X;  4GB3 2;  3TYJ A;  4IE5 A;  3WP3 A;  1CQ9 A;  1VRH 1;  3K2O A;  4SBV A;  2V4V A;  4XF1 A;  4E27 A;  1Y9G A;  3HVD A;  1F9K A;  1LJ7 A;  4PIY A;  3O1T A;  2NZ9 A;  3MFA A;  4CZS A;  1MR5 A;  3B9C A;  1WWY A;  3C7H A;  4EQV A;  4LBM A;  2VCM A;  3BU7 A;  1GOG A;  3HAG A;  3VD5 A;  2WYS A;  3AMH A;  4N90 A;  1AZD A;  4FAH A;  3J8F 2;  3DKW A;  2Y6G A;  1YQC A;  2I45 A;  2VOW A;  4LBJ A;  2DDU A;  4Q4Y 2;  1PGW 2;  3FUQ A;  4OMD A;  4AQS A;  4OQ9 A;  4XQ4 A;  3BUC A;  5JUV A;  1N3Q A;  1REE A;  5CG8 A;  1TMF 1;  2PYT A;  3OBA A;  2BBA A;  1SFN A;  3J26 N;  1NZC A;  5K7P A;  1W8N A;  1JU4 A;  5JZG B;  4Y4Y A;  4C1W A;  2VOX A;  2VZV A;  2JDM A;  2PLV 1;  3ZYB A;  1RHI 1;  3H8O A;  3DYM A;  4IEV A;  2WZR 1;  4JHT A;  1DQ1 A;  1PO1 2;  2C26 A;  3I59 A;  4LO5 B;  4YM0 A;  5GZE A;  4QX1 A;  1AR9 2;  5HPO A;  1HRI 2;  3DYO A;  5L7O B;  4BOW A;  1IS5 A;  1WLD A;  5BNN C;  4PDW C;  2F17 A;  3X29 B;  3LDB A;  4OFG A;  1OQ1 A;  2W0X A;  1QGL A;  3VKL A;  1HN0 A;  3WUD A;  3U78 A;  2EAL A;  3K3O A;  3T1L A;  1JS9 A;  2ARB A;  2CDP A;  5BNP A;  5C8C C;  4FFG A;  4Q4W 1;  3OGG A;  1ZA4 A;  4PCR A;  3SLI A;  2VQU A;  1Y43 B;  3MYX A;  3SH4 A;  3A21 A;  5ANN A;  4P9J A;  1AR8 3;  3W5N A;  1RUI 1;  3WOG A;  3OPZ A;  1WKY A;  4AFB A;  4CCM A;  1XNB A;  1ZBA 1;  2XQX A;  3AB0 A;  1UKR A;  1F4A A;  4YM2 A;  1XPW A;  1CD3 G;  1CVN A;  2VD7 A;  2XHK A;  5LEJ A;  1WMX A;  1P8J A;  3THC A;  1JZ8 A;  1QJU 1;  2HWC 1;  3LSD A;  1BMV 2;  2FMY A;  3LCP A;  3AL6 A;  3RMX A;  2A3X A;  3CZU A;  3JU9 A;  2GU9 A;  2WSU A;  4XYX A;  1G86 A;  4FTE A;  5FBJ A;  2IXK A;  4CUG A;  3GHN A;  5DG1 A;  5GLW A;  5CFD C;  2EF6 A;  2FDH A;  2HWE 1;  3N9L A;  4HPK B;  4LUK A;  3ZSJ A;  5KBF A;  1L7L A;  1WW7 A;  2Q5T A;  4LK7 A;  2A5Z A;  1ZRE A;  1NCQ C;  1Q8S A;  5BNP C;  2OZJ A;  4FSJ A;  5FUP A;  4E2G A;  3I3Q A;  1MEC 2;  3VD9 A;  5FPX A;  5CFD A;  5IK4 A;  2VZT A;  5FZ8 A;  1VBC 2;  5BNQ A;  1NLS A;  3WF2 A;  3WLU A;  4CTE A;  5IFT A;  3H8R A;  4AVA A;  4AHZ A;  3IAQ A;  4AEM A;  2V4A A;  2ID4 A;  5IK8 A;  1W2T A;  4HK9 A;  2Y34 A;  2C1F A;  3IAP A;  5FRE A;  3KGL A;  1UKG A;  2XUE A;  3MLJ A;  4IE6 A;  4R8H A;  3O1P A;  2VVD A;  2CGO A;  1FAT A;  1GNY A;  1QY4 A;  1E5I A;  2HWB 2;  3NKT A;  2ZAH A;  4O61 A;  1Q8P A;  4AF9 A;  2K0G A;  3BI3 A;  3PMS A;  1MZ5 A;  3FHA A;  1TZO A;  3HBZ A;  3BIE A;  1ULP A;  1O4Z A;  2FDJ A;  4IUG A;  4IV1 C;  5CVR A;  5EPA A;  4MSV A;  4BQX A;  5C9A A;  4C8D A;  1LGN A;  1LOA A;  2Z5W A;  1QOS A;  1RUF 2;  1VBB 1;  3LAG A;  4DY3 A;  5DZG A;  4F7Z A;  5CG9 A;  1UU4 A;  2WS9 2;  1AXZ A;  4CCK A;  2OS2 A;  1ZBE 2;  1QJY 3;  1ZBE 1;  1KEX A;  2AZ5 A;  1GP4 A;  2ZCW A;  5F3E A;  4E2S A;  4H55 A;  4RGA A;  2J22 A;  4YFZ A;  5AVA A;  3WG1 A;  5DAV A;  2A6W A;  3OEA A;  4CUA A;  2WL1 A;  1G9A A;  1OVS A;  1CR7 A;  3DXU A;  2A6Z A;  5FYH A;  5KR7 A;  2QFE A;  2E7Q A;  5DDJ 3;  1ND3 A;  2GP5 A;  4AEK A;  3BTZ A;  1B09 A;  2R0F A;  1HW5 A;  2XLA A;  5FZ6 A;  3ZYI B;  4AOC A;  3JBG 2;  1EV1 2;  2K2S A;  4X6R B;  3ZPO A;  4ZPI A;  3S30 A;  2CSG A;  4RFR B;  5CBL A;  1ONA A;  1IPS A;  4Y22 A;  3GCX A;  1LB2 A;  5CFD B;  1JZ6 A;  4JCK A;  1FNY A;  2ZA9 A;  1V6N A;  4XBN A;  1Z7S 3;  2LAL A;  3AKS A;  3HD8 B;  4QX7 A;  2R49 A;  4OZX A;  3NNF A;  4ZU7 A;  2UU8 A;  4HZF A;  3ASI A;  2IVI B;  2W92 A;  5FOB B;  4ZS3 A;  3HT1 A;  4A3Z A;  2WT2 A;  5GZG A;  2R07 3;  5FLI A;  4UT5 A;  4CDW C;  1PVC 2;  3ZIX A;  5I0R A;  3DEM A;  1T6B X;  1UY4 A;  5IVY A;  3AMP A;  5FPV A;  3I7D A;  4OHV A;  4B4Q A;  1KD7 A;  5C7G A;  1LOE A;  2Y38 A;  3M70 A;  4ZY9 A;  4XUR A;  2WNU B;  4QDR A;  2UWA A;  4W8J A;  1ZRF A;  3FJS A;  3ZYJ B;  3MW4 A;  2OVU A;  4L0P A;  2CWS A;  4Y20 A;  3JD7 1;  1PK6 C;  2QQM A;  4QX5 A;  1BMV 1;  3JXS A;  4KWJ A;  2PXJ A;  4I3G A;  3FMG A;  5FUI A;  4NIH A;  4G3Y C;  1JI6 A;  4XOG A;  1RXG A;  4FPC A;  1ZVF A;  4ATF A;  3VBO A;  1OKO A;  3ZXJ A;  5EIY B;  1JYW A;  4QDQ A;  2QQO A;  3WP6 A;  3H50 A;  3JD7 3;  3K46 A;  4NPM A;  3T0B A;  4B8E A;  4AAP A;  4QHZ A;  2WWS A;  4XPV A;  4RSU A;  5EQU A;  4Q0V A;  4A6O A;  4COY A;  2EIG A;  5A6Y A;  5C70 A;  4Q4W 2;  2XON A;  1GZ9 A;  4GMP 3;  3WNM A;  2WC2 A;  2D3P A;  3KM5 A;  4ZXE A;  3WCR A;  4YW4 A;  1ENS A;  2MPF A;  3HQU A;  2ZX0 A;  1VBD 2;  4Q8L A;  2UY8 A;  2J7M A;  5DXD A;  1XNT A;  1FNZ A;  2YHJ A;  4XIL A;  4EN0 A;  2PQQ A;  4XZU G;  5BV6 A;  1TNF A;  1CIY A;  1OI6 A;  4BLJ A;  3LDR A;  4YYO A;  3ILN A;  3IMM A;  2V5D A;  1AHS A;  4EZH A;  2BP6 A;  1APN A;  1RGS A;  1J3Q A;  3CIH A;  4CEY C;  4CP0 A;  1QJY 2;  4UBH A;  1AYN 1;  2VZO A;  3MZH A;  4UFK A;  4D6R A;  3IPV B;  2RS3 3;  2EAK A;  5IVV A;  1F35 A;  2CL2 A;  2VMF A;  2NPI A;  3E6B A;  3ELN A;  1W99 A;  5F5Q A;  4ZZ5 A;  2D7F A;  3W58 A;  4EN7 B;  4GXL A;  3THD A;  4MV2 A;  2BOI A;  3I3M A;  4M4P A;  4BIF A;  4MHU A;  2OII A;  2RS5 3;  2DCY A;  3POY A;  2BW8 A;  1SFP A;  1CAV A;  4CDX B;  1V6O A;  2J1A A;  2AYH A;  4GAZ A;  3SEP A;  2OXB A;  2GH8 A;  4CVU A;  1O4T A;  1ND3 B;  3ZYR A;  1H0B A;  1K5J A;  1S0B A;  1ND2 A;  3OPW A;  3OGR A;  4JDM A;  4LO8 A;  5L7O A;  1BQP A;  3PUS A;  3RZM A;  1Z7S 2;  1OH4 A;  1RUI 3;  1ZNP A;  4RGG A;  2DUQ A;  2DF7 A;  5I0U A;  3SKV A;  2RG4 A;  3AZX A;  3J8F 1;  3QAC A;  5FO8 B;  1DQ6 A;  1H6X A;  3O0V A;  2EAA A;  2TEP A;  1HV1 A;  3T4H B;  4TSV A;  5CEH A;  3ZXF A;  1VBE 1;  1R64 A;  2JE9 A;  4WM8 A;  3WDT A;  3B69 A;  1PNG A;  4E4S A;  2C24 A;  1VBC 3;  3LD8 A;  3ES1 A;  5DPN A;  2IWG B;  3TOJ A;  1HB3 A;  2JDU A;  3AKQ A;  1JOD A;  4Y1Z A;  1KRI A;  1CES A;  3D0S A;  5LAT A;  2H0V A;  5IT6 A;  1IQD C;  3ZFE B;  4KGG A;  3UT0 A;  1OPM A;  5E6H A;  4P9Y A;  4DOU A;  3Q8B A;  4KG0 A;  5ERL A;  1OUX A;  1BKZ A;  3TB0 A;  4HT1 T;  1OOP B;  4K8F A;  2HEW F;  3ZN6 A;  1CZS A;  1JH5 A;  1VLN A;  3AFK A;  1F5J A;  2D3S A;  2WT1 A;  3B01 A;  1R08 1;  2VO5 A;  5EYX A;  4C1X A;  1YO8 A;  1LHW A;  4Z1V A;  1DGL A;  3HT2 A;  1CJP A;  2O14 A;  5GJ6 A;  4CDX A;  1UY2 A;  3ZO0 B;  2NYY A;  2E63 A;  4QU1 A;  5A3N A;  1RUC 1;  4ZHN A;  1BXH A;  3PUH A;  3RGB A;  2LRO A;  2RM2 3;  1DQ4 A;  2WFF 1;  2X5I B;  5FBZ A;  4XET A;  4Y1U A;  1J1T A;  2P3K A;  2VNG A;  3JD7 2;  5FZG A;  2B9V A;  4MLO A;  5IW0 A;  3WHT A;  2EVX A;  4GWI A;  3ZXE A;  2WDB A;  3VZN A;  1YFU A;  1LOF C;  4WBB A;  1IS3 A;  2GAU A;  3IDE A;  3WNK A;  1JZ5 A;  4MGI E;  5FZC A;  5A1A A;  1GWK A;  5IHR A;  5AC9 3;  2X53 S;  1CAV B;  1DP0 A;  3CEW A;  1SAC A;  4LBQ B;  3RYP A;  5CKN A;  2JG9 C;  5JXJ A;  1OFS A;  2L9L A;  3AK0 A;  1FV2 A;  3WQ0 A;  1BYH A;  2RJ2 A;  4HKO A;  4CEW B;  1MZF A;  2GNB A;  4AXO A;  4CU7 A;  2JE8 A;  4XAA A;  2VM9 A;  1ZZ7 A;  2OQ7 A;  3AP7 A;  4AHY A;  5DAP A;  3IDB B;  3AC0 A;  1KIT A;  4GH4 A;  5FMO S;  4LO6 B;  4HN1 A;  1IG3 A;  3ACL A;  3EXU A;  2A1X A;  2DVF A;  2GSY A;  1KFX L;  2FCU A;  4OUS A;  3R6S A;  2ZMN A;  3N36 A;  5BNO A;  5I8T A;  4N7U A;  4OZO A;  1YCI A;  4A44 A;  4QB2 A;  1S0I A;  5GZD A;  1NUK A;  1AL2 3;  1K3I A;  5JLV A;  1NY7 1;  1RMU 3;  1GQP A;  2ENR A;  3Q8E A;  4NIA A;  4L92 A;  1QJU 3;  2HWC 3;  2ET1 A;  3M7A A;  4RGK A;  3Q8C A;  4CDW B;  5F2W A;  1OA2 A;  5LWB A;  4YZ3 A;  1X82 A;  1I1E A;  4GMP 1;  4MXV A;  1PIV 3;  4CDQ B;  3I2O A;  3FFQ A;  3OPT A;  4YZ4 A;  4ZS2 A;  1EV1 3;  5K4L A;  5JDB A;  2BFU S;  2GC2 A;  2VZ1 A;  2OUH A;  4I02 A;  2WS9 1;  3AKR A;  1QXP A;  1W2A X;  5FDB A;  5I0S A;  4HVR A;  4DB5 A;  4YVS C;  4AI8 A;  4QXH A;  1QHD A;  3NV3 A;  2XJQ A;  2E53 A;  3GGL A;  1B35 B;  4UOJ A;  3WDU A;  4YGD A;  5JMO A;  2YMZ A;  2YUE A;  3T0A A;  1POV 0;  2X09 A;  3NNM A;  4IEW A;  2DYC A;  3C7O A;  1QWR A;  5FY5 A;  2J42 A;  3DXT A;  3WF4 A;  1BCX A;  2A3Y A;  1RUF 1;  4C90 A;  3I2J A;  2IZW A;  2VXJ A;  3IDA A;  4CU6 A;  3AKP A;  4UFL A;  3WXP A;  1UN1 A;  2BNO A;  2CGP A;  1PIV 2;  2VPV A;  4Q4X 3;  2Q1F A;  4DQA A;  1RUG 1;  5DAQ A;  5FRA A;  3PIJ A;  1ZM1 A;  3LIH A;  1YFX A;  1JN2 P;  1UIJ A;  4ZKT B;  3EBR A;  4H14 A;  1OLR A;  1U5Y A;  2D43 A;  5D8A B;  5HCF A;  2G9G A;  3FHI B;  3M2M A;  1TMF 3;  4DUV A;  3U1X A;  5B4N A;  1RYY A;  4MYE A;  5ABJ B;  1O3R A;  2HWB 3;  4YSF A;  3I3D A;  4JRL A;  2ZXQ A;  3KV9 A;  1AR7 2;  2PHU A;  3ILF A;  4JVA A;  3USU A;  3SCG A;  3W21 A;  5FKC A;  4AVB A;  1LOC A;  4XZP A;  2J1R A;  3VBR C;  3HJR A;  4IL7 A;  2XG3 A;  1XSQ A;  3SXW A;  2CTV A;  4YM1 A;  1K5M C;  1VAV A;  4B1M A;  2JJ6 A;  3TBD A;  2W1W A;  1OH3 A;  3USU B;  4GWN A;  3ETQ A;  5IK7 A;  5LBF A;  4QQH A;  2WNU C;  3NL1 A;  4CDU C;  3J4U H;  4IDZ A;  1K12 A;  1W6M A;  3AYE A;  3FC0 A;  4LO4 B;  3I2G A;  4V2W A;  2VUL A;  5K8S A;  3POB A;  1AJO A;  3TEY A;  3TN9 1;  1QXJ A;  4QPW A;  2GND A;  2WLP A;  1LU2 A;  4Y33 A;  2SBA A;  2I74 A;  3DCQ A;  3UYJ A;  1YQ5 A;  5FPZ A;  2RMU 3;  3O1V A;  4B3N A;  4IE0 A;  1MVE A;  3RI9 A;  2VY0 A;  3A0K A;  2B8M A;  5LRR A;  1E57 A;  2HWD 3;  3FX3 A;  1ZZ9 A;  3EB7 A;  2DVD A;  2A6V A;  2ERF A;  2ZGQ A;  3KCY A;  3OY8 B;  2Q30 A;  4QPG C;  5GLT A;  1PM7 A;  1UU6 A;  4DXR A;  3HQR A;  2FDG A;  1ULC A;  3D0J A;  4YRD A;  1G8W A;  3U14 A;  1O4Y A;  5A3M A;  1X36 A;  3POE A;  2MEV 3;  1AR6 1;  4Q4V 1;  2ZJC A;  4IW3 A;  1H9P A;  1POQ A;  5F1R A;  3L2H A;  4JGZ C;  3U37 A;  1W2O A;  2QE3 A;  3GZE A;  3GBG A;  1D7P M;  1C5I A;  4ET7 A;  4H7M A;  4N53 B;  2HWB 1;  3LZZ A;  5JSP A;  2VJX A;  2HWD 2;  3JB4 C;  3VDC A;  1G7Y A;  2FZ1 A;  4Q0U A;  5FZ4 A;  1A6C A;  1VAM A;  4QGL A;  1S55 A;  4XMI A;  5CIS A;  3C7E A;  3MLK A;  4A3X A;  2FCV A;  4D6Q A;  1HRI 3;  3HR9 A;  5IVJ A;  2ZX1 A;  4Y4R A;  1BLZ A;  2DWR A;  1R1A 1;  3SKJ E;  3T08 A;  3E6D A;  3WV6 A;  2PHX A;  5FYC A;  4AHX A;  4CU8 A;  5FYV A;  3D5O A;  3L9J T;  4B1L A;  4LHL A;  3FLR A;  4CPB A;  4CXW A;  2QQP A;  4CP9 A;  2DV9 A;  5C4W C;  1XOY A;  4QMA A;  5LY2 A;  5F5I A;  5BNN B;  4OVE A;  2EXH A;  3H9A A;  1H8T B;  3RJR A;  4QU2 A;  3UKV A;  1CX4 A;  3INA A;  5KC5 A;  1H2K A;  5H9S A;  3HOB A;  3P1I A;  5FZ1 A;  2CU5 A;  2JDP A;  5L19 A;  2VW1 A;  5BXX A;  3VBU B;  3BN6 A;  1W9F A;  1GNZ A;  3BYW A;  1XU2 A;  2JDH A;  1VMJ A;  3BAL A;  3VZM A;  4BCU A;  4COV A;  2WO3 A;  1HB4 A;  2KXL A;  3ZN4 A;  1JTZ X;  5G05 L;  2DCK A;  2VU9 A;  3ZXL A;  4KU8 A;  2YZ4 A;  4MVT A;  4BMB A;  5FYM A;  1DGW X;  3J7H A;  2R16 A;  4KH9 A;  3ITQ A;  3SIS A;  1UMZ A;  2PHD A;  4C0B A;  5FXZ A;  3AKT A;  4QM8 A;  3THP A;  4C91 A;  1CN1 A;  1CPN A;  2WO2 A;  4JX0 A;  4L99 A;  1VBA 3;  1W04 A;  1LHN A;  4QXB A;  1VBA 2;  2LRP A;  1XYN A;  3PJY A;  5IUQ A;  2JIC A;  1LGB A;  5T52 A;  1WA6 X;  4AVC A;  2ZEY A;  3ZFE C;  3VDD C;  5KHK A;  3I3E A;  4CXY A;  2WJS A;  4URA A;  1TME 3;  1W6Q A;  1MS3 A;  4TWT A;  4YNI A;  3N9P A;  1E5R A;  5A33 A;  3TEW A;  1AX0 A;  4EN6 B;  1F2N A;  5EJ3 A;  5AVP A;  2PTM A;  5FO7 B;  2OPK A;  3VD7 A;  3N35 A;  1D4M 2;  4Q27 A;  4XFH A;  5A6Z A;  1AR6 3;  4IND A;  1ENR A;  4MGY E;  4Q4V 3;  1OA4 A;  5FP9 A;  3T2P A;  4X8N A;  1RUJ 3;  4P5Y A;  1W6N A;  1UQX A;  5K0U A;  2D5F A;  1A78 A;  5C8W A;  3WZ1 A;  5FZ7 A;  4NVP A;  1QJU 2;  2HWC 2;  2QDN A;  4Q1P A;  2JDA A;  1QF3 A;  2VNO A;  2VR4 A;  4JTO A;  4M00 A;  4WM8 B;  1RMU 2;  3LE0 A;  1W6O B;  1SBE A;  2YYO A;  4AR2 A;  2P4E A;  3NKG A;  5EYY A;  1ACC A;  1LNS A;  3VB9 A;  4IV3 C;  1LRH A;  5E1R A;  1RUH 2;  2HWF 2;  5FZO B;  4BK4 A;  1S2E A;  1PVC 3;  3VHO A;  4MO3 M;  4NAM A;  5DAX A;  1URX A;  4AQ2 A;  4NRP A;  4A41 A;  1R08 3;  1OUS A;  1W06 A;  4AAX A;  4D7T A;  4JGZ B;  2AR6 A;  4AFD A;  1RVF 3;  1V9U 3;  2RDN A;  4OI1 A;  3DPR C;  3EYP A;  4BQ2 A;  4FXG B;  5JOW A;  2A6Y A;  4GIQ A;  4CEY B;  1D0H A;  1FX5 A;  3HNY M;  3RG0 A;  5F37 A;  2YFZ A;  4LKS A;  1PGS A;  4HET A;  2BV4 A;  4PDW A;  3A23 A;  4BH9 A;  2OPW A;  2VZU A;  1C8N A;  1J3R A;  2BFU L;  2GP3 A;  2EIB A;  3Q8F A;  4IGP A;  1I3H A;  2KM2 A;  1V6M A;  1W9S A;  1XNK A;  2UWB A;  1Q8Q A;  2RS5 1;  2WO7 A;  3LWC A;  5IYY A;  2EIC A;  2F4P A;  4ATE A;  4LOS A;  5EXO A;  2XGX A;  1AF9 A;  1G9C A;  4LBL A;  1IOA A;  1A3K A;  4RN5 A;  4RFT 0;  1SQ4 A;  1ZRC A;  5CAZ A;  1C4R A;  3ZKY A;  5DAB A;  4YW7 A;  4A6S A;  3ZDS A;  4CDU B;  1LHO A;  2A71 A;  3UJO A;  5I91 A;  1WMD A;  2BYV E;  3H7Y A;  3R4U A;  3WNP A;  3NJZ A;  4QGN A;  3RZH A;  2YC2 A;  1ENQ A;  4LBQ D;  5K0U B;  1RUF 3;  3B9I A;  4FFF A;  2P6H A;  3VZO A;  2B7Y A;  1DG6 A;  4URT A;  4XAC A;  3C8X A;  4AFA A;  3UNP A;  4JGY C;  1NLR A;  3M3C A;  1ZZ6 A;  3VN4 A;  4DZG A;  1H1M A;  1SLA A;  1JBC A;  4KQ7 A;  2IFW A;  1ULF A;  1Q8O A;  1Q5O A;  2QDR A;  2ZPX A;  1RUH 1;  2HWF 1;  2ZS6 B;  1W03 A;  2UUR A;  3H3L A;  4NHX A;  3H1W A;  3SQO A;  2VZP A;  3TNP B;  3VLB B;  2DBI A;  3NJV A;  1KQR A;  2D5H A;  1UZZ A;  1VBD 1;  3E1F 1;  4AFM A;  2NQY A;  1Q3E A;  2VTX J;  2ILM A;  1HXS 2;  4COU A;  2C6S A;  3FL7 A;  1E5S A;  2WNV A;  1ODM A;  2VTX A;  5BYN A;  1VPH A;  5EV7 A;  2JDY A;  2ORX A;  3ZYH A;  1SBD A;  4WV8 A;  1NYW A;  1RUH 3;  2HWF 3;  2ZGM A;  3K51 A;  1TNR A;  1TQ5 A;  5FIX A;  3MF9 A;  2XVK A;  2XBO 1;  5FZL A;  3M1H A;  4XFI A;  1QQP 1;  1XNA A;  2QZ3 A;  1JUH A;  1UYP A;  1GWM A;  1ZZB A;  1K5M A;  1NXD 1;  3GYD A;  4ISQ A;  1ZRI A;  2HYX A;  1WUV A;  3POF A;  4QPI B;  5IJR A;  4K21 A;  3SCF A;  3VBS B;  5I93 A;  4AVT A;  1OSG A;  2DFB A;  3ROU A;  1SEF A;  3AP4 A;  4HSL A;  4P9X A;  1RUD 1;  4IQP A;  4OUM A;  2J1U A;  1D4M 1;  1JMU B;  4YM3 A;  1W8U A;  3VBH C;  3UJQ A;  1CJD A;  1WCS A;  4WVZ A;  1WCU A;  1UZV A;  5I8Y A;  3CBN A;  5AFE A;  5LA0 A;  1DQ5 A;  5JZG A;  1HQW A;  2R30 A;  3POJ A;  1UCX A;  4H7L A;  2KA3 A;  4BQY A;  3A0N A;  4HXC A;  5C5T A;  1VJ2 A;  1W2N A;  2EXI A;  2IVJ A;  2YGM A;  4LOT A;  5AC9 1;  5JXI A;  1O8S A;  4U2A A;  2ZX4 A;  3JCI A;  3THT A;  1MS8 A;  3I4I A;  4EWA A;  2ZGR A;  5T5J A;  3WNL A;  1OOP A;  2OQ6 A;  4D94 A;  4CEW A;  4B4R A;  2GAL A;  1VE0 A;  4AI1 A;  2RDR A;  2W39 A;  2R07 1;  4Y1V A;  4AHW A;  1KFU L;  2AEY A;  3B93 A;  3NST A;  4GKX A;  4UW3 A;  4LBQ A;  1FOD 3;  4MHR A;  4JGZ A;  1UY1 A;  3ES4 A;  2DBN A;  2GMM A;  1YI9 A;  2GMP A;  2VBP A;  3HBK A;  3O0X A;  4NE9 A;  1AYM 1;  3VGI A;  5LRS A;  5CAD A;  1AR9 3;  3WHU A;  3SC7 X;  4G9S B;  5BNO C;  3EO6 A;  3LB9 A;  1YRZ A;  3MW3 A;  5H9Q A;  1LEM A;  4WZF A;  5FR3 A;  1N3O A;  1YJL A;  2IXH A;  2WA4 A;  4FPO B;  2IXI A;  3VKN A;  1RVF 1;  1V9U 1;  2MHF A;  2QQU A;  2P5B A;  4RHV 1;  1D0G A;  3BU0 A;  4XTM A;  3WG3 A;  2D6P A;  1ND2 B;  3H8U A;  1R1A 2;  3KVA A;  5GKA C;  4PIX A;  3RQ0 A;  2XL9 A;  3OG2 A;  3PTY A;  2FDI A;  4PJY A;  2RS1 1;  1HLC A;  4BPZ A;  5FO9 B;  4UXA A;  3TN9 2;  4LXL A;  2ZGO A;  4QGM A;  4B7K A;  2VW0 A;  1UYX A;  1BEV 3;  2BOJ A;  3IMN A;  3MIG A;  4LIV A;  3SMH A;  1IQA A;  3V0A B;  2D3R A;  2QQN A;  3NVC A;  1RUI 2;  3AVR A;  5FK7 A;  4ES8 A;  1OKQ A;  4FI9 A;  2XVL A;  4J25 A;  3U0Z A;  2RS1 3;  5J3U A;  4P9I A;  3U10 A;  1NA1 B;  4XTP A;  5EWS A;  3BCW A;  4XIO A;  4LBO A;  4QQP A;  2W91 A;  5G04 L;  1LOB A;  3R4D B;  4AGR A;  1W05 A;  1Y7B A;  4X8P A;  4QHO A;  1EAH 2;  2UYA A;  2BGC A;  1DIW A;  3ST7 A;  1F8V A;  3RWN A;  4CCN A;  1R09 3;  3UET A;  3WF1 A;  1O3T A;  3OTF A;  1DHK B;  3IZO A;  5CNA A;  2W46 A;  3N9O A;  1RB8 G;  1AR9 1;  4NUB A;  2VH9 A;  2VXR A;  1STM A;  4GH4 C;  4K3U A;  4FPJ A;  4QWN A;  4AL9 A;  5C6C A;  4J1W A;  1X50 A;  5FK8 A;  1OXC A;  1FMD 1;  1F4H A;  3WVJ A;  5ABJ A;  1QXR A;  3MDP A;  1K5M B;  3WW1 A;  4AEJ A;  4Q26 A;  2XPJ A;  1ASJ 2;  1C8M 2;  3OGS A;  4LHN A;  4LQR A;  5A80 A;  1NE4 A;  5D8A A;  1PO2 1;  5C71 A;  1UF2 C;  2Y64 A;  2WQ4 A;  2WWJ A;  4AED A;  1OMI A;  2D6M A;  3SNM A;  3AXD A;  3D4K A;  2UYB A;  5B2G B;  2JKX A;  4UFJ A;  1RED A;  1R09 2;  1DYK A;  2HWE 3;  4Q29 A;  3VBS A;  2C5D A;  1EAH 3;  4TLF A;  2WNU A;  3O1S A;  4OI4 A;  4XUN A;  1OUR A;  5FZ3 A;  4LE3 A;  1RHI 3;  3I3B A;  3OD0 A;  1TG7 A;  4DMI A;  3CL1 A;  3PVE A;  1V70 A;  1VBB 2;  2PHR A;  1DGR A;  5FMB A;  1VRH 2;  2VCC A;  2V09 A;  1RUC 3;  3SH3 A;  2BVV A;  2GZW A;  2RE9 A;  3B00 A;  3MO4 A;  4DUX A;  4L97 A;  3R0R A;  1MQT C;  4N7I A;  4RD7 A;  3N4M A;  2D93 A;  3OBR A;  1COV 3;  4A4A A;  1SFY A;  5LBB A;  4HON A;  1UU5 A;  3O14 A;  3AMM A;  5F3G A;  5E88 A;  1J58 A;  2OKX A;  4NRM A;  5FFO C;  1VBE 2;  1GAN A;  1GYK A;  2NMN A;  2PLV 3;  3A4U A;  3NAP B;  5FYT A;  4LPL A;  1LHV A;  4XC9 A;  3VBU C;  5AFB A;  5ISL A;  2W94 A;  3NO8 A;  3OJB A;  1AYM 3;  3LDK A;  1UX7 A;  1HN1 A;  1NQJ A;  1PZ8 A;  4H2A A;  3D3A A;  1HRI 1;  4SLI A;  4CDQ C;  1S0J A;  1Q43 A;  5T54 A;  2YPD A;  3GZA A;  3S57 A;  2WZR 2;  4Y20 B;  3T0D A;  1VBC 1;  5E89 A;  2AEZ A;  1H8T C;  4P9L A;  4L2N A;  1QJE A;  1VBD 3;  2EXJ A;  3ZSM A;  4NIG A;  2D97 A;  4N43 C;  3O1U A;  1W39 A;  2R06 3;  2Z79 A;  3EQE A;  2ADE A;  4LTA A;  4QB1 A;  1FOD 2;  2A73 B;  1PK6 B;  3AP9 A;  3O12 A;  3ZFG B;  2J1V A;  4QX2 A;  2P34 A;  3WT3 A;  1UD1 A;  1ULE A;  1YQ8 A;  3RDI A;  5JPM B;  4NRQ A;  3I2H A;  4O7X A;  4Z2W A;  4RR3 B;  5ACA 3;  1UZY A;  3IM0 A;  1FI2 A;  2IXJ A;  3N9M A;  2PHL A;  2WYF A;  1GZW A;  2VZQ A;  4FOY A;  5ANQ A;  4N9I A;  5C8C A;  4XJZ A;  1X8M A;  1CAW B;  3M3O A;  4LKE A;  5FYZ A;  5FXW A;  3I2F A;  3QOP A;  2XJS A;  4PDW B;  5FP3 A;  3KF3 A;  4Y5Z 0;  1CZV A;  3V0A A;  3ZYP A;  2NM1 A;  1S0E A;  1H8V A;  3ORJ A;  4JZR A;  4AED C;  1HRV 2;  5C5U A;  1ZBA 2;  3KWV A;  3LPG A;  3CF6 E;  3VL8 A;  1KS4 A;  2KR2 A;  4PBP A;  1JOJ A;  1FYU A;  4NHL A;  2VMG A;  3VDD B;  3WP5 A;  2XJV A;  3IT8 A;  3KCX A;  4QPY A;  2BU9 A;  2R04 1;  4S2H A;  2BQP A;  3WD5 A;  4M3C A;  1S0F A;  3MFC A;  4WVM B;  1US2 A;  4M0N A;  1SLL A;  3USS A;  2JX9 A;  1H1A A;  1FPN 3;  3N7J A;  5L73 A;  3OGJ A;  4IV3 A;  4CUB A;  1OF4 A;  3OBZ A;  3DYP A;  2PLV 2;  1LGC A;  5APA A;  4HKW A;  2PAE A;  3B02 A;  5H9P A;  4BDV B;  1X9P A;  1TEI A;  1CAU A;  2HLE A;  2NN8 A;  2R06 1;  4CPB D;  3ZLI A;  5BUV A;  2GNT A;  2JE7 A;  3S7I A;  2QQJ A;  2RDS A;  2RDQ A;  3CDZ B;  3BOD A;  3DPR B;  3POI A;  2FD8 A;  4JTN A;  4HPK A;  1W6P B;  1UY3 A;  4I0A A;  5FJK A;  1FOD 1;  1OVP A;  3WQB A;  1U5I A;  5GLV A;  1U0A A;  1QDC A;  5C9A B;  4RYD A;  1DLC A;  2VL4 A;  2FCT A;  1CPM A;  1JYC A;  1O8P A;  1RUC 2;  3KT7 A;  1JOB A;  1LOD A;  4YZ2 A;  4WVW A;  1DGW A;  4XJ8 A;  1BHG A;  2V5Y A;  3BPS A;  5A32 A;  2GNM A;  1D4M 3;  3PUQ A;  4JDN A;  4XUT A;  1GUI A;  1PK6 A;  2VZ3 A;  4K1Y A;  2PHW A;  5JWP A;  2K46 A;  2E51 A;  1YQ2 A;  2KD7 A;  3D6E A;  3LFI A;  1GZC A;  5EZW A;  1K45 A;  3CJI A;  2PA7 A;  4XFC A;  3QH7 A;  5J96 B;  1N1V A;  4OQ8 A;  4UWD A;  4Q4X 1;  4QDS A;  4BQ4 A;  2RM2 2;  3Q9O A;  3LKJ A;  2OW4 A;  5F32 A;  2Q1M A;  4O65 A;  1MS1 A;  1V6J A;  4CP9 B;  1W8H A;  1GZT A;  3LFM A;  1JYT A;  1O59 A;  4HK8 A;  4XHX A;  1Y3T A;  2DCT A;  4X6Q B;  4DXT A;  1MS4 A;  1QOO A;  1Y4W A;  3UV9 A;  5F8P A;  4DNY A;  5FZB A;  4IEU A;  1OC1 A;  4LHS A;  3III A;  5HXV A;  5IVB A;  4NAO A;  1UAI A;  2WS9 3;  3G7D A;  4ARX A;  3IIA A;  5LCW L;  3AX4 A;  4RQP A;  1ND3 C;  2PN5 A;  4ES9 A;  1ZX5 A;  1POV 3;  5C9A C;  1OBN A;  4OLL A;  4XW3 A;  4R9A A;  5A3U A;  4XJW A;  1EV1 1;  1ZYB A;  5FAX A;  3VBF C;  4UFI A;  4MGT A;  4ZU4 A;  4MZU A;  2ZEW A;  5M0T A;  2EID A;  4WVV A;  1UOJ A;  2XOM A;  4LBK A;  1J84 A;  2B5H A;  2JB8 A;  1Z7S 1;  4GJZ A;  4AZZ A;  1LAJ A;  2VME A;  2VMC A;  3CJI B;  1W9Y A;  2W87 A;  2ZGK A;  3NJY A;  1QJX 1;  2RR1 1;  4MUV A;  1YUD A;  1B35 A;  4AI9 A;  5FQ0 A;  5J36 A;  3CU7 A;  4XDP A;  1YHF A;  2AUY A;  4FFI A;  3LOI A;  4TLG A;  1RUN A;  2VUC A;  1JYN A;  2D40 A;  3CJI C;  4LKD A;  1XBF A;  2XHN A;  3H1M A;  3AYC A;  1PGL 2;  4QQL A;  1NT0 A;  2WAO A;  4C0H A;  4HL0 A;  2JWP A;  1G9D A;  4ZON A;  4AGV A;  2PEL A;  5FPU A;  3CNA A;  3MF6 A;  2E9Q A;  1MEC 3;  5CB7 A;  3VBF B;  4BQ5 A;  4Y1Y A;  3RZG A;  1VRB A;  1ZRR A;  1JOP A;  1SLI A;  3RSJ A;  2A6X A;  2DTY A;  2RS5 2;  3NNJ A;  2C9A A;  5GLZ A;  3SCH A;  4AED B;  4DY5 A;  5A6Q A;  4A7K A;  4XXA A;  5TSW A;  1BEV 1;  3B3Q E;  2TNF A;  4IE4 A;  3AM2 A;  3IDC B;  3AVS A;  5FZH A;  3FHQ A;  1GP5 A;  4WVM A;  3WX5 A;  4UW5 A;  4YVW C;  4DRV A;  1W2U A;  1RUJ 1;  1W6M B;  4AQT A;  3POG A;  3I2D A;  4XJU A;  4UW4 A;  3AZZ A;  5DUU A;  4ZU5 A;  4QXK A;  5FV3 A;  5IFP A;  1EAH 1;  3H3U A;  4PT6 A;  1CGP A;  3ZFG C;  3S6P A;  4YPJ A;  4FBF A;  2AEN A;  2YY1 A;  4YVW A;  2ARE A;  5CFC C;  2FQP A;  3KVB A;  4UFM A;  4CYD A;  4YZ5 A;  4CEW C;  2R04 2;  4Q4V 2;  1AR6 2;  1LEC A;  3UES A;  1WCQ A;  5FMC A;  4DRR A;  3WDX A;  3WR0 A;  1PHM A;  1H2N A;  1KJL A;  4NWV A;  4PQ9 A;  1SMV A;  2Z2S B;  3ZR6 A;  2ZBJ A;  3PJQ A;  5DZF A;  4YW1 A;  1HJG A;  2ZGU A;  4CRQ A;  2HEY F;  4Y24 A;  3QLQ A;  5IVC A;  2JG8 B;  4CSW A;  3AJZ A;  1FMD 3;  5KHG A;  4RR3 A;  5IAX A;  2Q8E A;  4GWM A;  1DF0 A;  2EA7 A;  1YIF A;  2E31 A;  4RHV 3;  1XB9 A;  4UW6 A;  5L9B A;  2XWJ B;  2ZEX A;  2D44 A;  3GJA A;  4TYS A;  5CU1 A;  4I01 A;  5EJ1 B;  1R09 1;  2VBD A;  2XML A;  3VD3 A;  5HCA A;  3NV4 A;  5SV8 A;  2Q8D A;  3M4F A;  1RVF 2;  1V9U 2;  2QTW B;  1SPP B;  3PTR B;  5A7P A;  1QU0 A;  2WT0 A;  5LA9 A;  3JQX A;  4JQR A;  1UXX X;  1MQT B;  3VHP A;  3R05 A;  1JZ2 A;  1LOF A;  3ACI A;  4UBG A;  5JMC A;  4YAR A;  4LO7 A;  1ASJ 1;  1C8M 1;  5FY4 A;  3KQ4 B;  1B35 C;  3RYK A;  2BGP A;  2ET7 A;  5T5O A;  1JZ7 A;  1OFN A;  2CHH A;  3FN9 A;  1VBE 3;  2WAB A;  4TXW A;  2WZ8 A;  1O91 A;  2VEC A;  2ZZQ A;  4FOV A;  3WNO A;  4EYU A;  2YC0 A;  1H6Y A;  2W1S A;  1GU3 A;  3OGV A;  1AYN 2;  1SG3 A;  3GHM A;  1CAW A;  2DCJ A;  4FP2 A;  5FYI A;  5LK5 A;  4KL1 A;  4E2Q A;  1DGR N;  2WNO A;  2HBU A;  1AR8 1;  2B9U A;  4QQ2 A;  1CAX B;  2ZTN A;  1S2B A;  3GBW A;  1VRH 3;  1W9W A;  2W1Q A;  4XFB A;  5LZ6 A;  4WM8 C;  1LR5 A;  1RIT A;  2I2S A;  3NWK A;  2XLF A;  3K3N A;  1EP0 A;  1RHI 2;  3ZFF A;  2FDF A;  4NID A;  1MEC 1;  1H4H A;  1VP6 A;  3BTY A;  1NKG A;  4YGB A;  2OX0 A;  2BZD A;  4R9D A;  5LA2 A;  1HIX A;  4BE3 A;  2E32 A;  4OYU A;  1SLC A;  1DFQ A;  2UY9 A;  1SCR A;  4GA9 A;  3MIH A;  5EFU A;  3DV8 A;  2HWE 2;  2ATF A;  2WAA A;  3K4Z A;  3PNA A;  4GH4 B;  1EPZ A;  3I8T A;  4ARY A;  4AVV A;  4EZ4 A;  2E7T A;  3WDW A;  5ABJ C;  3UGG A;  1PMI A;  3K75 B;  3C7F A;  3KF5 A;  3O7O A;  4NOT A;  5FQ0 B;  4E9K A;  5BY5 A;  1A34 A;  5D8A C;  1J1L A;  3DEC A;  4HSJ A;  5HV4 A;  1QJX 2;  2RR1 2;  3PU3 A;  1PO2 2;  1V0A A;  2R1B A;  1A8M A;  4BQ3 A;  4MGQ A;  4IGO A;  4LEJ A;  1CAX A;  1GBG A;  2CNA A;  4GJY A;  4P9G A;  3HN3 A;  3WQ7 A;  4XCB A;  4QT6 A;  2YRO A;  5A7W B;  1DYO A;  2ZKL A;  1HJF A;  4W65 A;  3D8C A;  1FT9 A;  3TRS B;  5FPL A;  2OZ6 A;  1D2Q A;  1IPJ A;  1NQD A;  2ZX2 A;  4M4R A;  5A6X A;  2DVG A;  4UFH A;  2V73 A;  4P9W A;  1AX2 A;  1O7F A;  4QKB A;  3V65 A;  5JOX A;  1QQP 3;  1W0O A;  2VVF A;  4BWO A;  1RJ7 A;  2JD9 A;  3VKF C;  2DUP A;  1J3P A;  2GN3 A;  4HBN A;  3WF0 A;  1HQL A;  5HV0 A;  2PAM A;  2X5I A;  3G6J B;  2B45 X;  3S5A A;  4Y26 A;  2WQZ C;  3WF3 A;  4YVS B;  1AL2 2;  4B4P A;  4S2F A;  4MAD A;  5FTT C;  5F5A A;  3PVN A;  1GV9 A;  1R1Z A;  2WNV B;  2RJL A;  2LW8 A;  3C3V A;  1WLW A;  3HPN A;  4D6S A;  5BNN A;  1NA1 A;  3E97 A;  4KGQ A;  1U5Z A;  2O8O A;  1OOP C;  1Y9M A;  4OMC A;  5A3P A;  3HNM A;  4DUW A;  4FXK B;  2PMW B;  4IXL A;  1FPN 1;  3QBQ A;  1ZZC A;  1HXS 3;  4FAG A;  4Q0S A;  2DFC A;  2VAU A;  3M3I A;  3TN9 3;  3KT4 A;  1PX3 A;  5C4W B;  4V2V A;  3DN7 A;  4IV3 B;  1QJF A;  2OYZ A;  4HVO A;  3SHR A;  2VQT A;  1UYY A;  3ZIW A;  5KC6 A;  1JZ3 A;  5IK5 A;  3FLT A;  4ASL A;  1IHM A;  1T6G C;  2JG9 A;  1EYB A;  2WQ8 A;  1UMH A;  4P5H A;  4DEV A;  4QKD A;  1PNF A;  2FMD A;  2I07 B;  4IEQ A;  4N53 A;  1REF A;  5DDJ 1;  3MPB A;  1DLL A;  3MW2 A;  3VDD A;  5A3T A;  4FO9 A; 
#chains in the Genus database with same CATH homology
 5LA0 A;  5EIY B;  1JYW A;  1CX1 A;  4QDQ A;  2QQO A;  4P02 B;  3K46 A;  3T0B A;  2Y6H A;  4D0Q A;  4A6O A;  5JXH A;  3W5M A;  5JXI A;  1O8S A;  5C70 A;  5HXM A;  2XON A;  3WNL A;  3WNM A;  4ZXE A;  3SEE A;  1TVG A;  2J7M A;  4P00 B;  3VD4 A;  1XNT A;  1I5P A;  4XZU G;  1CIY A;  1GMM A;  2E26 A;  1SHW B;  2RVA A;  2V5D A;  1UY1 A;  3CIH A;  5DQ0 A;  3IB3 A;  2VZO A;  3HNB M;  2VCB A;  2Y6K A;  4UAP A;  1JZ4 A;  2VMF A;  2Y8K A;  1W99 A;  2J1T A;  4QX3 A;  4DXS A;  4ZZ5 A;  1JZ5 A;  4QX0 A;  3WEZ A;  3THD A;  3LEK A;  4M4P A;  1L7Q A;  1UY0 A;  2J1A A;  3SEP A;  3CMG A;  4CVU A;  3OG2 A;  3OGR A;  1OH4 A;  1SDD B;  3SKV A;  1OD3 A;  4TTG A;  1UYX A;  4CU9 A;  1H6X A;  2QQN A;  1R64 A;  3T2O A;  4AG4 A;  5CZK A;  2WN3 A;  4FI9 A;  1UXZ A;  4KWU A;  5DPN A;  3ACF A;  2VZS A;  3LEG A;  2W91 A;  2W5F A;  5G04 L;  1IQD C;  4GZ9 A;  4W4Z A;  5J1X A;  3VDA A;  3ETP A;  1PX4 A;  2J1S A;  3UET A;  3WF1 A;  2W46 A;  3T2Q A;  1CZS A;  5DN2 A;  2VO5 A;  2V72 A;  1F4H A;  4HG6 B;  4E8C A;  2VC9 A;  1UY2 A;  4XUQ A;  2BGO A;  1NAE A;  2EIE A;  3PUH A;  1MPX A;  3CKH A;  3OGS A;  4A45 A;  4LQR A;  2Z4F A;  1K42 A;  4XVH A;  5C71 A;  2B9V A;  2Y64 A;  4GWI A;  2WDB A;  3BGA A;  1UMI A;  3A22 A;  3WNK A;  2WUH A;  2JKX A;  5A1A A;  2VMD A;  3ACH A;  5IHR A;  1PMH X;  5JR2 A;  3ECQ A;  1UZ0 A;  1DP0 A;  4P08 A;  5JXJ A;  2L9L A;  4XUN A;  1W9T A;  4BJ0 A;  3GXU A;  3I3B A;  1TG7 A;  2RJ2 A;  4CU7 A;  2VCC A;  2JE8 A;  2VM9 A;  2VTF A;  3MO4 A;  3AC0 A;  4DUX A;  2Y6J A;  4JHZ A;  4JKL A;  4A4A A;  4OZO A;  2OKX A;  4A44 A;  3LPF A;  4QB2 A;  1PMJ X;  1NUK A;  2R7E B;  3CQO A;  1GOH A;  1K3I A;  2WO1 A;  2WZE A;  4LPL A;  1GQP A;  2W94 A;  4BK5 A;  1UX7 A;  1HN1 A;  3D3A A;  1UWW A;  1GOF A;  3I2I A;  1UYZ A;  4D8M A;  3T0D A;  3GM8 A;  1JHJ A;  2Y6L A;  2C9K A;  3ACG A;  2VZ1 A;  1T2X A;  2WN2 A;  4XUO A;  4QB1 A;  3GGL A;  2J1V A;  4QX2 A;  4Z2A A;  4UOJ A;  5JMO A;  3MV1 1;  3T0A A;  3I2H A;  2X09 A;  3WF4 A;  3C7O A;  3OB8 A;  1J83 A;  2VZQ A;  3I2J A;  3IDA A;  4CU6 A;  1CZT A;  3I2F A;  3MUY 1;  4JKM A;  1CZV A;  2QQL A;  5CYY A;  3LPG A;  4XUP A;  2BER A;  5F7U A;  4DUV A;  5B4N A;  1RYY A;  1KGY A;  2W3J A;  3I3D A;  2ZXQ A;  1EUU A;  1JYX A;  1US2 A;  2J1R A;  3HJR A;  4KMQ A;  2CDO A;  4CUB A;  1OF4 A;  2VOT A;  3LQC A;  3DYP A;  1XC6 A;  4BDV B;  5DMY A;  2W1W A;  2HLE A;  4W50 A;  2QQJ A;  3CDZ B;  2QQI A;  4OUE A;  4ZZ8 A;  1K12 A;  1UY3 A;  3P6B A;  3C7G A;  3I2G A;  3WQB A;  4DEQ A;  4RYD A;  1DLC A;  2VL4 A;  1O8P A;  2PQS A;  4QPW A;  1OT5 A;  1BHG A;  3HEI A;  5JXG A;  3I2K A;  1GUI A;  3NNG A;  2VZ3 A;  4XUT A;  1EUT A;  2KD7 A;  1YQ2 A;  2QBX A;  2W1U A;  3GDB A;  1K45 A;  3EB7 A;  4QDS A;  4DXR A;  4QB6 A;  1W0N A;  1O59 A;  2X10 A;  4DXT A;  2W47 A;  4LHS A;  1JU3 A;  3III A;  5LCW L;  4ARX A;  3U37 A;  3F2Z A;  2B4K A;  2J1E A;  1D7P M;  4ET7 A;  1NX9 A;  3NQH A;  2VJX A;  2V4V A;  2ZEW A;  3VDC A;  2EID A;  2LS6 A;  2XOM A;  1J84 A;  3C7E A;  3C7H A;  2VME A;  2VMC A;  2W87 A;  1GOG A;  3VD5 A;  2WYS A;  2Y6G A;  3SKJ E;  3T08 A;  1ULO A;  4CU8 A;  4A42 A;  2DDU A;  1JYN A;  2XHN A;  4OMD A;  5JUV A;  2WAO A;  4KI5 M;  3MV0 1;  4GWJ A;  3OBA A;  2BBA A;  3NJX A;  3A7Q A;  1W8N A;  1JU4 A;  2QQK A;  3HOB A;  3P1I A;  1OF3 A;  2VZV A;  3DYM A;  3BN6 A;  2C26 A;  1L7R A;  4QX1 A;  5HPO A;  3DYO A;  3FHQ A;  2WO3 A;  5G05 L;  2DCK A;  3VDB A;  3K77 A;  5IFP A;  2CDP A;  2WBK A;  4PT6 A;  4YPJ A;  2VQU A;  3J7H A;  3A21 A;  3K4A A;  2WO2 A;  4JX0 A;  3UES A;  1WCQ A;  3W5N A;  1WKY A;  2XQX A;  1F4A A;  1XPW A;  3I97 A;  3NRU A;  3PUI A;  2YFU A;  2ZEY A;  3I3E A;  2W95 A;  4UI9 L;  1P8J A;  3THC A;  1JZ8 A;  2E31 A;  2ZEX A;  4PQQ A;  3ZM8 A;  3VD7 A;  5EJ1 B;  3CZU A;  3VD3 A;  3T2P A;  3ABZ A;  4P5Y A;  1UXX X;  3OEB A;  1JZ2 A;  3ACI A;  2JDA A;  2ZEZ A;  2VR4 A;  2BGP A;  3LE0 A;  1JYV A;  1JZ7 A;  3VD9 A;  3FN9 A;  2VZT A;  5IFT A;  2WAB A;  3WF2 A;  4TXW A;  2WZ8 A;  3IAQ A;  4JKK A;  1LNS A;  4PF1 A;  2ID4 A;  3WNO A;  4BK4 A;  1H6Y A;  2W1S A;  1GU3 A;  3OGV A;  3IAP A;  4MO3 M;  1SG3 A;  2DCJ A;  2RV9 A;  4A41 A;  4AAX A;  1GNY A;  3WNN A;  1W9W A;  2W1Q A;  3EYP A;  3T09 A;  4MOA A;  3HNY M;  3FHA A;  2YFZ A;  4LKS A;  1ULP A;  4IUG A;  1NKG A;  3A23 A;  2BZD A;  5B4X A;  2VZU A;  5LA2 A;  4MGS A;  2E32 A;  4OYU A;  3MUZ 1;  2X05 A;  2EIB A;  2WAA A;  1W9S A;  3K4Z A;  4ARY A;  5IYY A;  3CZJ A;  2EIC A;  3K75 B;  3C7F A;  4CUC A;  1KEX A;  4RN5 A;  5EJZ B;  2J22 A;  3K4D A;  3DEC A;  3OEA A;  4CUA A;  4MGQ A;  3HN3 A;  1US3 A;  3WNP A;  2W9X A;  2YC2 A;  1DYO A;  5LA1 A;  4M4R A;  3UNP A;  3C8X A;  2YG0 A;  2JD9 A;  4E8D A;  3WF0 A;  1JZ6 A;  3WF3 A;  4MAD A;  2VZP A;  3NJV A;  3LEI A;  2LW8 A;  3E1F 1;  3HPN A;  2W92 A;  1W8O A;  4A3Z A;  4QAW A;  3FL7 A;  4OMC A;  2ORX A;  3HNM A;  4DUW A;  1UY4 A;  2YC4 A;  2VCA A;  4BXS V;  2E33 A;  1PX3 A;  2C4X A;  5C7G A;  4ZY9 A;  4XUR A;  4QDR A;  2VQT A;  4W8J A;  1XNA A;  3WSO A;  1UYY A;  1JZ3 A;  2YB7 A;  5IJR A;  4L0P A;  2HYX A;  5I0D A;  2VZR A;  2WQ8 A;  1UMH A;  2QQM A;  3MBW A;  4DEV A;  3JXS A;  2ORZ A;  5FUI A;  1JI6 A;  2J1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...