4ZXPA

Crystal structure of peptidyl- trna hydrolase from vibrio cholerae
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
196
structure length
195
Chain Sequence
VSQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELDLPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQELDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
publication title Unraveling the stereochemical and dynamic aspects of the catalytic site of bacterial peptidyl-tRNA hydrolase.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor str. n16961
total genus 65
structure length 195
sequence length 196
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2015-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4zxpA00
3TCNA 2JRCA 4FNOA 3TCKA 3KK0A 4HOYA 4JY7A 4DJJA 1RYMA 4IKOA 5EKTA 2MJLA 4JWKA 4QAJA 4Z86A 4OLJA 4JC4A 4YLYA 1RYNA 2Z2IA 4QT4A 3P2JA 2Z2KA 4FYJA 3VJRA 2NAFA 5IKEA 4DHWA 4LWQA 3NEAA 5IVPA 4QBKA 2PTHA 4P7BA 3TD2A 4FOPA 3V2IA 4QD3A 4FOTA 5IMBA 4ZXPA 3TD6A 3KJZA 3OFVA 4ERXA 4JX9A 2Z2JA 5B6JA 1RYBA 2LGJA
chains in the Genus database with same CATH superfamily
1H2YA 2VSNA 4LVNA 1FE8A 2JIOA 3FIJA 1JEAA 3R7DA 5HOEA 2XQFA 1GO2A 4R2LA 2GJ4A 3R5KA 1VPLA 2BGUA 2JLZA 1ZOOA 1NW8A 1O4WA 2QLJA 2VYNA 2Z5FA 3F5SA 3WLSA 1MG0A 4F71A 5IZCA 3AINA 3HRKA 4MGKR 2DHRA 4FYJA 1TF7A 4QJBA 1C4KA 4Q4LA 1VSUA 4Y9RA 5J4LA 3DC2A 1S7CA 4AMBA 2AG6A 4DDVA 5J9FA 1POXA 3O73A 2Q9AA 2EJTA 3S2SA 3W2TA 4WAUA 4Q4CA 4NU5A 4U5QA 1NQOA 5AK5A 5AP9A 3GRRA 1PUJA 1G0OA 4BZZA 2MYPA 2NUPA 5D7NA 2G76A 2Q21A 1Y33E 2FLWA 4B6QA 4ZFNA 4PGHA 3I92A 3VMMA 1N8SA 2VF5X 1GU7A 2Q4BA 3WQBA 3OPQA 2FAXA 4A27A 4K6OA 2Q5FA 3GFGA 3GGDA 2YASA 5EGNA 1EFRD 4BNJA 1WXGA 2XCIA 3HA3A 4GNRA 3PRYA 2P2NA 1TZJA 4PHGA 3BGOS 4G5RA 1CJKC 3NANA 3IE1A 3P9YA 4GKVA 4DRXA 2O3QA 4MYTA 5AO9A 1XDUA 4IWXA 4GAEA 2HF2A 1RADA 1ATZA 2PRJA 3DM9B 3OO1A 1FFAA 3KZMA 1TGVA 1SXJE 4R5HA 4U00A 4ALIA 5EIWA 1YJCA 3THWB 3KTAA 1E9FA 2A8YA 2W2TA 3K05A 3D7KA 5DBGA 3NTXA 4GLOA 1Z33A 1J8VA 1EDEA 2RARA 5KVQA 3TQQA 1ZVVA 4B3HA 1KJNA 2J5XA 5CXXA 1B41A 2GK7A 4NS4A 4CG0A 1WEHA 4M22A 4O2RA 1GV1A 5ERYA 3UT0A 4QEKA 1TF2A 5KWVA 2LWIA 2OXTA 1JDBB 1M67A 5JY6A 1U5BB 4L8LA 1RVDA 1TD1A 5T4FA 2D1YA 1BFDA 3QQ5A 1N6RA 2O7RA 2GCIA 4FDVA 5AVXA 4PLZA 3OZDA 3F7NA 4O4HB 1RXVA 2YXEA 3LZDA 1C9KA 1XJ5A 2BZ0A 3SX2A 3W2IA 1F51E 4OHBA 2NYVA 3G9UA 4AZSA 2PD6A 1ZAYA 5CJJA 2P41A 1F20A 3FB4A 4OPMA 5D8DA 5GJBA 3QA3E 4R3WA 4KIUA 3WLPA 2VWHA 1LF5A 2F1HA 4GRDA 4D8UA 1TIPA 1TZBA 4AJNA 3L7LA 3UUFA 5EJGA 5L6LB 4CLRB 3AK4A 4OX9Y 2O07A 2Q41A 1FW6A 3E4DA 3DBOB 4I19A 2JJQA 5CCBA 3ZW7A 1Q7EA 2WZQA 1CW2B 4Y6OA 1J9ZA 1OVMA 2EZ4A 4CJXA 2VWGA 4RD2A 2W6JA 3FY4A 2QVZX 1ZIDA 3L0YA 4LSWA 2JKZA 1TJNA 1PR1A 3TH5A 5GOZA 1BW9B 2DGDA 2LNDA 1E79D 1EVLA 3FSRA 4EIWA 3GC6A 5LLDA 1F4LA 3PYXA 4LNHA 5EWLA 3OOSA 2V7GA 4OO3A 4B6FA 1LVUA 3PE3A 4YRQA 1KRHA 4MDHA 3WJ2A 2N47A 3GZ4A 1QK5A 1JW9B 1YQ9A 1EE9A 2JI6A 3HS3A 1DCFA 2H4JA 2YZ2A 4Z51A 3EBOA 3IB3A 4UEJA 4IVPA 2RHRA 4UULA 3UJCA 1YJAA 1ARZA 1A8PA 1RHKA 1O4VA 3O21A 5EZYA 3JD1A 1H6CA 4IVRA 4AO6A 1XHFA 3ZWPA 3WYEA 2Z43A 3D8SA 4RSGA 4FOLA 5JCXA 2QTTA 4N7MA 3JW8A 3SDSA 5MN4A 3U44B 4KAFA 1AZTA 1K06A 4OGFA 4PVCA 1B6TA 2Q1WA 2TRSB 3HDVA 3MLAA 1NVTA 5EMHA 4D6XA 4D4KA 4YRZA 2CSUA 4KXWA 5E4FA 3EJ6A 1CB0A 2FPUA 2G1KA 2H5LA 4WOJA 2CDBA 1DKLA 2XMPA 4L51A 4Y0VA 3PKJA 3OZGA 4G9GA 5HA5A 5C8DA 1YZTA 1KA9H 2R1TA 2A67A 4BECA 3ORRA 4XYBA 2D8MA 5AH0A 3BX1A 1ECPA 1UMCA 4JHXA 4XYEA 4NABA 2TS1A 2XYPA 4O2AB 3V97A 1QRAA 3AWIA 4I9FA 1E6MA 5F9MA 4B4DA 4RPIA 1Y81A 1GAEO 5J59A 2G5GX 3V4ZA 5KQLA 3Q8XB 4PICA 4GPAA 3IALA 4CDMA 2AUMA 2C78A 2I2BA 2FW1A 1CZLA 1W46A 1NAIA 5IXYA 3KSAC 2V5AA 1E5TA 4NBUA 1V16A 4D9NA 3GGCA 621PA 3PNOA 5K3OA 4R5MA 1Y89A 3WDKA 1M2OB 1KMCA 2O7SA 2P35A 2YN2A 3TPFA 5JVDA 2ZAOA 1BCSB 4J1SA 3SQXA 2D1QA 2H65A 4I08A 3FYUC 2ZBEA 1PJ2A 2WU1A 4FBGA 4NV0A 4BNKA 2JH9A 3IPXA 4WPGA 2P0AA 4WNAA 2NUTA 5JAZA 3J7AC 1NFQA 1SG9A 1MO3A 4KE8A 4LRWA 1TEZA 1LJLA 3ZGYA 2QRGA 3MTIA 4CYMA 1FXWF 2QP3A 4L4YA 5B6PA 5A0TA 3DMDA 3C3WA 4MXDA 1GUZA 3KKOA 1N5OX 5LA6B 3ROKA 4IQGA 3MTEA 2PV7A 2H4FA 3QFRA 4LF6B 1JHUA 2J3DA 3DXFA 1G16A 3WGYA 2B6NA 3DEKA 2P5SA 1CVRA 4HMOA 5C1OA 1IIBA 4I0WB 2I4RA 2QN9A 1YH3A 1WAMA 5AM3A 3QFTA 1A5BB 5HIMA 1T4CB 2I8LA 1HG1A 1JR3D 2PVPA 2ZULA 4JASB 4LCEA 4MWSA 3GPDG 4NU8X 3ICQB 2J4FA 3DWGA 3H86A 3OMXA 1NJ6A 3EIQA 1EYZA 1Z22A 3H2GA 3KT6A 3MFQA 2YYSA 4UM7A 4ZYLA 2C7PA 3HWX1 4PNPA 4TZTA 3ICEA 4GLBA 1H6DA 1HMPA 4FONA 1S3SA 3DC7A 2CXQA 1LDBA 4N40A 4PFQA 1RAIA 4ZYVA 2ONCA 5AW1A 3E5NA 5CB6A 4OHCA 5KX5F 4C04A 4MW6A 1L5RA 4H2DA 4MICA 5JZMA 1CRPA 5KINB 2XD9A 2YN4A 2YWJA 3FHCB 3L7DA 2J3HA 3ANXA 1AKRA 3LY8A 4ENRA 3QEBZ 1AKNA 1JEYA 4QDJA 4ZEWA 1P31A 3T7CA 4Q34A 1E8NA 1XEWX 3CN7A 5KSYA 2CZQA 1XF1A 2Y6UA 2B3DA 1D7OA 3IAUA 3TQCA 5FAXA 5FOVA 4CEHA 3I76A 3GYBA 1GRQA 2W71A 4JYZA 4I55A 4UPVA 4NESA 5F1OA 2HNBA 3MXOA 1PZNA 1T9BA 3GLUA 3O92A 4H7IA 1OIWA 1H2EA 4ZVLA 5A3VA 3G88A 4GMXA 3WLLA 1NF2A 4QL3A 1U2QA 4O33A 4R8SA 3WLTA 3T61A 2GPNA 5KJCA 2QD3A 4CLHA 1E1CA 1QQ6A 2OY0A 5E6UA 1ZOLA 5EYPB 1Q0ZA 1KO1A 1REQA 1X7WA 1QQAA 1GAXA 4KSCA 1PZMA 1D0IA 3EC1A 3A1VA 4M0CA 4BJ5A 4RLHA 3DEJA 4MVJH 4X9XA 5H81A 4YAJA 2R48A 3AZOA 4R6WA 2HLHA 4LRXA 3BDAA 2AJ8A 3EVFA 1E1RA 3KLMX 4U39A 4EYEA 1FRVA 4KXVA 3IEXA 4ML3A 3DZIA 1C7QA 3PP8A 3CURA 1U7HA 4TYMA 1GVNB 1SEVA 3KB8A 4TRJA 3NFRA 4Y6LA 3E3AA 2FZGA 5EGSA 3AM5A 2IV3A 4D5EA 1T9ZA 3GMDA 1B15A 1F9AA 2VJKA 1U2SA 5IMSA 3U4DA 5FBKA 5H9WA 1XVIA 3G6KA 4H4CA 3VVCA 1GVHA 1UXKA 1M6EX 1U1EA 2PTGA 4PTZA 3EAGA 4XGIA 1L5SA 5AQEA 3VR3A 5HKBA 3FUXA 2C88A 4N6NA 3W79A 1FB5A 4E70A 5ER9A 1TNDA 3W9BA 3VR2A 1YIDA 3DYBA 3PYMA 3QVWA 1LU9A 1SH7A 2ZWAA 3G2IA 1E2BA 1EK6A 1ZX1A 1W0KD 4J0FA 4Q7MB 5K3EA 3LTNC 4FXOA 3TI9A 5AOAA 1PV2A 2GVNA 2SCUA 2P9EA 2O6HA 3AL3A 2EX4A 4RMNA 1CP3A 1VHLA 2EW8A 2GUGA 5IAOA 1BRTA 1JTVA 4Y2PA 1JXQA 2QTGA 4X7RA 5EKTA 3M4YA 5D84A 1P7VA 3RUAA 1QHEA 3STHA 3R4CA 4NE7A 3B51X 3GHHA 3LXRA 3UCEA 3ZHXA 4RTSA 3E7WA 2GXSA 1WDLA 3CC8A 4UHDA 4EG6A 1Z62A 1E7MA 1RJWA 3VZQA 5HNKA 5FI0B 4TLDA 4YTEA 1OIVA 1W48A 2RI1A 3V8PA 4WK2B 1QVVA 3E2MA 3D3NA 3EE6A 5BW5A 1N5MA 2QXYA 3LF1A 5K0CA 2E4XA 1D1TA 4HNTA 2SICE 4KR0A 3OX3A 3WQQA 4KQHA 3AR8A 3E05A 3ZDYB 3KDSE 1G66A 4KIWA 1JFFB 5JALA 1KYIA 3FKJA 1PD0A 3EISA 4QQNA 5BOSB 3THWA 1OOEA 1J2UA 2O3RA 5T41A 1GTVA 3LBYA 5KJ1A 2JLUA 3Q1KA 3Q2IA 3T3NA 5IJXA 3GROA 4K7JA 3BQNB 3IOYA 3ZHZA 2GN6A 3LCMA 1EZ4A 1LBTA 2A1TS 2WVHA 2ZI9A 3O8QB 1KR2A 3NTQA 3VDQA 3TTUA 2XV1A 5KVVA 3L0CA 1KXZA 2ZBDA 2QI9C 1WOMA 3SEAA 5IVKA 3S44A 3D64A 1U5BA 3M9WA 3EZNA 2KM1A 2YZ7A 1ZGBA 3HGQA 2QN7A 3M6FA 4C1BA 4EFMA 3ICPA 3PKZA 2YHSA 2DMRA 1DX6A 4MV8A 1THMA 1AKQA 4O4HA 4PQGA 1EQAA 1KNQA 1YBFA 2R1UA 2WT4A 5KC9A 4HFRA 4UTOA 4GPTA 4M9CA 4B9EA 1FZTA 4B80A 2B1IA 4RIFA 5F1KA 2C7OA 3JSAA 1VIDA 2H2DA 2QRZA 4L7QA 2YY6A 3RF7A 1FFDA 4J76A 1XK6A 2KB0A 2WABA 1S8AA 2QWXA 1W29A 4WY8A 4CLRA 2FF5A 1N0WA 2QM8A 4AF7A 2NTJA 3ZG6A 4H7EA 3DO5A 3E58A 5CM2Z 1JQLB 4NAVA 1YS1X 4OTZA 1CR6A 1TECE 2ZBUA 3BN3A 1NJ8A 1XAJA 4DXHA 3O31A 4YCCA 2E87A 1JDVA 1QK3A 2HI0A 4AG6A 4OJKA 1BW9A 1D8TA 2C8JA 1PJ8A 1CC1S 1PR9A 1CUSA 4EY7A 1N6LA 1U80A 5BORA 1XZAA 1CCWA 4LC9A 2YV5A 1R9NA 4PRLA 4GC5A 3VDNB 1U3GA 2CLKB 1VG8A 4REOA 1L1QA 1HFKA 4Z99A 5FTKA 2QV7A 4W9NC 1M10A 4QPDA 3ORQA 5LJIA 3FPJA 3IS3A 5B1HA 2JFUA 3IP6A 4RTMA 3K2BA 3TXAA 5DWVA 4JJAA 5G40A 1QO9A 1JVBA 2VRWA 2A0UA 4PZUA 4EHLA 3U44A 2ZB2A 3OURA 4PCAA 4GDFA 2FQXA 1FP2A 4ZT3A 2NLOA 4E2ZA 3CF4A 4NZNA 4YV1A 1AKEA 4AD8A 1R4ZA 1RCTE 3U1BA 3LG2A 2ZSUA 5D2CA 3BILA 2OSVA 5IZ4A 5LDDC 1UJ5A 1NBME 3MVEA 2WSBA 2WB4A 2QGFA 2SKCA 3F47A 3QQPA 2Q4TA 4JBNA 1AT1A 3IJRA 3JCZA 2CYCA 4TWZA 5BUQA 2CNDA 4Z86A 1D8AA 1PZHA 3EOAI 4L5YA 4WIAA 4Y98A 4HHEA 4YAKA 1Y42X 2XGSA 3ESRA 3RU2A 4DT1B 2QIPA 1SEPA 3C7DB 3D1LA 1C8BA 2Z9CA 2XB8A 4O2AA 4CCAA 2BISA 4OB7A 3M6IA 4P82A 2C3MA 2YOFA 2YC2C 3GFPA 3LFTA 1U0HC 5DGXA 4LRSB 3ABRB 2Z5VA 1ZS9A 5A5VA 3UIEA 2D6FA 3GR6A 5CFZA 4BMCA 3SJZA 1Q0PA 3GB9A 3OU2A 4ES6A 3MAJA 3E5HA 4GPZA 3RSLA 3TD6A 4EL0A 5KVAA 1Q1ZA 1HDCA 2YXDA 3PZRA 4QICA 4RZHA 1M2OA 1UK7A 3QWHA 3ABZA 5FUVA 4V1CB 3VV3A 4A0FA 2IZ6A 3R8XA 3MGAA 1BCSA 2KW5A 3B6ZA 2V7XA 3ZBPA 1O5TA 2HMAA 1TD9A 1U81A 4XRRA 4V2IA 4N3AA 5AKXA 1SIUA 4O29A 4QM7A 1UAYA 1UK9A 3AY3A 5IBPA 4BIIA 1CSEE 2O0HA 1LK7A 1LW6E 1KK0A 4R2IA 1J5PA 3L3BA 5HG0A 2EKDA 1U9IA 3LZCA 1XHLA 4YY3B 4YXWA 3EMKA 4QODA 4FGSA 5LA6A 3CGGA 4L02A 3FCEA 1C4OA 1AH2A 1W44A 3HJAA 4HYQA 1H8HD 2A1IA 2D2VA 2W2QA 3KSZO 2HLPA 2IIPA 5DVZA 2WJWA 2AHOA 1DUIA 1Q11A 1XKLA 2IYPA 4HP8A 1XZMA 3QV1A 1T4CA 2QXTA 4PVDA 1PNOA 1IBRA 4HOYA 5KTMA 3JQFC 3QVTA 8LDHA 5FRDA 1ODJA 4JD5A 3VZRA 4XPIB 3H4MA 5FOWA 4OHOA 4US0R 3QEMB 3G9ZA 4CRWB 4X95A 3L7IA 1I4DD 1PDWA 2R62A 2JIRA 1CUFA 3AOGA 3BJMA 3ZNQA 3H1BA 5KTKA 5M34A 4MDFA 3RWOA 1V95A 3JVVA 4P0QB 1U6JA 5E6RB 4YDQA 3CVWA 3OVMA 3NORA 2PIAA 4LN1A 3NHFA 1O94D 2CB9A 4CF4A 2HREA 5HRCA 3EBLA 3D6VA 3W2HA 2DLNA 1ZVQA 2GKGA 2OCDA 2AH5A 1ZJZA 3I58A 2QOEA 2NU8B 3KPWA 1QH8B 3DULA 1RBQA 1BQ4A 1KJZA 3BWBA 4WN9B 4BNHA 4GH5A 3DBRB 1W4BA 3T3OA 2GZAA 5LQSA 2PO5A 1EP2B 3B60A 3Q1LA 1ORHA 3NOXA 3L0DA 5HS4A 4DAEA 4JB3A 2NXEA 4IS2A 3QLVC 4MWBA 3CVUA 3IUBA 2QZPA 3L41A 4QYXA 3X1DA 5JLAA 3UBTA 2RIRA 1OXXK 1RFGE 1T8PA 4PX9A 1U90A 3AEYA 2BKUA 3JQAB 4Q15A 1I8TA 2GSDA 1AQJA 4ZCMA 1I5OA 5F5XA 3U48A 4XX1A 3A6LA 5EYPA 5ECWA 1HNXB 1GNSA 4NYMQ 2I2DA 4KSBA 4YDHB 2GPBA 3MT9A 5A2GA 5KVCA 1AKVA 1JT2A 1RJFA 2ES4A 2VYVA 5ETJA 4J6FA 421PA 5H9VA 4XWOA 5JDIA 2YS7A 1ICIA 1L5MA 1ZD4A 7ABPA 1VHQA 1U7PA 5BSMA 2GM5A 3BAZA 2I29A 3JZFA 4O3FA 3R3ZA 1F2TB 5MDHA 3HR8A 3N2EA 4HGPA 3N8GA 5JC1A 2G9RA 4W8GA 1XMQB 1BGVA 4W5NA 3O4FA 1BS2A 1ES9A 1NN0A 4MB6A 4WUVA 5E4YA 2GJSA 2PAFA 5ARDA 4CMJA 4UATA 1KRXA 2BTOA 2NAFA 3U3JA 4DUGA 3DE3X 1FDWA 3C5VA 4K26A 3ROZA 1DJOA 3O03A 3HCRA 2HBRA 3ND9A 5BT8A 4O59O 1NHGA 2X9GA 4YWHA 4UOZA 4COOA 1U02A 2P2CA 2DLDA 3IRUA 3N5CA 4FFSA 4JLMA 2WMYA 3ZE6A 1K3UB 2X86A 2V0GA 3M9LA 3N2YA 4P5PA 4PZEA 3IVAA 4KXNA 3PIRA 3CB4A 1CUDA 4P08A 4F5ZA 2HRZA 2TECE 3BXHA 4FFNA 1NKSA 3T3MB 1K5PA 1F38A 4FMDF 4PN7A 1SKAA 3REQB 5L51A 4CUJA 4IXWA 2GEKA 1I2AA 3KS9A 2ZS7A 4E13A 1RS0A 2ZK7A 1HFWA 3QV2A 2XUKA 2YJNA 5IT0A 4IPTA 1N2BA 2JFFA 2DTXA 4Q3CA 2HYIC 3ZWXA 4ND3A 2QB5A 1NYLA 1CEXA 1SIOA 3PFGA 2PRSA 3BB4A 3C6BA 2OXEA 2W4IA 1ZK2A 1R16A 2VT2A 3DZKA 3KAKA 1HZZA 4HZUB 4KQ9A 4QDXA 3K5IA 4ETMA 1FNMA 4IUDS 1DELA 2ZSDA 1OTHA 2G70A 3BD9A 1Q74A 3FOAA 4QTXA 2Z08A 2ATXA 3K5HA 5DGDA 3RSSA 3UAVA 3AO0B 3I12A 3N70A 2V7VA 3BHJA 3VH3A 3Q8KA 2IH4A 1K0FA 4LRQA 1PW7A 4MUMA 5KYTA 1UJBA 1UPAA 2GWRA 4LOIA 5K1ZA 5KAPA 2P3LA 3KDAA 5AOVA 4URWR 3HRHA 3KHUA 3B9PA 1JFFA 1U5AA 4OV6B 3OWXA 2VPWA 4UHFA 3WWDA 4MA5A 1FDSA 3HADA 4LX0A 5BOSA 4TXMA 5KC8A 2ZETA 2VK2A 1PQUA 1S7GA 2EG5A 3AEXA 4NEGA 3HY3A 4YVFA 3RGGA 2IY8A 1LLCA 1T10A 2BJWA 1QONA 3Q3CA 4GSYA 4DWWA 3O8QA 3EODA 4HFJA 1K08A 1T15A 1NL3A 1VSQA 4N03A 5DW3A 1F1JA 1U3FA 1BDIA 3PXXA 1U3VA 5EERA 5KWEA 3LY9A 4UMDA 3OQNA 4HLCA 3V8BA 1WKVA 3NHLA 2J6IA 3HN7A 1GAWA 2R47A 4PXAA 1GRCA 3RJMA 4GR9A 4KUHA 1P7WA 3SBEA 5J2TB 3EPKA 1RXYA 3EMVA 3KLNA 4PQRA 1EBUA 4F8JA 2LPMA 4G1FA 2EDCA 3NTLA 4PSUA 4RGQA 3MJDA 4NCXA 5AKZA 3FMOB 2BVNA 1GHTA 1Y63A 1G8GA 2QUKA 5DTIA 3JX9A 3W4IA 2OBNA 3EQ9A 2ZI3A 1XNJA 3H2HA 4NWIA 4QT4A 2PUBA 1PT6A 3GGSA 2PS1A 2QQ0A 3GARA 4BLRA 1G5RA 1VG9B 1HZJA 3UJ8A 4DPKA 2CCJA 3JASB 1FLAA 3SZ3A 4B8ZA 4H59A 4ZARA 3MUEA 3H2KA 4ZEXA 1ADYA 4P83A 3GIDA 1N2HA 2M6SA 3S28A 3NHUA 1W36D 4B3MB 4M7OA 1I10A 1HQDA 1YAHA 2ORWA 2V45A 3GUCA 4ER6A 2BFNA 5ESXA 3E9ZA 1RZVA 3VZPA 4BEVA 1U2DC 4ZODA 3U7FB 4MPDA 1IN1A 4A8HA 2BLLA 5BW4A 4A15A 4M1WA 4UU0A 1KFCB 5HF8A 2A9PA 3CJTA 3KBOA 4HVTA 4KQ2A 2C1EA 2IDKA 1XXLA 2LBPA 3GL9A 4MR7B 4FFDA 4U2CA 4LE0A 5LUAA 5F1YA 5GAJA 5EOVA 4II7A 5EKUA 2WKPA 1OF1A 4QELA 4QU9A 1E4EB 4BB9A 1D6MA 1UXHA 2P11A 4PNZA 1PSDA 3EDMA 3EW7A 1B1CA 4XGKA 4IIYA 1FJGB 2J0UB 2QQGA 3HBAA 5EHIA 4B6SA 1T9HA 1HEUA 2EFGA 4ARBA 3IV9A 1E2QA 2WZCA 5C1BA 1SBQA 4GYJA 1E9BA 2HUPA 4TZ0A 1SUDA 3AKCA 1IZYA 3MGCA 3N05A 3RUDA 1JMKC 1Q95A 2FR0A 3W5BA 1BX3A 3AERB 4ZOCA 1U0OC 2B3TA 2IUUA 3R3UA 3SHOA 1S3FA 4BQOA 4JLVA 2ZYGA 3NHBA 3S2ZA 2DRIA 2PGDA 4GKKB 1TUEA 1NW6A 1T3TA 1IXKA 1E1MA 3P9IA 1ZD5A 4X65B 2EKPA 5GINE 1RCUA 2F64A 3VFDA 2PUHA 4JP1A 3AHEA 2AG1A 2IDZA 3T38A 2BJHA 1E1LA 1LZLA 2IZOA 5ALHA 1L5LA 4DT1A 2JRLA 3N2IA 4I66A 4CLXA 1C8VB 4EECA 1EVEA 1EH5A 1GL3A 4QBTA 4XOIA 2D59A 3RTCA 2XMGA 1GZSA 4BNWA 3R24A 2OFPA 4B7XA 3SYMA 2K7ZA 1KI7A 1IN4A 4QSMA 3SIPA 1DIOB 3T5PA 2WB2A 5BUSA 1ZI8A 1FMFA 4JL5A 1N5KA 4H17A 4X90A 5CM8B 2O5EA 5KU7A 3E15A 2QW0X 3PHIA 3SE7A 4GP7A 3RVNA 2G0TA 4V1CA 3EEIA 4M1ZA 2MYNA 4PGMA 1DCMA 2ZJ7A 4PZYA 4EUHA 2ASEA 3WHLA 2DQKA 2WA1A 3N7AA 5C46F 1R1DA 1AA6A 3SCZA 3AVVA 4NOJA 2ZWOA 3HDQA 3TTWA 1KEKA 2F9LA 3UANA 3CRMA 3EDCA 3F2VA 3KUCA 1ZMOA 3QUTA 4J0DA 4G8CA 2DFTA 2OV1A 4N6OA 2W2LA 4IIVA 4KUGA 4YWJA 2FPRA 3FKQA 4LVUA 3EXHC 2NO5A 5EE0A 1ISRA 3JWIA 4U8GA 4BP1A 5C3UA 3AKDA 1SQGA 1XA3A 1OHHA 2YDXA 3IAS6 2X8WA 3QEKA 2BGWA 2QJRA 2WSYB 3E2IA 3HNPA 3IUYA 1W47A 1GN8A 4M7WA 3W6NA 1PV4A 4YPFA 4NR0A 3O3MB 3RROA 1Y6RA 3VI3B 4IDEA 3I8OA 1CD5A 1GNPA 1EUQA 4XPIA 3VC3A 1X0VA 3VVMA 4B85A 4CQMD 3P0EA 5JZSA 3GP8A 3QEMA 4CI0B 3A1FA 4RH1A 1V9SA 4CG1A 1WOYA 2AV6A 2NNLD 2WIFA 3KEOA 4O4JB 1CXZA 3SGLA 4DV1B 1W49A 2OO5C 1T6YA 2FEMA 1OGJA 2JI7A 3ZHYA 2ATCA 2B8WA 3M81A 3OLXA 4PSKA 3THRA 4DXDA 5E6RA 2Q9BA 4RK0A 2JAUA 1RMTA 3ZXIA 5HKKD 2VLBA 2ZUSA 7MDHA 1MX3A 3H1TA 1JAZA 4YN3A 5G1PA 4RENA 3OETA 3PXBA 3IAFA 3AY0A 2A7XA 2NU8A 4EY4A 2VPQA 1QH8A 2F3PA 2J67A 4XZ3A 2QTBA 4W6ZA 3EASA 5AXDA 3UPTA 1WZNA 5ICGA 1QJCA 1CG6A 1QVRA 4HRVA 2B9EA 2WILA 3DBRA 3PHLA 4IZ6A 4KRYA 4WN9A 3V55A 3ZYZA 1DSSG 4F3CA 1E5XA 2XQJA 4PEVA 3ZZ0A 5C7OO 2VTKA 1Z2PX 4X1OA 2QZ4A 2JHFA 1SUSA 1R18A 3NOVA 2V6MA 4ZVTA 4N47A 4O1IA 3DE4X 1S6YA 3JQAA 1EUYA 1JEDA 3B36A 1AUXA 2OMEA 3LA8A 1XCMA 1JB1A 3BCRA 1TE2A 4TLEA 4D42A 3C1OA 3QUCA 4AQ7A 1OXSC 1V2HE 1TT7A 4K9OA 4RNDB 1TVEA 3IOEA 3UV3A 4MW4A 4G8DA 1OH5A 1KI3A 4YI5A 2HZBA 3I04A 3NIGB 1XAGA 1EVZA 4FMCF 3TJMA 3OC6A 3NGXA 2HNAA 1JR4A 2JB9A 1ZN9A 4ZP1A 3FYSA 3ZCTA 4DVGA 5HRAA 1Z5GA 1DRWA 3BIOA 2P8JA 4MLDA 1F2TA 2XNJA 2VHVA 3BTVA 3DE0X 3CUWA 2JASA 3KVYA 5LXTF 1UIRA 1RWOA 3DVLA 3KR9A 3WRVA 2QPAA 1E3DA 3CM0A 1LBSA 4NZZA 3TGLA 1LS6A 3Q72A 2YYZA 4XCVA 1XR3A 2BM1A 2AJTA 3ABOB 5BW6B 3LWBA 5CA0B 4A2QA 3O91A 4IDNA 1W581 3LL4A 3MWKA 3WP1B 4DSTA 4U2GA 1SZPA 2DWQA 2Q0HA 3IR5A 1YDHA 3SKYA 1FFXB 3LHDA 1ZC4A 1V4BA 1ENYA 4IHAA 4TUYB 4B75A 1J97A 2GYUA 2WAOA 2XZPA 3ZKAA 2CLFB 3D31A 4L8YA 1G3QA 1ICEA 4O5OA 2P27A 4F21A 3HB7A 1AMNA 1EG7A 4RY0A 2D7CA 1UC9A 3I45A 3KD2A 2PO7A 4EX6A 2KE5A 1DJLA 1A27A 2OG2A 1YD7A 2Z8ZA 3I2JA 3NX4A 4D8WA 3NDBB 16PKA 3FDZB 4TLAA 1LBEA 4YT4A 3KKEA 5AW5A 3REQA 4BZXA 5A7FA 5IHXA 5FOUA 4PZ9A 4KQMA 5EJ2A 3R77A 4IJMA 2QJWA 4GOLD 1DHRA 3R5HA 3JVEA 1G3RA 3CUSA 2PPVA 3Q6IA 3EC2A 5F51A 3WMEA 1MENA 3FSEA 2DG2A 2CDNA 2IUYA 2PUAA 3CEMA 1GYPA 3LAWA 4HZUA 3VR6D 2YR0A 1VCOA 4K2AA 5FBWB 1CEQA 1DHTA 1Q22A 2PSSA 1XPJA 2HRCA 4WFKA 2IXAA 1LWNA 5CGQB 3RIMA 3VOBA 4DQVA 3LC0A 3T1TA 1C7ZA 4PHHA 4GF5A 4HKTA 2OP1A 2BIFA 3TDMA 5EHXA 4KPGA 4Q7LA 2RHJA 4UTRA 2ZBRA 4MUFA 2NIPA 2PH7A 4EFKA 4R9NA 2PKXA 4YMSA 2XA1A 1DQYA 2QUJA 5EXEA 4S1VA 1FJ2A 1ZZGA 1Z0UA 2BUBA 1J8FA 1N9ZA 2I7CA 2PTHA 4LXHA 3VNRA 6ABPA 4ZQBA 3JQQA 1Z17A 3G2PA 1B6RA 2VXBA 3E81A 3SZLA 4CIWA 3GGPA 4CQLB 1Z5OA 2ZU0C 3UW3A 1XTTA 3JVIA 2A5YB 2IRWA 2PXXA 4QO8A 2HNKA 4BQRA 3WGIA 2AXNA 2WVJA 5GONB 4B47A 4LTMA 2J41A 3P4XA 3T3IA 2ZXEA 1BN7A 2QPTA 4LNUB 3D6HA 3GP3A 4DJEC 5H8WA 5J2TA 1L5OA 4MAFA 1E2NA 1QP7A 5KNBD 3P27A 5DTRA 2EHJA 5BYBA 1UEJA 1XCOA 1X3LA 2FK8A 3I64A 3K32A 4WZAB 2WG1A 4NH4A 3WG9A 4HWSA 3ZV6A 3VO1A 4NNPA 5AOBA 1T5IA 3U60B 3NCTA 1ZQ9A 3SBDA 4GDMA 4OFBA 3NAGA 4JI8B 2QL9A 2ZR8A 4J0KA 3JASA 1ZW1A 4LZZA 4JUCA 4HAUA 1V3QE 2FG6C 2Q4EA 2ZUDA 3IIEA 5EMKA 2H1OA 3ADBA 4JBIA 3EVZA 3WIDA 3RRMA 3L0IB 4KXLA 1EUDB 4RESA 2K87A 4KACA 2IOHA 5F98A 4B6JA 2O0JA 1GV0A 3QKSB 3SYTA 3KM0A 3UXEA 2ZW9A 2E18A 5ISMA 5BR7A 5CNIA 3X43A 2CN1A 4N0PA 1XXHE 3ICOA 4N9WA 4DQXA 1KXJA 2FUG6 4MR7A 3HTXA 1NXPA 1Z0ZA 4TM7A 4EVSA 4UEOA 4RACA 1TLFA 1VLVA 3L43A 3D6MA 4Z1MA 2CXSA 3FR7A 3GGOA 1YS9A 2X0RA 1ZA2A 2FOXA 3UT6A 3MRTA 2J0UA 4TWBA 4DA8A 1P0PA 1U94A 1P2VA 1Y5RA 1VJDA 3ZHOA 2QGZA 3TQOA 3WS7A 1V8OA 2VJCA 3TYXA 4BV8A 3AERA 3TBFA 3AB3A 4RANA 5GIPE 5JD5A 1YR2A 2XCUA 3PDJA 1PWYE 4YS6A 1GSHA 2BC9A 3DONA 4JWTA 2MSCB 4DLZA 3F97A 2FZLA 4YFVA 4YAUA 2J9GA 1ONOA 2ZUVA 4QTUB 3W5JA 3MLBA 4V0KA 3TM5A 1QFXA 1PK8A 2WV9A 3CNLA 1EEHA 4HLDA 2EX1A 1GUBA 1ZCFA 2ZTLA 3DVSX 3UUEA 4Y2TA 1NTRA 1DBSA 2QY6A 4GWKA 1A98A 1UMKA 3U4AA 1VBNA 3CCFA 2G77B 1VSVA 2WWWA 3FCOA 1ZUWA 5HQTA 3ZQUA 3UMSA 1CF4A 2A9OA 9LDBA 4QNNA 3SHTA 2G5PA 2BTQB 4IDPA 1FQOA 2Q4OA 3TUJC 1FDIA 1UBKS 3H8VA 3OY2A 1VJCA 2C2MA 4BGVA 3KZVA 2UDPA 1TO2E 4P38A 2EW1A 5G0TA 3TLAA 3EEQA 4DCOA 1IZZA 1PNQA 4KH1A 1LJUA 4NP6A 4Y2VA 1JSLA 4MUKA 2OG1A 3VPAA 4DMCA 4GYYA 2Y2VA 2D3WA 4I5DA 4M4SA 4JLBA 4KX3A 4UDYX 4Z4CA 4NI5A 1RQXA 2XVAA 3GX1A 4TRNA 4UXIA 1B00A 1JN0A 1I6MA 1ULHA 2DFLA 2WFMA 3KHSA 4BHTA 1ESZA 3NP9A 2C07A 4KN6A 4YP9A 6Q21A 4CV1A 1A7UA 4JJGA 3ZJYA 2X9QA 4YRMA 1SHLA 3EQ6A 5J43A 4TYPA 2W6MA 2X9NA 2Y1XA 2EQ5A 1QYXA 4EJSB 4PO3X 3OCXA 3EEYA 4QWMA 2IX3A 3HKDB 4ZQFA 2XODA 3E7FA 1AQLA 4QXAA 3KWMA 4JLUA 1P3Y1 4DDKA 5T7BA 5I51A 4HWKA 1ZRNA 3A4NA 2ZIWB 5J1TB 1KPHA 1N5IA 2Q5LA 4YNBA 4KO1S 1WHTB 1ZD2P 4OK3A 2V65A 3A0RB 1MG5A 3L6EA 3WB1A 2I0FA 5FPSA 1A3CA 1G21E 2AVNA 2J7PA 1BFKA 1SMKA 3SLRA 3WL7A 2ENWA 2QUZA 2BM0A 3P7MA 3OZBA 4O4JA 4BE4A 1D2HA 1X0XA 4H7PA 2XKKA 3OZRA 1X7DA 3LKVA 4G0OA 4P53A 3RG8A 3R3HA 3BRWA 5EZ6B 1F0YA 5T57A 4PE5B 4YPOA 1C3EA 3TQSA 3OWHA 1T2VA 3DG9A 2HCFA 4BN0A 2WICA 4YV7A 2C98A 3Q8WA 2ABWA 4N0MA 3UA3A 1XFDA 1ZSYA 2CNBA 4AVYA 1I0LA 3HE3A 1EWRA 1A9QA 1SUPA 3FBTA 3WWYA 3EARA 4AUKA 4OQFA 2RSLA 1IULA 4ZREA 2CHEA 3FSGD 3FDJA 4RFSB 3OCVA 4RXTA 2DPHA 4CPDA 1LI5A 4DV3B 2G6TA 1JXMA 3IPLA 5UKDA 1FFBA 4IIGA 3FVRA 4C08A 1KK1A 3BQMB 2O8CB 1Y6GA 1BHO1 2JGRA 2JATA 4KYIB 2W6QA 2EL7A 3O3CA 1T8SA 5ERXA 1SCIA 1U8AA 4E33A 1CQIB 2UZ3A 4HY3A 1MC8A 1ZXXA 4EW2A 3QZUA 5ECGC 1JHQA 1T2EA 4ZOLB 4CW7A 2Q6LA 4D8XA 5EZ5A 2AOWA 4S35A 2DFPA 3K0HA 1GZ4A 1Z5VA 2G07A 4HGZA 5ICEA 1SQSA 5EMNA 2QX7A 1JFLA 1Y9JA 2Q7OE 1XD8A 4C7VA 2J4CA 3RT9A 4D3XA 3G89A 2ONJA 3JRNA 4BQFA 1GCGA 4I9NA 3L82B 2IF2A 1RAGA 2FSVA 2KLBA 4TXLA 4BEBA 3UGKA 3WTBA 2WFZA 1SD1A 3DGEC 3DVAB 3G2OA 4L27A 4C30A 4BQPA 1Y9ZA 1C7EA 1LK5A 2P2GA 4CLDA 5AJWA 4RCZA 1F2UA 5FBLB 1QO0D 1IRIA 1RT9A 5AUPB 3O1JC 5TT1A 1DKPA 1Y8QB 2AK3A 1LQUA 2OUKA 3NLLA 5ALZA 1DKMA 5CA0A 4MS1B 2WWRA 3G7SA 2QZSA 2W37A 1G8FA 5IT4A 3KSRA 3LGXA 3DD5A 4ROTA 1Y1KE 1XU7A 4HN4B 3T4PA 4UVIA 1QAOA 1FFXA 4M46A 2PNFA 3BIXA 1OFGA 2HBQA 1N3IA 1YDGA 2QE7A 3ANLA 1MCZA 1G6HA 2UVPB 3IAAA 4TUYA 3RAJA 5BMOA 1SOWA 4LY0A 4B79A 3G6WA 4Q19A 3HJBA 5BQ5A 1M0EA 3OZXA 4QT0A 4IW3B 1VYTA 4MRSA 3WLJA 3FDZA 1QHGA 5H68A 5L40A 2R6JA 1WVGA 5HKLA 2AUNA 4BNXA 3QWFA 2C96A 1EBBA 3T7SA 5DHUA 4CLEA 4OMUA 3B7PA 3O84A 4LYEA 2CL7X 5J2UF 1F0NA 5KO2A 4IJQA 1UZNA 2IEAA 2PBFA 3K30A 4F5EA 4M1SA 4DCCA 2B2XA 5E7QA 3ZOKA 3VTKA 1YB4A 2ZCJA 2YWBA 3FNQA 1RZRD 1T4DA 1TC2A 1RC0A 2VYFA 2YJGA 2G7ZA 3D3KA 4A8JB 3EGCA 2H07A 2YY7A 4JI3B 1HV8A 3HVHA 1MEJA 1VL5A 3MMXA 2XBUA 3NEAA 3PFIA 4ZT4A 1PR4A 4CMEC 4IL5A 3AU9A 4RHFA 4YACA 1E3WB 1N3YA 2RGWA 3D2AA 3QLTA 3DOFA 3ICVA 5JZVA 4ZHQA 1I2MA 3BERA 4NHOA 4X92A 1GU1A 2WSLA 1U0SY 4CQLA 3NS7A 3KETA 1XZDA 5BURA 1ADCA 5GONA 4PG6A 2GAJA 2YFQA 1S2DA 3FFBA 1MIOB 3GAZA 4ARSA 3OOYA 4ARAA 1XMVA 4D9KA 3KKMA 3VX4A 4CIAA 3W5AA 4JCCA 1RW4A 4LNUA 1VPTA 1NSYA 1WDWB 2BOVA 3COPA 2WYHA 1YMUA 3D9QX 3I1FA 3E9NA 3ESXA 3NJ4A 4PPQA 4YRBA 1RPJA 1MD9A 4C0KA 4OI4A 1U4NA 1YU6A 3DHWC 3G79A 2JEOA 3FYUB 3KLOA 3PWTA 1A4IA 4WZAA 2R8BA 3TZBA 1EFKA 3W6OA 3U5ZB 1U1DA 1X7XB 3UB3A 3KVNA 2APJA 1G5IA 2J5KA 2QTZA 3P97A 2CWWA 5B30A 4HRAA 5IAAA 3FW1A 4Q3OA 4ISCA 4XASA 4US2R 1DWOA 5A5FA 1E9CA 3INNA 3W5HA 5FV7A 3ZNOA 1O6FA 3MHPA 1ZVMA 1IG3A 3ICWA 1VXRA 4R31A 1ODFA 2D0PB 1HKHA 4MB0A 1YR6A 2B78A 4DRZA 4FS8A 1TXGA 1B8PA 1EUDA 2EBHX 2F3RA 3LYUA 3H9BA 2P9QA 3QBEA 4PLGA 3A2LA 4UNSA 5DJ5A 5T4EA 1YULA 4KH0A 3QKSA 3AR3A 1RLOA 3A2NA 2QAJA 4GI2A 3PFWO 4CF5A 4RPJA 4FZJA 3FFTA 4XUGB 1KRWA 5IANA 5I7EA 4NBVA 2RGRA 3OMLA 5LYJF 4PBTA 1CJVC 2FOLA 4HLUC 4HQ0A 3UGTA 1CUBA 4JX9A 3WWEA 2I2CA 3ZY5A 1UKBA 2IYAA 3K94A 3OZUA 4X6LA 1DXOA 1UWVA 3TNLA 1L5VA 2I3ZA 4DC1A 2J8ZA 4JR2A 3IE0A 4UEQA 4R9UC 1UDAA 1ZC3A 1ULBA 3DUWA 1BGXT 1E58A 2PMEA 2CHFA 2P4SA 2X4DA 3GZJA 2I6QA 3GD7A 3WLMA 1NTOA 3FKSA 3U26A 1K7EB 2WDZA 2R3SA 2VO1A 3KZXA 1MEOA 3IQXA 2AKEA 4WKOA 3CPJB 3M5DA 1F4VA 4EHKA 1SU8A 4K9NA 5BRJA 5AVRA 3WKAA 3AH8A 3P0JA 2QK4A 3CX4A 2W0SA 1E6UA 2V59A 1E4OA 3F6YA 4W9MC 2ZS9A 3DE5X 2R11A 2I6TA 3IFSA 5CURA 5EAIA 1RYFA 3ROGA 1P33A 1MV8A 1Q17A 2WM3A 1IVNA 1TJ3A 3T4EA 4ZJZA 1Z4MA 4M37A 4EF5A 3CB2A 3WNQA 2RAVA 2QJFA 5EG5A 1CB7A 5A4JA 1B74A 1ZRMA 2BTQA 2HHCA 4XYMA 2Q5QA 3MM4A 3HI4A 3ZCSA 1ZH2A 2D5BA 5FJIA 5K6AA 2W6ID 4P81A 3HWSA 3SKXA 2JZOA 3RS3A 2P9BA 1BMQA 1VMIA 4CMGA 2KSQA 3UC9A 2PXAA 4XEUA 5THQA 3ZDAA 5C8VA 3DE2X 3GH3A 3ZE2B 2EATA 1I2CA 1EZ1A 4XB1A 4XQGA 4D0LB 4DZZA 3VYVA 3FOCA 4WMLA 4LZJA 4C29A 1YJBA 4EG7A 1LK0A 1R6VA 1L5QA 1U2TA 2CJWB 2QP9X 3JWHA 1HTBA 2P77A 4U2BA 3FNFA 3GFTA 1MX9A 1RYEA 2JIMA 2YHBA 4Q82A 4DWVA 1DPGA 4YT2A 1XPRA 1NQWA 3DAHA 5TEVA 3ZD6A 2I1LA 4I1RA 4EJSA 2WQZA 4I9GA 5BSRA 4RZ2A 3PX3A 3LYAA 5FB3A 4V3CA 3F5QA 1WRBA 3HKDA 2EWWA 1VMAA 1X8XA 3VUFA 4OGLA 1FUIA 2QIOA 2YFKA 3OTWA 5CIWA 1C1HA 3WSVA 4ZHSA 1OJ7A 1OA1A 1SBYA 1WHTA 1XC7A 4MKFA 1G3IA 2WJYA 1Z6QA 2OZKA 4LK3A 2P1DA 4E11A 4UOQA 1OZFA 1NW5A 3WYNA 4ER0A 4AW9A 3IAXA 4HDSB 4TS1A 3AFIA 2TMDA 3MMNA 5AUNB 2G4VA 2HJVA 1WPRA 4MI3A 1E9AA 4IS3A 1EXDA 1S9DA 1YWGO 1M5UA 3ILYA 3R0QA 1HG0A 4OJQA 5TARA 1MAWA 1RD4A 4CV0A 1N34B 3QYJA 1IZ8A 3RFFA 2Z2XA 2YXPX 1C3JA 1KYTA 2YV4A 4WBSA 2PZGA 4G5OA 4YJDA 5CNJA 3SX0A 3I3OA 5B3LA 1ESEA 2VDMB 1C4WA 4BNNA 1WSWA 3WRXA 3UOWA 4E4YA 4JNKA 4RFSA 3ZHQA 4CL2A 1YRWA 4P7GA 1LPBB 3H5RA 2PYDA 1U7UA 4HAVA 3AVTA 5IG2A 1P5JA 2PLRA 1JLLB 2GNPA 1T0UA 5JD6A 2O8CA 3L7YA 5C7YA 4BFWA 1CJBA 5ICMA 2GN9A 2B2CA 1RYBA 1CQIA 4M6WB 1C81A 2I7XA 2QL5A 2WPDA 2ZUBA 3H2IA 4HRXA 4NDAA 2ZM5A 3KOMA 4K8RB 4CODB 2X6RA 3FNEA 4HQLA 1M2NA 3AR5A 1JHZA 1XDWA 4ZOLA 3ZY2A 4MVJG 3VR0A 4LSGA 4YR9A 2B0CA 3RVRA 4F3YA 4CR8A 1IEWA 2IOFK 2DSTA 3NYQA 5K0ZA 3EPPA 3HA2A 4A9AA 3QTLA 3GRZA 4DNFA 4PG4A 1T13A 4BCCA 4Q1AA 3NM6B 2XPCA 1XXHB 1Z5PA 1UP6A 1A9ZA 1F0KA 3M49A 4BIMA 5HZGA 2BKEA 5GADl 4HC4A 1YR3A 3FM9A 5KOJB 5F9HA 3DVAA 2G40A 1CZRA 4LFBB 1EFHA 2VC2B 3PGA1 5C2JB 4LGCA 5G1NA 1EVYA 4LJRA 1Y8QA 2C9BA 4O8CA 3V8QA 2XSZA 3UKDA 4MS1A 1Z7WA 1PT8A 3LBFA 1KOGA 4II2A 4EARA 2P68A 3A7DA 1C30B 4GQIA 5JAQA 3KQKA 2Z2IA 3GBVA 1JAYA 1HDRA 2UVPA 4K05A 3MGKA 2P6OA 3D4LA 4IDBA 1T25A 3E84A 2IV2X 4PSCA 4JC5A 3MJHA 3WWZA 1A2QA 2VTEA 4TYQA 4UC0A 2JNWA 5CVEA 2WOOA 4GMHA 5C5CA 2J30A 2UYCA 3RVSA 1T8TA 5MN6A 4JLNA 4EEZA 1UKYA 1QF6A 1Z16A 2CF5A 2I2FA 4BO6A 4DDTA 1ZP6A 2RJ3A 3UH0A 3LJKA 2P8SA 4JSYA 1OV4A 4CL3A 5CVCA 1BHQ1 5B1EA 1KDPA 2AJCA 2G1JA 4TRMA 4OLJA 3TM4A 2XITA 1EJ6A 2DKNA 1E6CA 4CM4B 4QQ8A 4TTPA 1QNLA 1TMYA 3DZBA 1ODCA 3LM8A 4W6QA 2INGX 4MP3A 3KT3A 3KVVA 4K6GA 5CT8A 5EN4A 4AJKA 3K31A 4Z9AA 2M6KA 2CXTA 5BMVB 4E2YA 3PR2B 4Z8YA 3W1WA 4E6PA 2EWVA 3RFUA 1QQBA 1U0EA 4JJIA 4P4LA 3KE8A 4R1TA 4J0HA 2WKWA 1YBVA 4ZXFA 2W6ZA 3V3TA 4CKCB 5JXHA 3B48A 4B3TB 2ZAYA 4WBNF 4MEJA 3FUUA 4BX0A 4BYGA 5CUQA 3GJSA 4F5DA 2AR7A 3MN1A 1XNRB 3FPBA 4GPD1 1E3WA 3UMCA 2BDUA 3ORFA 3B9RA 1E5VA 4KNWA 4KQWA 4BRUA 1GTRA 2BHTA 3P2IA 4JELA 2WJHA 1M1XB 2OD2A 2OAQ1 3MWGA 3VR3D 1QQTA 2GCNA 3I6QA 4HDRB 3FLAA 5JQWA 1GNLA 2NG1A 2GA9A 3EDQA 2PMKA 4Q3DA 3VR2D 3DAYA 1UJNA 2R5WA 4MOWA 2HQSA 3KDPA 1JSCA 3P4YA 4Q3NA 1MIOA 4UVEA 2OCKA 4Y1GA 4IOJA 4MIKA 3L8DA 4U2KA 3VPCA 1D7AA 4RDXA 1IUKA 3N0RA 4YONB 4RUKA 3OIWA 4QOJA 4IIUA 3KKPA 5B2ZA 5HF5A 1GA4A 4UUAA 4UCFA 2C4KA 3VKVA 3BSSA 2RB4A 1HKUA 3HDGA 5DHPA 2AW5A 3M6LA 4MVJA 3FYUA 5C4GB 5HZKA 1B8NA 4WXRA 2A0YA 2VDUE 4WN3A 1X7XA 2GJ9A 3E9YA 3FN4A 4EW6A 2H9AA 1TLTA 2OM2A 1U28A 3DE1X 1LX7A 3DTVB 3EGOA 3SLKA 2VDWB 3L8HA 3LYLA 5AW0A 1D03A 4QDUA 4MGIR 3U3DA 1XQXA 1B6GA 2FR8C 1MJGM 2HDHA 2XGJA 4GZ3A 3M7IA 1IXSB 1P7ZA 2PGXA 4B3GA 1T4GA 4EVRA 2G9VA 4UQOA 3D2LA 2YOGA 5DM1A 5BWOA 4QXMA 5CG2A 2R4QA 4Q18A 1ELOA 3HN2A 3NOOA 3QX8A 2QTHA 2VP0A 2X76A 1ABFA 3NBUA 3VH1A 2WU0A 4DHEA 3BXXA 3FRIA 1JNXX 3DNPA 3QE4A 4ZVPA 4AK9A 3H3FA 1G291 2KMLA 3IIKA 5AKJA 1DBVO 4Y2RA 1FP1D 3E3OA 2GBLC 5LZ2A 4KAAA 1W5TA 2OD7A 1L7AA 4WBNB 5DNVA 3TZKA 3N8NA 2O14A 1AA9A 1CUAA 4N41A 1JTFA 2QG4A 1W6UA 2O1WA 3PNVA 4YRIA 4OFWA 4NMHA 5I7VA 4KGVA 1RQGA 3H5WA 10MHA 2PIDA 3B3GA 5AW8A 6PFKA 1TDJA 4CM5A 3T5MA 3CU5A 1IM8A 4W82A 5IMBA 5TXGA 1YCFA 3VVBA 3DF9A 4YLEA 4XTCS 1XZNA 3CSSA 4IOMA 3BM5A 3RSGA 1E1KA 1GNVA 2QVCA 4A0GA 4F92B 4FI3F 1VMEA 1XRNA 4ZA2A 4IJ5A 4M38A 4TV8F 1VP9A 2GEJA 1H8EA 2AEFA 2QT1A 1A97A 3OA0A 2X40A 4FGKA 3QNMA 1W0JD 2CFRA 1R5BA 3E5MA 3WV5A 3IQZA 4EJ0A 1BVHA 5KSOA 1ZR2A 2RHCA 4PLCA 3EIOA 4RD4A 3FUVA 1WS6A 3BEDA 5F2EA 1L6RA 3T3HA 5ERGB 4IMRA 1LVGA 5HMMA 1N6OA 3VYWA 4MQ4A 1O8BA 4BLWA 4CN9A 4Q9LA 1VPEA 1EWKA 2JLWA 1IJKA 1ORTA 3LUBA 1ISJA 3CHYA 3SP1A 3ZJ5A 1XV5A 3GF4A 4DWJA 3FI0A 3L7OA 1PCXA 2VT6A 3LH5A 2BEUB 2CFSA 1XFAA 2Q5EA 1JKXA 2Y92A 1VL1A 4PFSA 3P9XA 4BCDA 2JGNA 4H7KA 4JMPA 4QU8A 3O4VA 3OX4A 1DP4A 1YXMA 2IE8A 3CO5A 2CJWA 3LHKA 4X1KB 3B8EA 1AXGA 1JDUA 1A1SA 1CS4C 1SC6A 1ZY2A 1SM4A 2FCAA 2WWGA 4GX2A 1W6RA 3NEPX 3WDLA 1CLUA 4HBGA 1QVWA 1G5HA 2CXXA 3HU3A 4ZQEA 3WRYC 4LF5B 1CRWG 1L4NA 4EP1A 1IHDA 3GY0A 5MFZA 1XPOA 2JJ2D 3IQIX 1Y37A 4B3DA 1AZWA 2ZQYA 1YBAA 1AGYA 3ANSA 4NV1A 5THXA 4J0JA 3ZGVA 2OPHA 1EK2A 3R3XA 4NE9A 1PK9A 4O3MA 1L4LA 3ESQA 3ZWVA 3AKYA 4MUXA 2IXTA 1FFGA 3IMCA 3OEHD 1SZDA 2BCJQ 2W2KB 4JVMA 5FFNA 2ECOA 2VZ0A 4ZHQB 4YP5A 1UBMS 1XYVA 1DLJA 2RJOA 2ZRNA 3VJKA 2PSEA 4HDSA 3G5AA 1WZIA 4XGQA 1G38A 4G09A 2VCYA 5KREA 3AGPA 1P5HA 5ALRA 2B61A 4QBIA 4DA0A 3F3SA 1GQRA 4AO8A 1RRVA 2CBXA 2WMOB 2O2IA 1P3JA 3Q0TA 2BFOA 1V35A 2BMEA 2XW6A 4G1MB 4PM4A 1NRIA 3C8DA 4NATA 3E03A 1UBEA 1HE5A 1QRTA 3K9WA 3LT0A 2DPGA 4EAQA 1BG6A 1XRJA 3OZSA 4ZCRA 1G4UR 4Q48A 3TXYA 1LXCA 3RVBA 1SOMA 1N2OA 3O95A 2QG9A 2QRVB 2NADA 4FTWA 4MPTA 5SZIA 3IBTA 4TL6A 3R5XA 5BW8A 5KSZA 1ZLXA 4X41A 1RJGA 3EEBA 1JLLA 4M0FA 5FI3A 3OG9A 4NK5A 3JQ9A 4BP8A 3GFBA 5L3SB 3IQFA 4MJ3A 1ZD1A 2RGYA 2ZANA 5DBFA 1EB9A 2YNMD 4RTLA 1QTQA 2CBGA 3ENZA 3Q0EA 4KFTA 4M6WA 1HF3A 3LXMA 4DOMA 2A5FA 3WGVA 3SU8A 1Y7IA 1HSOA 4AIRA 1JKJB 1WNTA 3D4IA 1QIIA 5ARCA 3UPDA 1Y80A 1H4TA 1GKLA 2CVOA 2GZMA 3FBGA 3I6IA 2GHIA 4JP3A 2XB6A 3HXLA 1I80A 4TV9F 2Q99A 4EHFA 4EUFA 1SNYA 2GPJA 1RAEA 2VSYA 4RF2A 4C3ZA 3I2YX 1VE5A 4I8IA 4K6CA 1GL9B 4RWEA 4X7MA 4EGFA 1B16A 1HUQA 1PVDA 1XXHA 2FWIA 2J3MA 4H16A 4HH1A 5SV2A 4FFBB 3JPWA 3VO8A 1NUQA 3RRXA 1Q0HA 5KOJA 1PJTA 2NV6A 1SN7A 4AP5A 1ZVJA 3IUJA 4ZJUA 2PG3A 3UICA 3TIVA 3ZWMA 1P0CA 5JCJA 1QBKC 4DG5A 2NU6B 5B36A 3FWNA 2HA7A 3N76A 4TS4A 1KMIY 4BRSA 2E5WA 1JKMA 5BXYA 4FOSA 4LOHA 2LDXA 5AI5A 5A7HA 3USCS 3E7DA 3ASVA 1ND6A 1C30A 1TM5E 4IIBA 4RKYA 4E3ZA 4EPXA 5JJ5A 2FDXA 3WGKA 3BE4A 4AJIA 1SVNA 3OLYA 2XTZA 1XYGA 2XVXA 3IOCA 1R5OA 1YL7A 3LDUA 4JB0A 1OT3A 5F7OA 2V1XA 3UAZA 1LY1A 3IMEA 2N3ZA 1R6AA 1YIOA 3HO6A 5AYVA 4LHEA 1V47A 4O0LA 1PKEA 2ZJ2A 1RJDA 2BE9A 2G28A 1COWD 1RXIA 3OCCA 4N5HX 5JNWA 4NBNA 4X63A 4KDFA 1FTNA 5E3HA 4AU1A 2DC1A 4YB8A 5ADUS 3FTFA 4RD0A 4ANFA 4JHLA 4YV2A 3ABQB 4X0EA 3T9AA 3H5TA 3UAYA 2XYVA 4URUR 4HF7A 3L93A 4A0HA 1YB7A 1PS9A 1T1SA 4LXQA 1UXOA 4ZYUA 4BX2A 1ULUA 2PX8A 3LSYA 3QP9A 2GCGA 5KPDA 4D3ZA 5JYDA 1FP6A 4CM4A 4DV6B 2VYVD 2O2EA 2JFGA 3QE2A 3R9IA 4DMLA 4ENWA 1URPA 2O2HA 5JY1A 2QN2A 4JR1A 1Z4NA 1Z4IA 1E2EA 5G0VA 3TK1A 4ZXPA 3QA9A 2ZVJA 4YUXA 2P9JA 4Y67A 3RC2A 1KEPA 1MVOA 3VR6H 3KFLA 2JGMA 4HATA 4WRRA 2RIPA 1Y7LA 2PFKA 2R65A 3GEBA 5DULA 4CKCA 4U1RA 5JSHA 2X41A 3CLSC 3B6IA 2CLLB 4OI1A 1E6WA 3GHYA 2P4UA 2HDWA 1QWSA 1T5TA 5DNCA 3OT1B 3LBHA 1YRHA 3B3AA 4IDFA 4RKEA 2VUHB 3K0BA 3MIIA 3RHTA 4UZSA 3DTTA 1M8FA 3OFNA 3RRFA 4X62B 1G2QA 4WOCA 4KSYA 4MVYA 5GQSA 3ROTA 2PLNA 4HDRA 5L3QA 1C2YA 3EXG2 1YB6A 5MN5A 3ND6A 4M0DA 4IOKA 2VK8A 4GQAA 1P77A 1J09A 5JFTA 1NNLA 3QFSA 1D2RA 3E23A 2IU6A 4C43A 3ZHTA 2L0XA 5EJ7A 3DCJA 5DBOA 1PLJA 2Y4OA 3WTCA 4F8EA 3WLQA 3HBMA 1KFEB 5IFKA 4OM8A 1JU3A 3O4IA 2XR1A 2NVUB 5HOQA 3OCZA 1XDDA 1M83A 3OX1A 3BF8A 3KZNA 4BVLA 2H18A 3DTVA 3MBOA 1AQYA 4KDCA 2CNNA 1EFDN 2VDWA 1VSTA 2DCUA 1Y5LA 2ZYWX 3DVRX 2X0EA 2HGSA 5KNBH 3JR7A 2W0MA 1DOAA 4D79A 2JLVA 4G0PA 3ECCA 3IDQA 1LPSA 1P17A 5A3RA 1IDN1 4JBWA 5DASA 1Q16A 2WP0A 3EXHB 3L79A 2X8JB 5IJAA 1XT6A 1TZMA 4YO8A 3T4XA 4CI9A 4D97A 2B1QA 2ZSEA 5J23A 1YVUA 3B2NA 1J2EA 2QMHA 4G0QA 4LJ4A 4RVFA 3OFVA 3TZQA 4BWYA 4V24A 4NXNB 2FWAA 4PPFA 3BXGA 2F1KA 3DP9A 1XVLA 1HLGA 2DPLA 2PMDA 2XUIA 2ZS8A 4KBYA 4K9KA 2VK4A 4FK8A 3AHIA 3B82A 2FMFA 1RHQA 1KDOA 2FSFA 1TCVA 2J59A 2PHZA 2PZBA 3R3SA 4WK0B 5DGIA 5DK6A 5JE8A 4DDWA 2Q0QA 4NMLA 3PENA 3FHTA 1EA7A 4YLGA 4LFCB 4GMDA 2BR3A 2D4AA 2PRYA 3CLHA 1EBFA 4WBNA 4OH1A 1GU0A 3G59A 3K0SA 2ZQ5A 1OFTA 2VVTA 3W2FA 1H4VB 1YMVA 2CWDA 4D4HA 2OVFA 2C0PA 4AKGA 4JBYA 4KIJA 3NBMA 4DLVA 3ZE9A 1LBHA 1I33A 1W4ZA 4H35A 4KWTA 5AESA 5H16A 4AYWA 4KNYA 5IXJA 1K63A 2GN1A 3BB3A 5IYZF 3VC1A 4EHJA 4ZICA 2XZLA 5TMEA 1XTJA 1QQ5A 2HV8A 1M7GA 1WF3A 2ZVDA 1RPNA 4M21A 1R4AA 1IY0A 3ZGNA 2C61A 4Q4AB 1CUIA 4EY8A 1MU0A 2CLIB 2OM6A 4E88A 1PTKA 1DC6A 4I14A 4MA0A 3U7QB 2ZYRA 1ACLA 3PQ7A 3R7BA 1X8LA 1UT8A 4QEZA 1NU6A 3GWZA 1KYQA 5BOVA 1UBSB 4EVIA 1MH9A 1YCDA 2VRCA 5MGBA 2EP8A 2PJRA 4PIMA 2NSYA 4D5GA 1UR5A 3ESYA 4B84A 1FSSA 2ANCA 2PMBA 2WVAA 4IUCS 4CBVA 4IIJB 2G6BA 1CYEA 5G0UA 5CK4A 3EIEA 1W73A 4M1EA 4KC0A 2BM9A 1U3UA 2F8TA 2BEUA 2VRBA 2E7ZA 4IGFA 2BFWA 3Q0IA 3LCVB 1RJEA 4G25A 4MIOA 2GTIA 2V0CA 3ABIA 3K6KA 1QS0B 2B30A 4WWHA 2N9UA 1USGA 1Z2AA 3GLHB 3ETLA 1HOXA 2W98A 4L0MA 4RF3A 4J7UA 5FPYA 3H3JA 3M0EA 3W8DA 3EZ6A 3GNQA 1IPEA 3AONB 4X1KA 4QDOA 2HU8A 2X2EA 4N48A 3SZOA 2JGIA 4U3JB 4ENSA 1NUTA 1NMYA 3OP4A 4M49A 3ZV3A 1CNFA 3UV7A 1HK7A 3GGJA 2HT1A 1FJHA 3LFUA 1KYXA 1GG8A 1W1WA 3IT2A 1DTSA 2D74A 2PBZA 4MV9A 1NQAO 2WFAA 1MX5A 3CKMA 3X2SA 1Q6ZA 1YTLA 1SVWA 2C4NA 5DNDA 2FCRA 3GLKA 4ZEOA 1Z68A 4ERXA 5L7WA 1XNGA 2F1IA 4WHMA 5EE5B 3HXMA 4LC1A 4UAUA 2W2KA 2CHQA 2GF2A 1HL3A 1WR8A 1XRSB 1XL0A 4GQBA 4UUQA 4XUDA 1LI4A 3MMSA 3EPLA 1NULA 1SHZA 4NSNA 5KYVA 4DQ0A 5B1SA 3B5JA 2Y0CA 2AXPA 1O9HA 5JTUA 2VSOA 4QRHA 1CZNA 3DH0A 2XWBF 4RCYA 2C5FA 1NOIA 4E14A 3IQHX 2XGOA 4K9MA 1YZVA 5DPMA 5JBNA 3KB1A 2VNHA 3HHEA 4IGEA 4R1OA 1YRAA 2VHJA 1BXRB 2FPWA 2FSSA 1I01A 2GD1O 1TM3E 2X4LA 3C1UA 3HJGA 3O8LA 4TTTS 1XE3A 1WCYA 2HQOA 1UINA 2R2AA 4DUYB 4C9BA 2QRVA 4BDSA 1QP8A 3C5WP 4I1IA 3OLCX 5EWMB 2YWFA 3TZCA 3RKSA 3VH4A 5FOXA 3WWCA 3UC5A 5L3SA 4WGGA 2Q8NA 3RBXA 3WYGA 2GZ3A 2FN3A 4WZBB 2R6HA 3HU2A 4RFLA 2CGEA 2FSIA 2J9RA 1JKJA 1TI7A 2E4AA 2QXUA 3K2EA 4XSHA 5ALMA 5FWYB 4MMXB 1QZUA 3HMKA 3S2UA 1E2JA 4S05A 1PT7A 5FHRA 4FSXA 5K05A 2Z4TA 2O2YA 2UV8A 1D1QA 1RYZA 3OOHA 5GGXA 5CBKA 2C29D 3JQBC 4CCYB 1SXJD 5CB4B 5ILOA 4O02B 1JIKA 1KJWA 1ZHFA 2QRJA 2WF8A 4KWCA 4Q1FA 5CR9A 2HYDA 5ALFA 1OJLA 1EAYA 5E0OA 2ALJA 3FMGA 2HCBA 4JI1B 3MB5A 1ISMA 3I6YA 2PXHA 4FFBA 3TTXA 5JPCA 4BTEA 2ZFUA 1JEOA 4H31A 3TVYA 4WUTA 3AF2A 4FC7A 2I55A 3CUYA 3IUMA 2VAWA 5FYQA 4PG8A 4GW3A 1WB9A 1UT5A 4V1CI 1VCHA 1AK2A 1BDBA 1HFEL 3ZZNA 2NU6A 4Y3UA 1VBMA 4P0PB 3T5BA 5ICCA 3B13B 9ABPA 3EG9B 721PA 4KWHA 3HBNA 1LDGA 3ZJ4A 4C0QC 1RLIA 3D7RA 4F56A 3AHHA 2PQMA 4CG3A 4IGAA 3W06A 2BBSA 2IYXA 4QWWA 1MV5A 3DBIA 3E3MA 3OE1A 4QREA 2GZRA 3IC5A 1E7RA 3K15A 3DMTC 3HI6A 3PEEA 121PA 2O1EA 1Z4KA 1MMFB 4BFLA 1MOSA 3LPAA 4KB5A 4NL4H 4Z0PA 2UUAB 3FGNA 1U2DA 3BZBA 3PUJA 1IG0A 3RVLA 2CNLA 2W2MA 5FFMA 1BGWA 2ZWPA 3U7GA 2HHLA 2O3TA 1NVKA 2BN4A 4OJTA 4PG7A 1ZOIA 1L5KA 3TMYA 4E5MA 4L73A 2Q9UA 2AI1A 5FXMA 3AP2A 2LV8A 4B6GA 3SXUB 1JA1A 1JXAA 1JS1X 3BDVA 5JHHB 1TIKA 2A9KA 1GKKA 1Z5ZA 2WUWE 2PL3A 4R2JA 1GKIA 1WG8A 4B34A 1LFDB 2GR9A 5L7TA 5LVAA 4PZZA 4DLTA 2IBMA 4RL4A 3NUGA 3TIXB 6GPBA 3B1KA 4H27A 3VM6A 2ACVA 3U3KA 2G1AA 4J91A 5BN3B 2QS9A 4JT9A 4QOFA 2HCRA 4OATA 2HTEA 4X71A 3UCFA 2NSDA 4CM7A 4RTQA 2XMZA 5BQOA 3T7KA 3A36A 4OQXA 4RJIA 2I4IA 8MHTA 1JDSA 3TOSA 1II8B 2QT0A 3OT1A 4FP9A 4R8KA 1ZD8A 2FW6A 5BQXA 1E9EA 1Z83A 1JZSA 2G71A 1NMXA 3I9OA 4K6HA 4DADA 3ZCPA 5TPZD 3QBVA 2VOEA 1L5YA 1R6XA 2GPWA 3K5WA 3LBNA 1A9SA 2RG1A 3BSYA 4LJLA 3T1OA 4CIBA 5JISA 2B0JA 5JI3E 2I1VB 3HRIA 1CUHA 4A5SA 1OE0A 2F1OA 2QHXA 5J5CA 5A5DA 2HTFA 3L7MA 2A1TR 3UFBA 3WSWA 3I01M 3NUQA 4Z4HA 1GFWA 1Q0SA 1HQYE 5H1YA 4ECAA 4FINA 1QVZA 3HO1A 1GGFA 3UMMA 2NVUA 3WNVA 2G5TA 4M0KA 3TG2A 4MR9B 1MAHA 4KHZA 4MV5A 2CDCA 1PGQA 1E2GA 1M2VB 3H18A 5DI9A 1MDFA 2ZU6A 4XWTA 1QE5A 2EKBA 1V48A 3USES 1J42A 2HJSA 3QBDA 4AY5A 2NO9A 2QVXX 4B2YA 3RJ9A 5ESWA 3FFWA 2GHRA 4YMWA 4BVEA 2NQTA 1UJMA 3EXHA 2X8JA 2YWRA 1FBTA 2AN4A 3WLOA 1AVTA 1ZM4A 4MWDA 3L1UA 5HIIA 3Q9LA 2QBYB 4EHBA 1OFIA 4EY5A 3EC7A 4RQTA 2P5TB 3C45A 5KJ6A 1MC1A 2OCYC 1LSSA 3ZXSA 1GCOA 3ABSB 3K6SB 3TWOA 4F1KA 3CEHA 4DAOA 1DIHA 1ZQ1A 4L95C 2C5EA 4FNMA 2Q2VA 3D1VA 5HJEA 1PTJC 3EYWA 5JPIA 5T4HA 4NEQA 4DNQA 5CVVA 1FTQA 2H17A 3HV2A 3QMMA 2PBRA 1VFNA 1VI5A 4LV8B 5I3ZA 1RCFA 1G59A 1F8XA 2ZWVA 3IV6A 2OSBA 1NPDA 1UL1X 2HL6A 2II6A 3V1LA 5B57C 1RU3A 4XDHA 5CFLA 1NASA 4E4RA 2GD0A 4YO7A 3TLXA 7AT1A 1EUCB 1OW3B 2G4LA 1DAHA 4XJVA 5AKKA 3TX2A 3UAGA 2GBPA 4V2UA 1YQTA 2CJYA 2D5LA 3FVWA 3KAPA 3MJTA 4MINA 4EG4A 1UXGA 3KK0A 2RB5A 1PGOA 3OE4A 4MCHA 5IFLA 3ER8A 1CUGA 1NV8A 1PJAA 1UQRA 3OPYB 2A5JA 3TMAA 5EP3A 1ZGGA 3WNDA 4BE9A 1XRLA 3GUYA 3PTZA 4OM7A 4EGSA 5LQKA 1ZM2A 1N2GA 1K97A 3PS9A 4DLWA 3QUSA 5SYNA 3GCDA 5YASA 5EFOA 1HETA 4Q4AA 5K8VA 1KAHA 2NXCA 3GEPA 4LMPA 1T0JB 4RK5A 1LV7A 4N7RA 3U7QA 4QZVA 1CEEA 1EFRA 4AECA 1Y9AA 3AF0A 1THZA 2TMKA 1Q21A 3IT0A 2A7QA 3OLQA 1PUXA 4KFSA 3TZEA 3VTZA 4HNRA 4D26A 2IC5A 2VHWA 3PJRA 1LX6A 3WL4A 1HLPA 1Q0LA 3PLNA 4RHXA 4EKNB 4XW2A 1I3CA 4G4JA 2GKSA 4JJEA 3IBGA 1C9NA 2WUDA 4IIJA 5DTEA 1ZK1A 1YOVB 5BN1A 2HIGA 2GDZA 3GRPA 2XJ9A 1J0BA 1OWNA 4RGYA 4Z1MD 3DHVA 4AXBA 5LLTA 5LQCA 4C76A 1TO6A 1QS0A 3Q2KA 4OQMA 1WMBA 1FVFA 3GLHA 1XJQA 2R7KA 2EV9A 2AD1A 2ZR9A 1ZHOA 5C4MA 3QW2A 3L7JA 2RK6A 2FQQA 2Q3FA 1ODIA 2HFKA 3FFXA 2FZKA 4U3JA 4XVRA 5TPWA 1JFSA 3ZDDA 2Y4NA 4EUSA 1GQOA 4A0SA 5FBZA 3B12A 2QX9A 2E21A 4PCVA 3VC7A 2ZRPA 2OHIA 3QX7A 5K8LA 4GZLA 3OU6A 4QUGA 4UVGA 4RO0A 5A9SB 1YF3A 2AL7A 4Q3KA 4RJLA 4F1WA 1Y1LA 1Z18A 2WBLC 1N92A 3UXMA 5JR3A 2VSFA 3OJLA 3UJ7A 1UZUA 3L0BA 3HGMA 1TIBA 1JHAA 3OFJA 5KNDD 3K8OE 2QTLA 4QRIA 1ZKDA 4IRUB 2CMFA 4L5BA 4ZKDA 1AC5A 1COZA 1YZLA 3ENNA 4G4SP 2JKYA 4R6XA 4XA8A 3RE1A 5JS2A 3BMXA 4AT1A 1IPHA 3RC1A 5AVWA 1OWLA 2A58A 4PR0A 1J07A 2ZIVB 3LS2A 1O9GA 4G8BA 1BQEA 2XA9A 1SBZA 4G67A 2ZAGA 3GDGA 4GE0A 4UM8B 3V1KA 1BHSA 3MJFA 2G80A 3ELUA 4M9QA 4B31A 2IT1A 3JYLA 4IKPA 1BXRA 1PGNA 1RZ3A 5FCDA 3SEQA 1SUAA 3BJIC 2RGGA 3IMKA 3PE6A 4N65A 1GFSA 2OB2A 4XFDA 2QT9A 1E79A 4XWWA 2CLSA 4R8LA 3Q7QA 1Q0UA 1EWYA 4X24A 4X8OA 1GG9A 5IX8A 1WZUA 3LT1A 5AK6A 4OMFG 5EWMA 3RYFB 1BVRA 5F2KA 2UUPA 3NDRA 3T3GA 5FV4A 4JI5B 2YW2A 3FIUA 3HEBA 3ZU5A 1LSJA 4HEA1 4C0LA 1KEVA 2ODEA 4KNVA 1QB7A 4J2HA 4NZ9A 3V9AA 4D3FA 1ZJWA 4G9BA 1POWA 5JXGA 2UU9B 2FWPA 3LUKA 2JIBA 1JKIA 1UFKA 3ASUA 4WZBA 5BNZA 1RPTA 4G5YA 2HIHA 1ADJA 1ZESA 1MNAA 4YRKA 1OB2A 4M3NA 2L17A 2QMQA 5FWYA 3D2CA 3F6CA 4M7RA 4NFHA 4O4LF 1OZ0A 1F17A 3BTOA 2ETVA 3LC7O 3QGMA 4FWIB 4LXTA 4C7JA 1DOZA 1OH7A 2WG2A 2DHQA 4F7DA 4CCYA 2R7AA 1S3IA 3EWNA 4U7GA 5CB4A 1TEVA 4EPRA 1QDLB 2A3NA 2WSMA 4QYSA 3B78A 1TW3A 3B6EA 4X93A 4J1QA 4QGFA 1PWZA 5AXBA 2ZUTA 2H0AA 3ZU4A 1RSZA 1UMDB 1W34A 4UCWA 4EKYA 2GEVA 4JUIA 2X5NA 4JXKA 3I4CA 3B3QA 2PNJA 2CXPA 4LSMA 3AHJA 3FOWA 3JD2A 3UAWA 4LF7B 1JWAB 1ZONA 3EG9A 2NZJA 1DXHA 3FCCA 4NC9A 4PO9A 1DBWA 5H83A 1IBSA 1GUFA 3EVTA 2CL5A 3PC7A 3WYAA 4ZYTA 4DB4A 3I1JA 1G1AA 3I83A 4P2BA 4JEHA 2YQ5A 3ZD7A 2YV1A 4WACA 5CB0A 4WXMA 2EGUA 4QFBA 2XY4A 2GM4A 1MO4A 1WXXA 1NDQA 3BWEA 2ZYAA 1VRCA 2WIGA 5E1MA 5AW4A 4FIZA 1SR8A 5I7OA 1BJTA 3PDIB 1QR2A 4C07A 5EPOA 3JWEA 1QUFA 3RJ5A 2P3OA 8ABPA 2Q29A 4FKZA 1LS1A 3IAS1 3A58B 4QPJC 4KVZA 5TB5A 2GD6A 5JFGA 2B4TO 4LJ8A 1ORIA 3SXUA 3ZU3A 4F4CA 4JEMA 1VSBA 1DPFA 2IYFA 4OSPA 1ACJA 3MOSA 3ST7A 3WJ7A 1AZLA 5JATA 4QOHA 2QA5A 1M72A 4PGAA 2W42A 5JSZB 4YRGA 3LO8A 1A9YA 3B5IA 4AXXA 4CHGA 3P2YA 4XARA 2R1VB 1Z0DA 1CHDA 1KQ3A 3GA0A 5ES3A 5FWDA 1R6TA 1VLLA 4YA6A 2FMIA 1JR3A 1LUAA 3QUBA 4ZCSA 5ED4A 3GLGB 2MR6A 1UIMA 5DCLA 1GY8A 5BN3A 3CF6R 4PC6A 4MIYA 3EZ2A 3OJXA 4I2VA 1I2ZA 4JVLA 1GTSA 3ZXYA 4LYDA 1H93A 1II8A 1MHTA 1JI0A 1TW2A 2H4WA 4IZOA 3ADPA 2HK9A 4MP6A 3K72B 4C01A 1BA2A 5EKDA 2VDPB 1C0IA 3VU8A 4PFJA 3QVVA 3KTFA 3NHMA 1CE8B 3BRQA 4BNUA 5IBCA 1ENPA 5CTAA 1N1DA 5JTTA 1SC3A 1NBMD 5K09A 4ZAFA 4ZO6A 3E70C 2JD2A 4MRRA 1Z0SA 3TLMA 2EZUA 3W6PA 3AEZA 2GD2A 1EI9A 2IXEA 3MRXA 4HX9A 2RE8A 5A3SA 4D7AA 1OTXA 2ZTVA 2ZT6A 3NDIA 1E8DA 1HDGO 1XZKA 4D9CA 5AQ1A 4HZGA 2NW6A 5BVGB 4MR9A 1CQZA 2VQEB 3DEZA 3TOCA 1M2VA 4WECA 5C8YB 3EVGA 4V0RA 2Z3WA 2FQWA 3PQCA 3PUWA 3JXEA 4IG4A 1NW4A 4L50A 3V8NA 3NI2A 4DR2B 4G36A 3ZI4A 1ODSA 2XKJE 3Q8LA 1XRRA 1PQ4A 1G60A 1K8QA 2WWXA 4FDAA 2JGLA 4YRCA 5DM60 4CLOB 4FB5A 3J80A 3CNHA 5LP6F 1R0KA 2QBYA 4A8TA 2ZB3A 1RIFA 3GMTA 1E77A 1G6Q1 2JAWA 1M74A 4DBLC 5KMGB 5HTKA 2R84A 3BC1A 4EI7A 4CDRA 1TAHA 2XI4A 3GFQA 4JN6B 5IDVA 1DO0A 2AN3A 2NYRA 3K6SA 4M0PA 4L5JA 3W7BA 3EAQA 1FS4A 5L3ZA 2BMFA 2IF0A 2ZITA 4FUQA 3PUKA 1Z0KA 3ONWA 4TS3A 3PYLA 4IQFA 2H48A 5K3DA 3REOA 4HEQA 1V1RB 4I6GA 4YUWA 1GZ3A 2PU7A 3ZQ6A 2GILA 1AJEA 2CY0A 4GI1A 3BMQB 3TQFA 3L9WA 1W0KA 2WE8A 3UTDA 4X7BA 1KGDA 5A1TA 5LPNA 3EY9A 1EUCA 4ZT5A 3SXJA 2WDPA 1RMQA 3IV7A 3V1YA 3OPYA 1AD2A 3PWKA 4G2TA 5TPZA 4LBWA 4E08A 4YP1A 4W5QA 2OFOA 4MEBA 1GFIA 4EYKA 3LX8A 4OP3A 4EHNA 1N7HA 1S5PA 3RC9A 4TMKA 4YYEA 1BE0A 4KN8A 1ZH4A 2V9PA 1IN7A 3EDRA 4OEHA 4BTLA 3D7MA 3K9LA 3HVUA 4UUNA 3EF3A 4I6EA 5IN5A 1FFHA 3GDFA 2ZZNA 5ELLA 3TLKA 1ACMA 1VE7A 4BKOA 2QW1A 1EXNA 1YVPA 4EKIA 5JHGB 4FQ8A 2ECQA 5BV2P 2UUCB 1PRYA 1W5FA 1RLTA 3VR5H 5EXSA 1MA3A 4CGYA 1O95C 4EG5A 4YUYA 2IS4A 1P2FA 4OB6A 2AZXA 3VKGA 2H8KA 4UAGA 5AJZA 5T67A 2P5YA 4YRDA 4OX9B 4Z49A 3GEGA 3P8ZA 1YOVA 1R0BA 1PR6A 1NN3A 2Q1YA 2RGUA 3ESCA 3PB3A 3QF7A 4WW0A 1N77A 4HQOA 3CRZA 4RY9A 3ROQA 1RNLA 3E9EA 2ERYA 3OZ7A 4M1OA 1W9HA 4KQCA 1PU2A 1GLVA 2XD4A 4QJIA 4ZVNA 4N39A 4FI3C 3IURA 4A16A 1N0UA 1PWXA 1U0BB 3C1TA 4OQPA 2VXOA 1ZMTA 3E9MA 3QOWA 3C0KA 1N5DA 4KDRA 4WKBA 3WMWA 4B9AA 2AEMA 2UVQA 3P2KA 2OHVA 1LB1B 2KPOA 4XJSA 5FUXA 5IUKC 1R2QA 2Q45A 1PR3A 4MTLA 5FNZA 1YE3A 1SKUA 3R5FA 3KJXA 4QVKA 2YCBA 4JXZA 1MO5A 3DR5A 4RV9A 5A9SA 2FHSA 4C4AA 3MELA 3FE2A 5A4MS 1R0WA 3KOUA 1H42A 3O5AA 4HCJA 1GCIA 4OIMA 5HFAA 4A2CA 3D7NA 4E32A 4PRZA 2AZMA 1T2NA 4BZPA 2O8FB 4OK5A 3SEZA 3SK0A 4YAOA 4F9TA 2XE4A 2F8LA 4GLLA 3A6ZA 1GNTA 2FU5C 2NZXA 3NKLA 2BZ1A 2PUTA 4N49A 1JJIA 4KBGA 4YJ3B 4FFVA 2ICAA 1W36B 2QLLA 5D86A 2POQX 3SD7A 1T1IA 3WIOA 2BZGA 2D1FA 2GJKA 2VDVE 3ZR4B 4E5SA 2H16A 3THXA 1GGVA 4ONEA 1Y7TA 3LCRA 3W8FA 2FUG1 1V6CA 1YO6A 3ROFA 4FZ5A 5JSKA 1BXKA 5A6VA 1JLHA 4D8TA 3IA7A 3W4JA 1O6CA 3L4BC 1SAYA 1OREA 3H3XA 2XZTA 4CT5A 2X5KO 4AN0A 1F7VA 1QMPA 1UAGA 4HB3A 4J49A 1QWOA 2WNIA 4PC3A 1DKOA 4V3BA 3RYFA 5CVDA 5C8XA 3ZDEA 3CLRD 1R6BX 4O2BB 5H3CA 5T6BA 5IK2D 1R0CA 2VH5R 1Q19A 3H9QA 4DCJA 1X1TA 3TMKA 3K1ZA 3QFCA 1PR0A 2VHEA 3TKAA 4BNGA 2R7MA 4JLAA 4EYSA 5FBHA 4XRGA 2CXUA 2H00A 3I9JA 4HUQB 1T1RA 2H3EA 1MFPA 1OXTA 2KYRA 3D4OA 3D6NB 4FWBA 3K9NA 4UNQA 5A04A 4LYGA 3SC3A 3T5GA 3FDFA 1Z2DA 3OTQA 5FPHA 2B1JA 3LBIA 2YKGA 2P67A 2YUTA 3AQIA 3O9ZA 1NG1A 3CE6A 2EGHA 3K09A 3PNMA 5G2OA 1G7TA 1Z7GA 3RVOA 2XMSA 3MMZA 4NQRA 5CX4A 4L7VA 1DV2A 2E48A 3BEOA 3MJRA 3R3WA 4GX1A 1KVRA 1UMDA 4IDHA 4QHSA 4ZZ1A 1ZINA 4XIIA 4RTPA 3QM1A 4NYIR 1FA9A 4L0QA 1VE6A 1Z8HA 4PTYA 3GLIB 1LQTA 5JJKA 1OBHA 1OPXA 2Q0XA 3CWQA 1DJNA 5ABPA 1L7XA 1P0FA 2IHJA 2QUHA 3DPIA 4HH0A 1NVXQ 5I8PA 7GPBA 3OM9A 2JZNA 3DEHA 4IEEA 1LPPA 3WKEA 4Q9DA 3ZE7A 5JVDF 5SICE 5JQGF 1LNSA 4RTJA 3FWZA 2PFSA 4BVBA 4D0NA 3FZQA 5LQUA 3V1TC 4MYUA 2QEQA 1UBTS 3CUTA 3PG5A 4G24A 3TZLA 3ZWAA 1UANA 1SCUB 4G2NA 4DMRA 4JV5B 3VGJA 2AWOA 2OGSA 5LIRA 1AGRA 3V8MA 1HH4A 2F8MA 1BTOA 1TCBA 1WQ4A 2I99A 3IT1A 2JA1A 2WKQA 3NM5A 3PDIA 5DXJA 2W70A 3VH2A 3IQDB 3AP3A 2CYAA 4C14A 2ZKLA 2BD0A 2VKQA 2WPDD 4KQJA 5DN9A 4I3HA 4DJTA 5LWQA 1J99A 1TKCA 2YXNA 1DINA 5F4BA 5HF6A 2ZTHA 3B2QA 1E3EA 2WFLB 4F45A 2GSWA 1CLEA 4QUAA 1VE3A 4FB4A 5JCZA 1Z39A 3D6JA 1ETHA 3O82A 4F85A 4KR9A 3BE8A 1H8HA 1O97C 4RC9A 1DB3A 5JG7A 5JSZA 3RC8A 1JR2A 3ROPA 2O2DA 3DVQX 4IKOA 1UZLA 5A9RA 4WH0A 3FCAA 4Y9SA 2R1VA 5DSZA 3KEFA 4UHCA 2B92A 3U0VA 1OI7A 4PY2A 2E9SA 2QX4A 4JC4A 3GLGA 2I5PO 1EX1A 5JWHA 4NYJQ 3HFJA 3KE9A 4MI6A 2JF0A 4BMYA 1YZNA 3H99A 3QBTA 5C80A 2O3UA 4S1NA 3G1WA 3K0EA 4YAWA 1D2GA 4E1AA 3NONA 3FG9A 1KH3A 3AF1A 2KLHA 1QFMA 1CJMA 5K0SA 3OQPA 4BO2A 1RXWA 3H16A 3IEIA 4JUDX 3MCTA 4AYTA 1O94A 4M9UA 2FETA 3GFOA 3D8UA 3MT0A 4EWLA 2P2SA 2ZRCA 3OWOA 1KETA 3A9RA 1OILA 4ZPXA 1CE8A 3HCCA