4ZY1A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10r
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
519
structure length
518
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable M17 family aminopeptidase
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
total genus 168
structure length 518
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zy1A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zy1A02
2ZEDA 1VGYA 3B3WA 4NGQA 4PXDA 1LAPA 2O4HA 1ZLIA 5LYIA 1ZG7A 3V38A 3PB4X 3BHXA 5J1QA 4UEFA 3KR5A 3PFEA 2ACFA 3B35A 1XFOA 2HB6A 2PE3A 2C6CA 3HLPA 5JGFA 1HDQA 4NGTA 3KQZA 3IO1A 3GPGA 2XEJA 3SI2A 4NGMA 4A39A 2BOAA 3WC6A 4ZX9A 5HVGA 2PJ5A 1VHOA 3D66A 2ZEFA 2Q43A 3MN8A 1Y0YA 3S9MA 2BCOA 1FT7A 3IIBA 2PJ6A 3GLJA 2CTCA 4MMOA 2AFWA 4K3NA 1TKFA 4OC2A 1M4LA 5E3BA 4ZX8A 2GREA 2ZEGA 3D7HA 4WWVA 3SIHA 4DJLA 2JBJA 1F57A 4P4DA 2JEWA 3DGVA 4NGNA 4ZY2A 4ZYQA 3Q6ZA 2RB7A 3IC1A 5ELYA 4ABLA 1OBRA 1TF9A 3KGQA 5LYLA 4UMLA 2PJBA 1XMBA 2GLJA 4PPZA 4EFDA 3FMCA 1LOKA 1IGBA 4J5RA 4ZI6A 4NFRA 3FVLA 3NH4A 2PJAA 4MCRA 2PRQA 2C6PA 4NGRA 3PB7X 1VHUA 3FJUA 3PB6X 4GUAA 1EE3P 5AILA 5THWA 3KHXA 4P4FA 5FSYA 4B6ZA 4H2KA 2WZNA 3I1UA 1QQ9A 4O23A 5CBMA 3IWWA 1XJOA 3B3CA 3EKEA 2PJ0A 1CX8A 3JRUA 4YWYA 2FG1A 5K8MA 4JGKA 2FVGA 4JVVA 2Q51A 4TNUA 1YW6A 4PXEA 3NA6A 2LGRA 3PFOA 4OKOA 4TU0A 4IQYA 2IMOA 4P45A 2J9AA 2ZEEA 4P6YA 5JH9A 3Q71A 3PB9X 2IQ6A 1R43A 4NGPA 1PYTB 4P4IA 3V7ZA 1YW4A 3GB0A 3GPQA 5LRJA 3PBEA 3BI0A 5CB5A 2C1CA 4ZY0A 5HOLA 3H8FA 3KHZA 4OIWA 4OC0A 1GYTA 3KZWA 1AYEA 1JQGA 2V8DA 5HIHA 1CP6A 2V8HA 2QVPA 4P4JA 3CPXA 4P44A 4NJQA 4ONWA 2EK9A 4MCQA 3IJ3A 3FEDA 4MHYA 2AFXA 4FWUA 1Z5RA 1FNOA 3GQOA 1XRYA 1CBXA 3ETIA 4MHPA 4PXBA 3K9TA 4RUHA 3B3TA 5K8NA 1LCPA 5I4MA 1ZG8A 2GLFA 2V77A 4ZY1A 1Y0RA 2Q4ZA 1BPMA 4MXUA 2ANPA 4NJRA 2ZENA 4Z65A 4JLLA 4OC4A 1BLLE 5FSUA 4JZ0A 4GM5A 1HJZA 4R6TA 3PB8X 3EJGA 3TC8A 2POKA 3HUVA 3PBBA 2F7VA 4YU9A 1RTQA 2AFOA 2OR4A 1LFWA 2NYQA 4ETKA 5K8PA 1YLOA 5FSVA 1Y7EA 4A94A 2PJ7A 1XBUA 1F2OA 4ESSA 1AMPA 4UEEA 3RZAA 4EMEA 4R8FA 5HVFA 5LYDA 3ISZA 3B2YA 1TF8A 5DUSA 3KASA 3PRTA 8CPAA 3S9LA 5F09A 3IIFA 4MHNA 3FF3A 2AFUA 4P10A 3H8GA 3V45A 4IK2A 2O53A 3D7FA 4WJBA 3SI0A 2VRIA 4GVVA 3ISXA 4BD9A 3NFZA 3L2NA 4ABKA 1VHEA 3IFEA 4UF4A 4R76A 4OIDA 1DE4C 2CF4A 4MCPA 4GVWA 3SJGA 5IB9A 4D86A 4MRIA 1IY7A 4F8ZA 1R3NA 1TY8A 2ZEMA 3MRUA 3LWUA 3WC5A 3EJFA 3RAMA 4PXCA 3B3VA 3RBUA 4JCAA 3FECA 2ZELA 3FX6A 4KSIA 3GQEA 4OC1A 2XEIA 2EEEA 5FSZA 4OMEA 1ZLHA 3SJXA 1Q7LA 1YD9A 1QMUA 3KL9A 1UWYA 4ETJA 1ELMP 4FUUA 3SJEA 2ZOGA 1NSAA 1ZR3A 5K8OA 1ZR5A 3EW5A 3EWOA 4X8IA 4DYOA 4LQGA 2PJ9A 3D4UA 3D68A 3IEHA 2IJZA 4A38A 3BI1A 5LYFA 2ZEHA 3TX8A 5HVHA 3VARA 4J4ZA 5FSXA 3VATA 4TWEA 1YMEA 3NH5A 3SIJA 2ZEPA 4Q7AA 1BPNA 2CTBA 2CIJA 4G1PA 3KR4A 4X3RA 3GPOA 4J5SA 3IIDA 4W9YA 3B3SA 2DX6A 3EWRA 4OC5A 5CPAA 4UIBA 3KQXA 7CPAA 6CPAA 3WABA 2XEGA 1ELLP 3D67A 4FBEA 1SPVA 3WC7A 2XD7A 3N5FA 3QNVA 4F9VA 3EWPA 1ARMA 3DLJA 1TXZA 2FAVA 4MCSA 4X2TA 1CPXA 3K2KA 4EWTA 3V2BA 3SJFA 2VL1A 3CDXA 4AXVA 1ARLA 1NJRA 4P4BA 2L8RA 1H8LA 2I3CA 4DUKA 3CPAA 1CPSA 2ZEOA 3CT9A 4NGSA 2PJ3A 1PCAA 5LRGA 3H8EA 2WYRA 2ZOFA 4MHZA 3JZTA 4FAIA 2X47A 4IAVA 3KI9A 1LANA 1BAVA 1TKJA 4OP4A 4P4EA 2PVVA 4F9UA 1TXRA 3B7IA 2QYVA 2GU2A 2PCUA 2PJ1A 5D8NA 2EWBA 2AFSA 4OC3A 4JYWA 4PQAA 1ZG9A 2BO9A 2XEFA 2PVWA 4CPAA 2PIYA 3EWQA 3D7DA 1VIXA 3VFQA 1HDUA 4UIAA 5D29A 2QJ8A 2DEAA 1F2PA 3SIGA 3D7GA 2PIZA 3SIIA 3BXMA 5CB3A 2OOTA 1Z2LA 3SI1A 2V8GA 3WT4A 5LRKA 2FXKA 4K0CA 3FEEA 1HEEA 1TKHA 4KYBA 2PJ2A 2EK8A 5CMSA 1Z8LA 3PEIA 2C6GA 2BFQA 3FH4A 2PJ8A 2PJCA 5JM6A 2RFHA 2JBKA 3T8WA 2V8VA 4R7MA 2PJ4A 3S9NA 5DS0A 1YSJA 2AFCA 2AFZA 3VH9A 1KWMA 5HXDA 1CG2A 4IHMA 2ABZA 2F8HA 2NSMA 3NH8A 2HC9A 2AFMA 3LMSA 2BFRA 4J5QA 4UEZA 2G9DA 4A37A 1CP7A 1DTDA 1LAMA 3GUXA
chains in the Genus database with same CATH superfamily
4CGLA 2ZEDA 4C7IA 2HV2A 1VGYA 3B3WA 1CM0A 2ARHA 2K5TA 1V0CA 4NGQA 1PUAA 4X5KA 4PXDA 4UFWA 1LAPA 2O4HA 1RO5A 2R1IA 3BJ7A 1ZLIA 4KLVA 5LYIA 3ZZIA 4BINA 1IICA 1ZG7A 2VBQA 2Z3PA 2VQYA 3GIUA 3S6KA 5J8FA 4IUSA 3V38A 3PB4X 2J8MA 3BHXA 2QECA 1Q2DA 4U9YA 4UEFA 4CS0B 5J1QA 3KR5A 3TT2A 3PFEA 2ACFA 2DF5A 1XFOA 3B35A 4ORFA 4U9ZA 4C2YA 3TFYA 2HB6A 1IU8A 1TIQA 2PE3A 3SHPA 1OZPA 5GCNA 2C6CA 2DPTA 3HLPA 3CZXA 3D8PA 3SXNA 4JLYA 5JGFA 2WPWA 4M6HA 1HDQA 1IB1E 2EUIA 3KQZA 3IO1A 3GPGA 4NGTA 1UFHA 4UCMA 4DNCA 2XEJA 3SI2A 4NGMA 4A39A 2BOAA 5DWMA 4YFJA 3GY9A 3WC6A 4ZX9A 5HVGA 2PJ5A 2ODFA 5AG5A 1VHOA 3D66A 2P6FA 2ZEFA 2Q43A 3MN8A 1Y0YA 2PR1A 2JZEA 2BCOA 3S9MA 1FT7A 2YNCC 2ZW4A 3IIBA 2PJ6A 3GLJA 2CTCA 4MMOA 3W91A 2AFWA 2B4DB 4K3NA 1TKFA 4OC2A 1M4LA 4CGOA 2WCTA 5E3BA 4ZX8A 2CNTA 2GREA 2ZEGA 3FBUA 1S5KA 2Q7SA 1P4NA 1Y9WA 3D7HA 2WPXA 3EC4A 3SIHA 4WWVA 4B5PA 4DJLA 2JBJA 3WR7A 1F57A 2EBJA 1GHEA 3FB3A 4CYPA 5F46A 4BMHA 3F5BA 3TO7A 5H86A 4P4DA 2FSRA 2JEWA 1L0CA 3JUWA 3DGVA 2WSAA 4NGNA 4ZY2A 4ZYQA 3Q6ZA 2RB7A 2P6GA 3IC1A 4Y49C 5EC4A 4ABLA 1IYLA 1OBRA 5ELYA 1TF9A 2ATRA 3KGQA 4NEXA 5A27A 5LYLA 4UMLA 2RNKA 2PJBA 1XMBA 2GLJA 4GXHA 4PPZA 2YNDA 4EFDA 1MK4A 3FMCA 1LOKA 1Z4RA 4HNWB 1IGBA 4J5RA 3E0KA 4ZI6A 4NFRA 4B10A 3FVLA 3NH4A 3QAYA 4HPSA 2PJAA 4MCRA 2PRQA 2C6PA 4NGRA 3PB7X 3T90A 1VHUA 1A2ZA 3D3SA 3FJUA 3PB6X 4GUAA 1EE3P 2VXKA 2DXQA 4KOYA 5EBVA 2OB0A 5AILA 3D2MA 5THWA 4KVME 3KHXA 4P4FA 5FSYA 2FCKA 2YNEA 4B6ZA 3FXTA 4MY0A 3TOBA 2P0WA 1Z8WA 4H2KA 2WZNA 3I1UA 1QQ9A 3SXOA 4O23A 5CBMA 3IWWA 2DPSA 2GIVA 1XJOA 2PR8A 4HNXB 3B3CA 3EKEA 2O28A 1QSNA 4PK3A 2PJ0A 1CX8A 3R96A 3JRUA 3R1KA 1PU9A 4H6UA 3C26A 4JJXA 4YWYA 2FG1A 3VWEA 4JGKA 4A95A 5K8MA 4PV6A 2Q4VA 2FVGA 2FS5A 4JVVA 4AG7A 3NE8A 2Q51A 2QMLA 3QAHA 4TNUA 1YW6A 1Q2CA 2REEA 3NA6A 4PXEA 2LGRA 3D2PA 3TO6A 3PFOA 3RO0A 4KUBA 2JLMA 4OKOA 4TU0A 4IQYA 2IMOA 4P45A 4UWIA 3TCVA 4KOVA 2J9AA 2ZEEA 4P6YA 4E0AA 2OH1A 5JH9A 3Q71A 3PB9X 4L8AA 1XIXA 2IQ6A 1R43A 4NGPA 4F0XA 4R3LA 2CNSA 1PYTB 3G3SA 2FE7A 5AG7A 4P4IA 3V7ZA 1KUVA 1YW4A 3GB0A 3GPQA 4R57A 4CGNA 2F5IA 5F49A 5LRJA 2IL4A 3PBEA 4M6GA 3TOAA 1BOBA 3BI0A 5CB5A 2C1CA 3T9YA 1WK4A 4ZY0A 5KTDA 5HOLA 4MHDA 3H8FA 2PDOA 2OZUA 3KHZA 4H89A 1YREA 4OIWA 4OC0A 4CYNA 1GYTA 3KZWA 4QUSA 1AYEA 1JQGA 2V8DA 5HIHA 4UBRA 4CAEA 5IV0A 3P2FA 1CP6A 2B3VA 4MFKA 2V8HA 2QVPA 3QB8A 1Z9UA 4P4JA 4C2ZA 1VHSA 3CPXA 4MBUA 4P44A 2EVNA 4NJQA 4Y49B 4ONWA 2EK9A 2Z11A 3PZJA 4MCQA 1XOVA 3IJ3A 3FEDA 4MHYA 2I00A 2FT0A 2AFXA 4E2AA 4BBHA 4FWUA 1Z5RA 4HNYB 4UWJA 1FNOA 3GQOA 1S7NA 1XRYA 1CBXA 1X10A 1S7LA 3S6HA 4UFXA 3ETIA 1Y9KA 1R57A 1ZO0A 3CXQA 4MHPA 4PXBA 3K9TA 4RUHA 3B3TA 5K8NA 4FD7A 3I3GA 3FYNA 1LCPA 4HKFA 5I4MA 1ZG8A 2GLFA 2V77A 4AVBA 1SQHA 3EY5A 3JVNA 4RI1A 4ZY1A 5G22A 1Y0RA 2Q4ZA 4A2ZA 1BPMA 4MFPA 4MXUA 4ZGYB 2ANPA 4C7HA 1YVOA 4B13A 4NJRA 4KOWA 2ZENA 3G8WA 3H4QA 3R95A 2WUUA 4OAEA 4Z65A 4JLLA 4MFLA 4OC4A 1BLLE 5FSUA 2Q7BA 5A28A 1S7KA 2G0BA 2Q04A 3KKWA 4UCPA 4JZ0A 5DWNA 4GM5A 4KVOE 1HJZA 3EO4A 2OZHA 4CAFA 4R6TA 4R3KA 1Y7RA 3PB8X 4MFZA 3EJGA 2FIAA 2POKA 3TC8A 4QVTA 4R87A 4B11A 2VEZA 3HUVA 4YRHA 1CJWA 4GS4A 3PBBA 2F7VA 4YU9A 1RTQA 2AFOA 2OR4A 1LFWA 2ZW5A 2NYQA 4ETKA 5K8PA 1YLOA 1M4DA 2I79A 5FSVA 4U5YA 1XEBA 4QC6A 1Y7EA 4PSWA 4A94A 2PJ7A 1XBUA 1F2OA 2FIWA 4ESSA 4NCZA 3IU1A 4B5PB 1AMPA 2RC4A 1IOIA 2Z3NA 2R8VA 4UEEA 1XMTA 1K4JA 3RZAA 1QSOA 4EMEA 2R7HA 4JWPA 1J4JA 2PC1A 4R8FA 2Q0YA 2PQ8A 4ONUA 5HVFA 1M1DA 5LYDA 3ISZA 3UY5A 2Z0ZA 3B2YA 1TF8A 5DUSA 3KASA 3PRTA 8CPAA 3S9LA 3EFAA 5F09A 4QB9A 2Z10A 3IIFA 1BO4A 5FVJA 4MHNA 3FF3A 2AFUA 4P10A 4MFQA 5KTAA 3H8GA 3N7ZA 2HQYA 1QSTA 4UFVA 2VI7A 3V45A 4IK2A 2O53A 5CNPA 4KORA 1Z8XA 3D7FA 2GE3A 4KLWA 4WJBA 3SI0A 2VRIA 4GVVA 3ISXA 4BD9A 3NFZA 2J8RA 1N71A 2VZZA 3L2NA 4ABKA 3PP9A 2OZGA 1VHEA 2BL1A 3CXSA 3IFEA 4UF4A 4R76A 2EO8A 2KCWA 4OIDA 1DE4C 4A31A 2CF4A 3GKRA 4MCPA 4GVWA 4ZBGA 3SJGA 4M3SA 5IB9A 1VKCA 4D86A 1IOFA 2B3UA 4B12A 4MRIA 2Z3OA 1B6BA 3NE7A 1IY7A 4F8ZA 1R3NA 1TY8A 1U6MA 1YX0A 3F8KA 3W6XA 4KOSA 2ZEMA 3MRUA 4Q36A 5AGEA 2C27A 3VWDA 3LWUA 3WC5A 3EJFA 3RAMA 4RS2A 5BWAB 4PXCA 3B3VA 4CYQA 2PSWA 3RBUA 4JCAA 3LACA 3FECA 2ZELA 2D4PA 3FX6A 3GQEA 4KSIA 4OC1A 5JPHA 2W2GA 2XEIA 2EEEA 5FSZA 1YQEA 4OLLA 4OMEA 4CYOA 5E96A 1ZLHA 2ZPAA 3RNZA 3SJXA 3W6SA 2J8NA 4XNHC 1Q7LA 2PRBA 2REFA 1YD9A 1QMUA 1B87A 3KL9A 1Z8TA 5G1ZA 1UWYA 1LRZA 4ETJA 1ELMP 4FUUA 2QIRA 3FRMA 4XPLA 3B8GA 3SJEA 2ZOGA 4NXYA 1NSAA 1ZR3A 1Z4EA 4A33A 1IYKA 4A32A 4R9MA 1Q2YA 2D4OA 5K8OA 4M85A 1ZR5A 4XPDC 3EW5A 3EWOA 5JQ4A 1M44A 4X8IA 4F0YA 4DYOA 2KQVA 2B58A 5HH1A 4LQGA 2PJ9A 3P2HA 3TE4A 3D4UA 2GANA 5KTCA 3D68A 3IEHA 2IJZA 4AVAA 5IB0A 4Q38A 3BI1A 4A38A 4YGOA 1JWQA 4B14A 5LYFA 3OWCA 2ZEHA 1FY7A 1I12A 3TX8A 4J4ZA 4FD5A 3VARA 5HVHA 2BEIA 5FSXA 3VATA 2VZYA 4TWEA 1YMEA 3NH5A 3SIJA 2ZEPA 2FL4A 4I49A 4KOTA 1XF8A 4Q7AA 1BPNA 2CTBA 2CIJA 4G1PA 4MY3A 3KR4A 2BUEA 4X3RA 3GPOA 4J5SA 3IIDA 2JZDA 4M6IA 4W9YA 2B5GA 3R9FA 4QBJA 3B3SA 1IIDA 2DX6A 3EWRA 3IGRA 4LX9A 4OC5A 4MFJA 4UIBA 5CPAA 3KQXA 5AG4A 3A9LA 6CPAA 7CPAA 4H6ZA 3WABA 4A30A 5I0CA 5IX3A 2XEGA 1YLEA 1P0HA 1MJBA 1ELLP 4FD4A 3D67A 4FBEA 4UA3A 1SPVA 2B4DA 3WC7A 2XD7A 3N5FA 3QNVA 4F9VA 1WWZA 4JXQA 3EWPA 1ARMA 3DLJA 1TXZA 2FAVA 2B4BA 1S7FA 2B5GB 1XE4A 3FNCA 2HUZA 3DR8A 4CRZB 4CGPA 2JZFA 1QSMA 1RXTA 5AG6A 4MCSA 4NF1A 4C68A 4X2TA 1CPXA 1M4GA 3K2KA 3IU2A 5F48A 3V2BA 2G3TA 2Z3KA 4C2XA 3SJFA 2VL1A 3CDXA 4EWTA 4KSFA 4AXVA 1ARLA 1NJRA 4P4BA 2L8RA 1H8LA 1S3ZA 2I3CA 3CPAA 1CPSA 2ZEOA 3CT9A 4KS9A 3DSBA 4DUKA 5ISVA 4NGSA 2PJ3A 1PCAA 4CGMA 4KSAA 5LRGA 3H8EA 2WYRA 2ZOFA 4MHZA 3BLNA 1YR0A 3JZTA 3K9UA 4FAIA 2X47A 4IAVA 2FXFA 1KUXA 4XNHB 2Q44A 1X12A 1LANA 1BAVA 3KI9A 1TKJA 4OP4A 4P4EA 4UCNA 2PVVA 1NE9A 2OU2A 1KZFA 2GFQA 2Z3MA 3IWEA 4XPKA 5EMIA 5F47A 4F9UA 4J3GA 1TXRA 4II9A 3B7IA 2QYVA 3DDDA 2NMTA 2GU2A 4CAXA 2PCUA 2PJ1A 5D8NA 2Y0MA 3GUXA 4JD6A 4MJ8A 3V8IA 4LQ6A 2EWBA 2AFSA 4OC3A 5G20A 5C82A 4JYWA 4PQAA 4KOXA 1ZG9A 5C88A 2BO9A 2XEFA 2PVWA 3JTKA 4CPAA 1M4IA 2PIYA 3I9SA 3EWQA 3LD2A 4K30A 4XPDB 4B5OA 3D7DA 4LUAA 4KOUA 1VIXA 3VFQA 1HDUA 4IF5A 4EVYA 3CXPA 5G21A 4UIAA 5D29A 5J8CA 2QJ8A 2DEAA 1KUYA 1F2PA 3SIGA 3D7GA 4AG9A 2PIZA 2ZXVA 3DR6A 2AJ6A 3SIIA 4NSQA 3BXMA 4CRYB 4RN7A 3LODA 5CB3A 3S6FA 3EXNA 1I21A 2X7BA 2OOTA 1Z2LA 1MJAA 2A4NA 2JEVA 2V8GA 3SI1A 3WT4A 5LRKA 2FXKA 1AUGA 4K0CA 2ZW6A 1HEEA 1YGHA 1TKHA 2CXAA 2Q4YA 4KYBA 3FEEA 3IWGA 3R9GA 2PJ2A 2EK8A 5CMSA 3GYAA 1Z8LA 3S6GA 3RYOA 2ZW7A 3PEIA 2C6GA 2BFQA 2R98A 3FH4A 3ZJ0A 2PJ8A 2PJCA 1I1DA 3F0AA 5JM6A 2RFHA 3R9EA 2JBKA 3T8WA 2V8VA 4R7MA 2PJ4A 1NSLA 4KZTA 2Z3LA 5DS0A 3S9NA 2JDDA 1YSJA 2AFCA 3PGPA 4PSXA 4E8OA 2AFZA 3VH9A 1KWMA 3DNSA 5HXDA 1CG2A 4KVXA 2YNCA 4AVCA 4CAWA 4IHMA 2ABZA 2F8HA 2NSMA 3NH8A 4AB7A 2HC9A 4JXRA 3TO9A 4MI4A 2AFMA 3TTHA 3LMSA 1MJ9A 1QSRA 2BFRA 5HMNA 4CAVA 1ON0A 4L89A 1YK3A 4OADA 4J5QA 1YVKA 4UEZA 2JDCA 4F6AA 5H84A 1S60A 2G9DA 2H5MA 2P6EA 4A37A 2CY2A 4KUAA 2YGWA 1CP7A 1DTDA 1NMTA 1LAMA 2BSWA 2CNMA 3BJ8A 2G3AA 3FIXA 4PK2A 2AE6A 3H5ZA 4FD6A 3MGDA
chains in the Genus database with same CATH topology
2ZEDA 1VGYA 3B3WA 4NGQA 4PXDA 1LAPA 2O4HA 1ZLIA 5LYIA 1ZG7A 3V38A 3PB4X 3BHXA 5J1QA 4UEFA 3KR5A 3PFEA 2ACFA 3B35A 1XFOA 2HB6A 2PE3A 2C6CA 3HLPA 5JGFA 1HDQA 4NGTA 3KQZA 3IO1A 3GPGA 2XEJA 3SI2A 4NGMA 4A39A 2BOAA 3WC6A 4ZX9A 5HVGA 2PJ5A 1VHOA 3D66A 2ZEFA 2Q43A 3MN8A 1Y0YA 3S9MA 2BCOA 1FT7A 3IIBA 2PJ6A 3GLJA 2CTCA 4MMOA 2AFWA 4K3NA 1TKFA 4OC2A 1M4LA 5E3BA 4ZX8A 2GREA 2ZEGA 3D7HA 4WWVA 3SIHA 4DJLA 2JBJA 1F57A 4P4DA 2JEWA 3DGVA 4NGNA 4ZY2A 4ZYQA 3Q6ZA 2RB7A 3IC1A 5ELYA 4ABLA 1OBRA 1TF9A 3KGQA 5LYLA 4UMLA 2PJBA 1XMBA 2GLJA 4PPZA 4EFDA 3FMCA 1LOKA 1IGBA 4J5RA 4ZI6A 4NFRA 3FVLA 3NH4A 2PJAA 4MCRA 2PRQA 2C6PA 4NGRA 3PB7X 1VHUA 3FJUA 3PB6X 4GUAA 1EE3P 5AILA 5THWA 3KHXA 4P4FA 5FSYA 4B6ZA 4H2KA 2WZNA 3I1UA 1QQ9A 4O23A 5CBMA 3IWWA 1XJOA 3B3CA 3EKEA 2PJ0A 1CX8A 3JRUA 4YWYA 2FG1A 5K8MA 4JGKA 2FVGA 4JVVA 2Q51A 4TNUA 1YW6A 4PXEA 3NA6A 2LGRA 3PFOA 4OKOA 4TU0A 4IQYA 2IMOA 4P45A 2J9AA 2ZEEA 4P6YA 5JH9A 3Q71A 3PB9X 2IQ6A 1R43A 4NGPA 1PYTB 4P4IA 3V7ZA 1YW4A 3GB0A 3GPQA 5LRJA 3PBEA 3BI0A 5CB5A 2C1CA 4ZY0A 5HOLA 3H8FA 3KHZA 4OIWA 4OC0A 1GYTA 3KZWA 1AYEA 1JQGA 2V8DA 5HIHA 1CP6A 2V8HA 2QVPA 4P4JA 3CPXA 4P44A 4NJQA 4ONWA 2EK9A 4MCQA 3IJ3A 3FEDA 4MHYA 2AFXA 4FWUA 1Z5RA 1FNOA 3GQOA 1XRYA 1CBXA 3ETIA 4MHPA 4PXBA 3K9TA 4RUHA 3B3TA 5K8NA 1LCPA 5I4MA 1ZG8A 2GLFA 2V77A 4ZY1A 1Y0RA 2Q4ZA 1BPMA 4MXUA 2ANPA 4NJRA 2ZENA 4Z65A 4JLLA 4OC4A 1BLLE 5FSUA 4JZ0A 4GM5A 1HJZA 4R6TA 3PB8X 3EJGA 3TC8A 2POKA 3HUVA 3PBBA 2F7VA 4YU9A 1RTQA 2AFOA 2OR4A 1LFWA 2NYQA 4ETKA 5K8PA 1YLOA 5FSVA 1Y7EA 4A94A 2PJ7A 1XBUA 1F2OA 4ESSA 1AMPA 4UEEA 3RZAA 4EMEA 4R8FA 5HVFA 5LYDA 3ISZA 3B2YA 1TF8A 5DUSA 3KASA 3PRTA 8CPAA 3S9LA 5F09A 3IIFA 4MHNA 3FF3A 2AFUA 4P10A 3H8GA 3V45A 4IK2A 2O53A 3D7FA 4WJBA 3SI0A 2VRIA 4GVVA 3ISXA 4BD9A 3NFZA 3L2NA 4ABKA 1VHEA 3IFEA 4UF4A 4R76A 4OIDA 1DE4C 2CF4A 4MCPA 4GVWA 3SJGA 5IB9A 4D86A 4MRIA 1IY7A 4F8ZA 1R3NA 1TY8A 2ZEMA 3MRUA 3LWUA 3WC5A 3EJFA 3RAMA 4PXCA 3B3VA 3RBUA 4JCAA 3FECA 2ZELA 3FX6A 4KSIA 3GQEA 4OC1A 2XEIA 2EEEA 5FSZA 4OMEA 1ZLHA 3SJXA 1Q7LA 1YD9A 1QMUA 3KL9A 1UWYA 4ETJA 1ELMP 4FUUA 3SJEA 2ZOGA 1NSAA 1ZR3A 5K8OA 1ZR5A 3EW5A 3EWOA 4X8IA 4DYOA 4LQGA 2PJ9A 3D4UA 3D68A 3IEHA 2IJZA 4A38A 3BI1A 5LYFA 2ZEHA 3TX8A 5HVHA 3VARA 4J4ZA 5FSXA 3VATA 4TWEA 1YMEA 3NH5A 3SIJA 2ZEPA 4Q7AA 1BPNA 2CTBA 2CIJA 4G1PA 3KR4A 4X3RA 3GPOA 4J5SA 3IIDA 4W9YA 3B3SA 2DX6A 3EWRA 4OC5A 5CPAA 4UIBA 3KQXA 7CPAA 6CPAA 3WABA 2XEGA 1ELLP 3D67A 4FBEA 1SPVA 3WC7A 2XD7A 3N5FA 3QNVA 4F9VA 3EWPA 1ARMA 3DLJA 1TXZA 2FAVA 4MCSA 4X2TA 1CPXA 3K2KA 4EWTA 3V2BA 3SJFA 2VL1A 3CDXA 4AXVA 1ARLA 1NJRA 4P4BA 2L8RA 1H8LA 2I3CA 4DUKA 3CPAA 1CPSA 2ZEOA 3CT9A 4NGSA 2PJ3A 1PCAA 5LRGA 3H8EA 2WYRA 2ZOFA 4MHZA 3JZTA 4FAIA 2X47A 4IAVA 3KI9A 1LANA 1BAVA 1TKJA 4OP4A 4P4EA 2PVVA 4F9UA 1TXRA 3B7IA 2QYVA 2GU2A 2PCUA 2PJ1A 5D8NA 2EWBA 2AFSA 4OC3A 4JYWA 4PQAA 1ZG9A 2BO9A 2XEFA 2PVWA 4CPAA 2PIYA 3EWQA 3D7DA 1VIXA 3VFQA 1HDUA 4UIAA 5D29A 2QJ8A 2DEAA 1F2PA 3SIGA 3D7GA 2PIZA 3SIIA 3BXMA 5CB3A 2OOTA 1Z2LA 3SI1A 2V8GA 3WT4A 5LRKA 2FXKA 4K0CA 3FEEA 1HEEA 1TKHA 4KYBA 2PJ2A 2EK8A 5CMSA 1Z8LA 3PEIA 2C6GA 2BFQA 3FH4A 2PJ8A 2PJCA 5JM6A 2RFHA 2JBKA 3T8WA 2V8VA 4R7MA 2PJ4A 3S9NA 5DS0A 1YSJA 2AFCA 2AFZA 3VH9A 1KWMA 5HXDA 1CG2A 4IHMA 2ABZA 2F8HA 2NSMA 3NH8A 2HC9A 2AFMA 3LMSA 2BFRA 4J5QA 4UEZA 2G9DA 4A37A 1CP7A 1DTDA 1LAMA 3GUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZED A;  1VGY A;  3B3W A;  4NGQ A;  4PXD A;  1LAP A;  2O4H A;  1ZLI A;  5LYI A;  1ZG7 A;  3V38 A;  3PB4 X;  3BHX A;  5J1Q A;  4UEF A;  3KR5 A;  3PFE A;  2ACF A;  3B35 A;  1XFO A;  2HB6 A;  2PE3 A;  2C6C A;  3HLP A;  5JGF A;  1HDQ A;  4NGT A;  3KQZ A;  3IO1 A;  3GPG A;  2XEJ A;  3SI2 A;  4NGM A;  4A39 A;  2BOA A;  3WC6 A;  4ZX9 A;  5HVG A;  2PJ5 A;  1VHO A;  3D66 A;  2ZEF A;  2Q43 A;  3MN8 A;  1Y0Y A;  3S9M A;  2BCO A;  1FT7 A;  3IIB A;  2PJ6 A;  3GLJ A;  2CTC A;  4MMO A;  2AFW A;  4K3N A;  1TKF A;  4OC2 A;  1M4L A;  5E3B A;  4ZX8 A;  2GRE A;  2ZEG A;  3D7H A;  4WWV A;  3SIH A;  4DJL A;  2JBJ A;  1F57 A;  4P4D A;  2JEW A;  3DGV A;  4NGN A;  4ZY2 A;  4ZYQ A;  3Q6Z A;  2RB7 A;  3IC1 A;  5ELY A;  4ABL A;  1OBR A;  1TF9 A;  3KGQ A;  5LYL A;  4UML A;  2PJB A;  1XMB A;  2GLJ A;  4PPZ A;  4EFD A;  3FMC A;  1LOK A;  1IGB A;  4J5R A;  4ZI6 A;  4NFR A;  3FVL A;  3NH4 A;  2PJA A;  4MCR A;  2PRQ A;  2C6P A;  4NGR A;  3PB7 X;  1VHU A;  3FJU A;  3PB6 X;  4GUA A;  1EE3 P;  5AIL A;  5THW A;  3KHX A;  4P4F A;  5FSY A;  4B6Z A;  4H2K A;  2WZN A;  3I1U A;  1QQ9 A;  4O23 A;  5CBM A;  3IWW A;  1XJO A;  3B3C A;  3EKE A;  2PJ0 A;  1CX8 A;  3JRU A;  4YWY A;  2FG1 A;  5K8M A;  4JGK A;  2FVG A;  4JVV A;  2Q51 A;  4TNU A;  1YW6 A;  4PXE A;  3NA6 A;  2LGR A;  3PFO A;  4OKO A;  4TU0 A;  4IQY A;  2IMO A;  4P45 A;  2J9A A;  2ZEE A;  4P6Y A;  5JH9 A;  3Q71 A;  3PB9 X;  2IQ6 A;  1R43 A;  4NGP A;  1PYT B;  4P4I A;  3V7Z A;  1YW4 A;  3GB0 A;  3GPQ A;  5LRJ A;  3PBE A;  3BI0 A;  5CB5 A;  2C1C A;  4ZY0 A;  5HOL A;  3H8F A;  3KHZ A;  4OIW A;  4OC0 A;  1GYT A;  3KZW A;  1AYE A;  1JQG A;  2V8D A;  5HIH A;  1CP6 A;  2V8H A;  2QVP A;  4P4J A;  3CPX A;  4P44 A;  4NJQ A;  4ONW A;  2EK9 A;  4MCQ A;  3IJ3 A;  3FED A;  4MHY A;  2AFX A;  4FWU A;  1Z5R A;  1FNO A;  3GQO A;  1XRY A;  1CBX A;  3ETI A;  4MHP A;  4PXB A;  3K9T A;  4RUH A;  3B3T A;  5K8N A;  1LCP A;  5I4M A;  1ZG8 A;  2GLF A;  2V77 A;  4ZY1 A;  1Y0R A;  2Q4Z A;  1BPM A;  4MXU A;  2ANP A;  4NJR A;  2ZEN A;  4Z65 A;  4JLL A;  4OC4 A;  1BLL E;  5FSU A;  4JZ0 A;  4GM5 A;  1HJZ A;  4R6T A;  3PB8 X;  3EJG A;  3TC8 A;  2POK A;  3HUV A;  3PBB A;  2F7V A;  4YU9 A;  1RTQ A;  2AFO A;  2OR4 A;  1LFW A;  2NYQ A;  4ETK A;  5K8P A;  1YLO A;  5FSV A;  1Y7E A;  4A94 A;  2PJ7 A;  1XBU A;  1F2O A;  4ESS A;  1AMP A;  4UEE A;  3RZA A;  4EME A;  4R8F A;  5HVF A;  5LYD A;  3ISZ A;  3B2Y A;  1TF8 A;  5DUS A;  3KAS A;  3PRT A;  8CPA A;  3S9L A;  5F09 A;  3IIF A;  4MHN A;  3FF3 A;  2AFU A;  4P10 A;  3H8G A;  3V45 A;  4IK2 A;  2O53 A;  3D7F A;  4WJB A;  3SI0 A;  2VRI A;  4GVV A;  3ISX A;  4BD9 A;  3NFZ A;  3L2N A;  4ABK A;  1VHE A;  3IFE A;  4UF4 A;  4R76 A;  4OID A;  1DE4 C;  2CF4 A;  4MCP A;  4GVW A;  3SJG A;  5IB9 A;  4D86 A;  4MRI A;  1IY7 A;  4F8Z A;  1R3N A;  1TY8 A;  2ZEM A;  3MRU A;  3LWU A;  3WC5 A;  3EJF A;  3RAM A;  4PXC A;  3B3V A;  3RBU A;  4JCA A;  3FEC A;  2ZEL A;  3FX6 A;  4KSI A;  3GQE A;  4OC1 A;  2XEI A;  2EEE A;  5FSZ A;  4OME A;  1ZLH A;  3SJX A;  1Q7L A;  1YD9 A;  1QMU A;  3KL9 A;  1UWY A;  4ETJ A;  1ELM P;  4FUU A;  3SJE A;  2ZOG A;  1NSA A;  1ZR3 A;  5K8O A;  1ZR5 A;  3EW5 A;  3EWO A;  4X8I A;  4DYO A;  4LQG A;  2PJ9 A;  3D4U A;  3D68 A;  3IEH A;  2IJZ A;  4A38 A;  3BI1 A;  5LYF A;  2ZEH A;  3TX8 A;  5HVH A;  3VAR A;  4J4Z A;  5FSX A;  3VAT A;  4TWE A;  1YME A;  3NH5 A;  3SIJ A;  2ZEP A;  4Q7A A;  1BPN A;  2CTB A;  2CIJ A;  4G1P A;  3KR4 A;  4X3R A;  3GPO A;  4J5S A;  3IID A;  4W9Y A;  3B3S A;  2DX6 A;  3EWR A;  4OC5 A;  5CPA A;  4UIB A;  3KQX A;  7CPA A;  6CPA A;  3WAB A;  2XEG A;  1ELL P;  3D67 A;  4FBE A;  1SPV A;  3WC7 A;  2XD7 A;  3N5F A;  3QNV A;  4F9V A;  3EWP A;  1ARM A;  3DLJ A;  1TXZ A;  2FAV A;  4MCS A;  4X2T A;  1CPX A;  3K2K A;  4EWT A;  3V2B A;  3SJF A;  2VL1 A;  3CDX A;  4AXV A;  1ARL A;  1NJR A;  4P4B A;  2L8R A;  1H8L A;  2I3C A;  4DUK A;  3CPA A;  1CPS A;  2ZEO A;  3CT9 A;  4NGS A;  2PJ3 A;  1PCA A;  5LRG A;  3H8E A;  2WYR A;  2ZOF A;  4MHZ A;  3JZT A;  4FAI A;  2X47 A;  4IAV A;  3KI9 A;  1LAN A;  1BAV A;  1TKJ A;  4OP4 A;  4P4E A;  2PVV A;  4F9U A;  1TXR A;  3B7I A;  2QYV A;  2GU2 A;  2PCU A;  2PJ1 A;  5D8N A;  2EWB A;  2AFS A;  4OC3 A;  4JYW A;  4PQA A;  1ZG9 A;  2BO9 A;  2XEF A;  2PVW A;  4CPA A;  2PIY A;  3EWQ A;  3D7D A;  1VIX A;  3VFQ A;  1HDU A;  4UIA A;  5D29 A;  2QJ8 A;  2DEA A;  1F2P A;  3SIG A;  3D7G A;  2PIZ A;  3SII A;  3BXM A;  5CB3 A;  2OOT A;  1Z2L A;  3SI1 A;  2V8G A;  3WT4 A;  5LRK A;  2FXK A;  4K0C A;  3FEE A;  1HEE A;  1TKH A;  4KYB A;  2PJ2 A;  2EK8 A;  5CMS A;  1Z8L A;  3PEI A;  2C6G A;  2BFQ A;  3FH4 A;  2PJ8 A;  2PJC A;  5JM6 A;  2RFH A;  2JBK A;  3T8W A;  2V8V A;  4R7M A;  2PJ4 A;  3S9N A;  5DS0 A;  1YSJ A;  2AFC A;  2AFZ A;  3VH9 A;  1KWM A;  5HXD A;  1CG2 A;  4IHM A;  2ABZ A;  2F8H A;  2NSM A;  3NH8 A;  2HC9 A;  2AFM A;  3LMS A;  2BFR A;  4J5Q A;  4UEZ A;  2G9D A;  4A37 A;  1CP7 A;  1DTD A;  1LAM A;  3GUX A; 
#chains in the Genus database with same CATH topology
 4CGL A;  2ZED A;  4C7I A;  2HV2 A;  1VGY A;  3B3W A;  1CM0 A;  2ARH A;  2K5T A;  1V0C A;  4NGQ A;  1PUA A;  4X5K A;  4PXD A;  4UFW A;  1LAP A;  2O4H A;  1RO5 A;  2R1I A;  3BJ7 A;  1ZLI A;  4KLV A;  5LYI A;  3ZZI A;  4BIN A;  1IIC A;  1ZG7 A;  2VBQ A;  2Z3P A;  2VQY A;  3GIU A;  3S6K A;  5J8F A;  4IUS A;  3V38 A;  3PB4 X;  2J8M A;  3BHX A;  2QEC A;  1Q2D A;  4U9Y A;  4UEF A;  4CS0 B;  5J1Q A;  3KR5 A;  3TT2 A;  3PFE A;  2ACF A;  2DF5 A;  1XFO A;  3B35 A;  4ORF A;  4U9Z A;  4C2Y A;  3TFY A;  2HB6 A;  1IU8 A;  1TIQ A;  2PE3 A;  3SHP A;  1OZP A;  5GCN A;  2C6C A;  2DPT A;  3HLP A;  3CZX A;  3D8P A;  3SXN A;  4JLY A;  5JGF A;  2WPW A;  4M6H A;  1HDQ A;  1IB1 E;  2EUI A;  3KQZ A;  3IO1 A;  3GPG A;  4NGT A;  1UFH A;  4UCM A;  4DNC A;  2XEJ A;  3SI2 A;  4NGM A;  4A39 A;  2BOA A;  5DWM A;  4YFJ A;  3GY9 A;  3WC6 A;  4ZX9 A;  5HVG A;  2PJ5 A;  2ODF A;  5AG5 A;  1VHO A;  3D66 A;  2P6F A;  2ZEF A;  2Q43 A;  3MN8 A;  1Y0Y A;  2PR1 A;  2JZE A;  2BCO A;  3S9M A;  1FT7 A;  2YNC C;  2ZW4 A;  3IIB A;  2PJ6 A;  3GLJ A;  2CTC A;  4MMO A;  3W91 A;  2AFW A;  2B4D B;  4K3N A;  1TKF A;  4OC2 A;  1M4L A;  4CGO A;  2WCT A;  5E3B A;  4ZX8 A;  2CNT A;  2GRE A;  2ZEG A;  3FBU A;  1S5K A;  2Q7S A;  1P4N A;  1Y9W A;  3D7H A;  2WPX A;  3EC4 A;  3SIH A;  4WWV A;  4B5P A;  4DJL A;  2JBJ A;  3WR7 A;  1F57 A;  2EBJ A;  1GHE A;  3FB3 A;  4CYP A;  5F46 A;  4BMH A;  3F5B A;  3TO7 A;  5H86 A;  4P4D A;  2FSR A;  2JEW A;  1L0C A;  3JUW A;  3DGV A;  2WSA A;  4NGN A;  4ZY2 A;  4ZYQ A;  3Q6Z A;  2RB7 A;  2P6G A;  3IC1 A;  4Y49 C;  5EC4 A;  4ABL A;  1IYL A;  1OBR A;  5ELY A;  1TF9 A;  2ATR A;  3KGQ A;  4NEX A;  5A27 A;  5LYL A;  4UML A;  2RNK A;  2PJB A;  1XMB A;  2GLJ A;  4GXH A;  4PPZ A;  2YND A;  4EFD A;  1MK4 A;  3FMC A;  1LOK A;  1Z4R A;  4HNW B;  1IGB A;  4J5R A;  3E0K A;  4ZI6 A;  4NFR A;  4B10 A;  3FVL A;  3NH4 A;  3QAY A;  4HPS A;  2PJA A;  4MCR A;  2PRQ A;  2C6P A;  4NGR A;  3PB7 X;  3T90 A;  1VHU A;  1A2Z A;  3D3S A;  3FJU A;  3PB6 X;  4GUA A;  1EE3 P;  2VXK A;  2DXQ A;  4KOY A;  5EBV A;  2OB0 A;  5AIL A;  3D2M A;  5THW A;  4KVM E;  3KHX A;  4P4F A;  5FSY A;  2FCK A;  2YNE A;  4B6Z A;  3FXT A;  4MY0 A;  3TOB A;  2P0W A;  1Z8W A;  4H2K A;  2WZN A;  3I1U A;  1QQ9 A;  3SXO A;  4O23 A;  5CBM A;  3IWW A;  2DPS A;  2GIV A;  1XJO A;  2PR8 A;  4HNX B;  3B3C A;  3EKE A;  2O28 A;  1QSN A;  4PK3 A;  2PJ0 A;  1CX8 A;  3R96 A;  3JRU A;  3R1K A;  1PU9 A;  4H6U A;  3C26 A;  4JJX A;  4YWY A;  2FG1 A;  3VWE A;  4JGK A;  4A95 A;  5K8M A;  4PV6 A;  2Q4V A;  2FVG A;  2FS5 A;  4JVV A;  4AG7 A;  3NE8 A;  2Q51 A;  2QML A;  3QAH A;  4TNU A;  1YW6 A;  1Q2C A;  2REE A;  3NA6 A;  4PXE A;  2LGR A;  3D2P A;  3TO6 A;  3PFO A;  3RO0 A;  4KUB A;  2JLM A;  4OKO A;  4TU0 A;  4IQY A;  2IMO A;  4P45 A;  4UWI A;  3TCV A;  4KOV A;  2J9A A;  2ZEE A;  4P6Y A;  4E0A A;  2OH1 A;  5JH9 A;  3Q71 A;  3PB9 X;  4L8A A;  1XIX A;  2IQ6 A;  1R43 A;  4NGP A;  4F0X A;  4R3L A;  2CNS A;  1PYT B;  3G3S A;  2FE7 A;  5AG7 A;  4P4I A;  3V7Z A;  1KUV A;  1YW4 A;  3GB0 A;  3GPQ A;  4R57 A;  4CGN A;  2F5I A;  5F49 A;  5LRJ A;  2IL4 A;  3PBE A;  4M6G A;  3TOA A;  1BOB A;  3BI0 A;  5CB5 A;  2C1C A;  3T9Y A;  1WK4 A;  4ZY0 A;  5KTD A;  5HOL A;  4MHD A;  3H8F A;  2PDO A;  2OZU A;  3KHZ A;  4H89 A;  1YRE A;  4OIW A;  4OC0 A;  4CYN A;  1GYT A;  3KZW A;  4QUS A;  1AYE A;  1JQG A;  2V8D A;  5HIH A;  4UBR A;  4CAE A;  5IV0 A;  3P2F A;  1CP6 A;  2B3V A;  4MFK A;  2V8H A;  2QVP A;  3QB8 A;  1Z9U A;  4P4J A;  4C2Z A;  1VHS A;  3CPX A;  4MBU A;  4P44 A;  2EVN A;  4NJQ A;  4Y49 B;  4ONW A;  2EK9 A;  2Z11 A;  3PZJ A;  4MCQ A;  1XOV A;  3IJ3 A;  3FED A;  4MHY A;  2I00 A;  2FT0 A;  2AFX A;  4E2A A;  4BBH A;  4FWU A;  1Z5R A;  4HNY B;  4UWJ A;  1FNO A;  3GQO A;  1S7N A;  1XRY A;  1CBX A;  1X10 A;  1S7L A;  3S6H A;  4UFX A;  3ETI A;  1Y9K A;  1R57 A;  1ZO0 A;  3CXQ A;  4MHP A;  4PXB A;  3K9T A;  4RUH A;  3B3T A;  5K8N A;  4FD7 A;  3I3G A;  3FYN A;  1LCP A;  4HKF A;  5I4M A;  1ZG8 A;  2GLF A;  2V77 A;  4AVB A;  1SQH A;  3EY5 A;  3JVN A;  4RI1 A;  4ZY1 A;  5G22 A;  1Y0R A;  2Q4Z A;  4A2Z A;  1BPM A;  4MFP A;  4MXU A;  4ZGY B;  2ANP A;  4C7H A;  1YVO A;  4B13 A;  4NJR A;  4KOW A;  2ZEN A;  3G8W A;  3H4Q A;  3R95 A;  2WUU A;  4OAE A;  4Z65 A;  4JLL A;  4MFL A;  4OC4 A;  1BLL E;  5FSU A;  2Q7B A;  5A28 A;  1S7K A;  2G0B A;  2Q04 A;  3KKW A;  4UCP A;  4JZ0 A;  5DWN A;  4GM5 A;  4KVO E;  1HJZ A;  3EO4 A;  2OZH A;  4CAF A;  4R6T A;  4R3K A;  1Y7R A;  3PB8 X;  4MFZ A;  3EJG A;  2FIA A;  2POK A;  3TC8 A;  4QVT A;  4R87 A;  4B11 A;  2VEZ A;  3HUV A;  4YRH A;  1CJW A;  4GS4 A;  3PBB A;  2F7V A;  4YU9 A;  1RTQ A;  2AFO A;  2OR4 A;  1LFW A;  2ZW5 A;  2NYQ A;  4ETK A;  5K8P A;  1YLO A;  1M4D A;  2I79 A;  5FSV A;  4U5Y A;  1XEB A;  4QC6 A;  1Y7E A;  4PSW A;  4A94 A;  2PJ7 A;  1XBU A;  1F2O A;  2FIW A;  4ESS A;  4NCZ A;  3IU1 A;  4B5P B;  1AMP A;  2RC4 A;  1IOI A;  2Z3N A;  2R8V A;  4UEE A;  1XMT A;  1K4J A;  3RZA A;  1QSO A;  4EME A;  2R7H A;  4JWP A;  1J4J A;  2PC1 A;  4R8F A;  2Q0Y A;  2PQ8 A;  4ONU A;  5HVF A;  1M1D A;  5LYD A;  3ISZ A;  3UY5 A;  2Z0Z A;  3B2Y A;  1TF8 A;  5DUS A;  3KAS A;  3PRT A;  8CPA A;  3S9L A;  3EFA A;  5F09 A;  4QB9 A;  2Z10 A;  3IIF A;  1BO4 A;  5FVJ A;  4MHN A;  3FF3 A;  2AFU A;  4P10 A;  4MFQ A;  5KTA A;  3H8G A;  3N7Z A;  2HQY A;  1QST A;  4UFV A;  2VI7 A;  3V45 A;  4IK2 A;  2O53 A;  5CNP A;  4KOR A;  1Z8X A;  3D7F A;  2GE3 A;  4KLW A;  4WJB A;  3SI0 A;  2VRI A;  4GVV A;  3ISX A;  4BD9 A;  3NFZ A;  2J8R A;  1N71 A;  2VZZ A;  3L2N A;  4ABK A;  3PP9 A;  2OZG A;  1VHE A;  2BL1 A;  3CXS A;  3IFE A;  4UF4 A;  4R76 A;  2EO8 A;  2KCW A;  4OID A;  1DE4 C;  4A31 A;  2CF4 A;  3GKR A;  4MCP A;  4GVW A;  4ZBG A;  3SJG A;  4M3S A;  5IB9 A;  1VKC A;  4D86 A;  1IOF A;  2B3U A;  4B12 A;  4MRI A;  2Z3O A;  1B6B A;  3NE7 A;  1IY7 A;  4F8Z A;  1R3N A;  1TY8 A;  1U6M A;  1YX0 A;  3F8K A;  3W6X A;  4KOS A;  2ZEM A;  3MRU A;  4Q36 A;  5AGE A;  2C27 A;  3VWD A;  3LWU A;  3WC5 A;  3EJF A;  3RAM A;  4RS2 A;  5BWA B;  4PXC A;  3B3V A;  4CYQ A;  2PSW A;  3RBU A;  4JCA A;  3LAC A;  3FEC A;  2ZEL A;  2D4P A;  3FX6 A;  3GQE A;  4KSI A;  4OC1 A;  5JPH A;  2W2G A;  2XEI A;  2EEE A;  5FSZ A;  1YQE A;  4OLL A;  4OME A;  4CYO A;  5E96 A;  1ZLH A;  2ZPA A;  3RNZ A;  3SJX A;  3W6S A;  2J8N A;  4XNH C;  1Q7L A;  2PRB A;  2REF A;  1YD9 A;  1QMU A;  1B87 A;  3KL9 A;  1Z8T A;  5G1Z A;  1UWY A;  1LRZ A;  4ETJ A;  1ELM P;  4FUU A;  2QIR A;  3FRM A;  4XPL A;  3B8G A;  3SJE A;  2ZOG A;  4NXY A;  1NSA A;  1ZR3 A;  1Z4E A;  4A33 A;  1IYK A;  4A32 A;  4R9M A;  1Q2Y A;  2D4O A;  5K8O A;  4M85 A;  1ZR5 A;  4XPD C;  3EW5 A;  3EWO A;  5JQ4 A;  1M44 A;  4X8I A;  4F0Y A;  4DYO A;  2KQV A;  2B58 A;  5HH1 A;  4LQG A;  2PJ9 A;  3P2H A;  3TE4 A;  3D4U A;  2GAN A;  5KTC A;  3D68 A;  3IEH A;  2IJZ A;  4AVA A;  5IB0 A;  4Q38 A;  3BI1 A;  4A38 A;  4YGO A;  1JWQ A;  4B14 A;  5LYF A;  3OWC A;  2ZEH A;  1FY7 A;  1I12 A;  3TX8 A;  4J4Z A;  4FD5 A;  3VAR A;  5HVH A;  2BEI A;  5FSX A;  3VAT A;  2VZY A;  4TWE A;  1YME A;  3NH5 A;  3SIJ A;  2ZEP A;  2FL4 A;  4I49 A;  4KOT A;  1XF8 A;  4Q7A A;  1BPN A;  2CTB A;  2CIJ A;  4G1P A;  4MY3 A;  3KR4 A;  2BUE A;  4X3R A;  3GPO A;  4J5S A;  3IID A;  2JZD A;  4M6I A;  4W9Y A;  2B5G A;  3R9F A;  4QBJ A;  3B3S A;  1IID A;  2DX6 A;  3EWR A;  3IGR A;  4LX9 A;  4OC5 A;  4MFJ A;  4UIB A;  5CPA A;  3KQX A;  5AG4 A;  3A9L A;  6CPA A;  7CPA A;  4H6Z A;  3WAB A;  4A30 A;  5I0C A;  5IX3 A;  2XEG A;  1YLE A;  1P0H A;  1MJB A;  1ELL P;  4FD4 A;  3D67 A;  4FBE A;  4UA3 A;  1SPV A;  2B4D A;  3WC7 A;  2XD7 A;  3N5F A;  3QNV A;  4F9V A;  1WWZ A;  4JXQ A;  3EWP A;  1ARM A;  3DLJ A;  1TXZ A;  2FAV A;  2B4B A;  1S7F A;  2B5G B;  1XE4 A;  3FNC A;  2HUZ A;  3DR8 A;  4CRZ B;  4CGP A;  2JZF A;  1QSM A;  1RXT A;  5AG6 A;  4MCS A;  4NF1 A;  4C68 A;  4X2T A;  1CPX A;  1M4G A;  3K2K A;  3IU2 A;  5F48 A;  3V2B A;  2G3T A;  2Z3K A;  4C2X A;  3SJF A;  2VL1 A;  3CDX A;  4EWT A;  4KSF A;  4AXV A;  1ARL A;  1NJR A;  4P4B A;  2L8R A;  1H8L A;  1S3Z A;  2I3C A;  3CPA A;  1CPS A;  2ZEO A;  3CT9 A;  4KS9 A;  3DSB A;  4DUK A;  5ISV A;  4NGS A;  2PJ3 A;  1PCA A;  4CGM A;  4KSA A;  5LRG A;  3H8E A;  2WYR A;  2ZOF A;  4MHZ A;  3BLN A;  1YR0 A;  3JZT A;  3K9U A;  4FAI A;  2X47 A;  4IAV A;  2FXF A;  1KUX A;  4XNH B;  2Q44 A;  1X12 A;  1LAN A;  1BAV A;  3KI9 A;  1TKJ A;  4OP4 A;  4P4E A;  4UCN A;  2PVV A;  1NE9 A;  2OU2 A;  1KZF A;  2GFQ A;  2Z3M A;  3IWE A;  4XPK A;  5EMI A;  5F47 A;  4F9U A;  4J3G A;  1TXR A;  4II9 A;  3B7I A;  2QYV A;  3DDD A;  2NMT A;  2GU2 A;  4CAX A;  2PCU A;  2PJ1 A;  5D8N A;  2Y0M A;  3GUX A;  4JD6 A;  4MJ8 A;  3V8I A;  4LQ6 A;  2EWB A;  2AFS A;  4OC3 A;  5G20 A;  5C82 A;  4JYW A;  4PQA A;  4KOX A;  1ZG9 A;  5C88 A;  2BO9 A;  2XEF A;  2PVW A;  3JTK A;  4CPA A;  1M4I A;  2PIY A;  3I9S A;  3EWQ A;  3LD2 A;  4K30 A;  4XPD B;  4B5O A;  3D7D A;  4LUA A;  4KOU A;  1VIX A;  3VFQ A;  1HDU A;  4IF5 A;  4EVY A;  3CXP A;  5G21 A;  4UIA A;  5D29 A;  5J8C A;  2QJ8 A;  2DEA A;  1KUY A;  1F2P A;  3SIG A;  3D7G A;  4AG9 A;  2PIZ A;  2ZXV A;  3DR6 A;  2AJ6 A;  3SII A;  4NSQ A;  3BXM A;  4CRY B;  4RN7 A;  3LOD A;  5CB3 A;  3S6F A;  3EXN A;  1I21 A;  2X7B A;  2OOT A;  1Z2L A;  1MJA A;  2A4N A;  2JEV A;  2V8G A;  3SI1 A;  3WT4 A;  5LRK A;  2FXK A;  1AUG A;  4K0C A;  2ZW6 A;  1HEE A;  1YGH A;  1TKH A;  2CXA A;  2Q4Y A;  4KYB A;  3FEE A;  3IWG A;  3R9G A;  2PJ2 A;  2EK8 A;  5CMS A;  3GYA A;  1Z8L A;  3S6G A;  3RYO A;  2ZW7 A;  3PEI A;  2C6G A;  2BFQ A;  2R98 A;  3FH4 A;  3ZJ0 A;  2PJ8 A;  2PJC A;  1I1D A;  3F0A A;  5JM6 A;  2RFH A;  3R9E A;  2JBK A;  3T8W A;  2V8V A;  4R7M A;  2PJ4 A;  1NSL A;  4KZT A;  2Z3L A;  5DS0 A;  3S9N A;  2JDD A;  1YSJ A;  2AFC A;  3PGP A;  4PSX A;  4E8O A;  2AFZ A;  3VH9 A;  1KWM A;  3DNS A;  5HXD A;  1CG2 A;  4KVX A;  2YNC A;  4AVC A;  4CAW A;  4IHM A;  2ABZ A;  2F8H A;  2NSM A;  3NH8 A;  4AB7 A;  2HC9 A;  4JXR A;  3TO9 A;  4MI4 A;  2AFM A;  3TTH A;  3LMS A;  1MJ9 A;  1QSR A;  2BFR A;  5HMN A;  4CAV A;  1ON0 A;  4L89 A;  1YK3 A;  4OAD A;  4J5Q A;  1YVK A;  4UEZ A;  2JDC A;  4F6A A;  5H84 A;  1S60 A;  2G9D A;  2H5M A;  2P6E A;  4A37 A;  2CY2 A;  4KUA A;  2YGW A;  1CP7 A;  1DTD A;  1NMT A;  1LAM A;  2BSW A;  2CNM A;  3BJ8 A;  2G3A A;  3FIX A;  4PK2 A;  2AE6 A;  3H5Z A;  4FD6 A;  3MGD A; 
#chains in the Genus database with same CATH homology
 2ZED A;  1VGY A;  3B3W A;  4NGQ A;  4PXD A;  1LAP A;  2O4H A;  1ZLI A;  5LYI A;  1ZG7 A;  3V38 A;  3PB4 X;  3BHX A;  5J1Q A;  4UEF A;  3KR5 A;  3PFE A;  2ACF A;  3B35 A;  1XFO A;  2HB6 A;  2PE3 A;  2C6C A;  3HLP A;  5JGF A;  1HDQ A;  4NGT A;  3KQZ A;  3IO1 A;  3GPG A;  2XEJ A;  3SI2 A;  4NGM A;  4A39 A;  2BOA A;  3WC6 A;  4ZX9 A;  5HVG A;  2PJ5 A;  1VHO A;  3D66 A;  2ZEF A;  2Q43 A;  3MN8 A;  1Y0Y A;  3S9M A;  2BCO A;  1FT7 A;  3IIB A;  2PJ6 A;  3GLJ A;  2CTC A;  4MMO A;  2AFW A;  4K3N A;  1TKF A;  4OC2 A;  1M4L A;  5E3B A;  4ZX8 A;  2GRE A;  2ZEG A;  3D7H A;  4WWV A;  3SIH A;  4DJL A;  2JBJ A;  1F57 A;  4P4D A;  2JEW A;  3DGV A;  4NGN A;  4ZY2 A;  4ZYQ A;  3Q6Z A;  2RB7 A;  3IC1 A;  5ELY A;  4ABL A;  1OBR A;  1TF9 A;  3KGQ A;  5LYL A;  4UML A;  2PJB A;  1XMB A;  2GLJ A;  4PPZ A;  4EFD A;  3FMC A;  1LOK A;  1IGB A;  4J5R A;  4ZI6 A;  4NFR A;  3FVL A;  3NH4 A;  2PJA A;  4MCR A;  2PRQ A;  2C6P A;  4NGR A;  3PB7 X;  1VHU A;  3FJU A;  3PB6 X;  4GUA A;  1EE3 P;  5AIL A;  5THW A;  3KHX A;  4P4F A;  5FSY A;  4B6Z A;  4H2K A;  2WZN A;  3I1U A;  1QQ9 A;  4O23 A;  5CBM A;  3IWW A;  1XJO A;  3B3C A;  3EKE A;  2PJ0 A;  1CX8 A;  3JRU A;  4YWY A;  2FG1 A;  5K8M A;  4JGK A;  2FVG A;  4JVV A;  2Q51 A;  4TNU A;  1YW6 A;  4PXE A;  3NA6 A;  2LGR A;  3PFO A;  4OKO A;  4TU0 A;  4IQY A;  2IMO A;  4P45 A;  2J9A A;  2ZEE A;  4P6Y A;  5JH9 A;  3Q71 A;  3PB9 X;  2IQ6 A;  1R43 A;  4NGP A;  1PYT B;  4P4I A;  3V7Z A;  1YW4 A;  3GB0 A;  3GPQ A;  5LRJ A;  3PBE A;  3BI0 A;  5CB5 A;  2C1C A;  4ZY0 A;  5HOL A;  3H8F A;  3KHZ A;  4OIW A;  4OC0 A;  1GYT A;  3KZW A;  1AYE A;  1JQG A;  2V8D A;  5HIH A;  1CP6 A;  2V8H A;  2QVP A;  4P4J A;  3CPX A;  4P44 A;  4NJQ A;  4ONW A;  2EK9 A;  4MCQ A;  3IJ3 A;  3FED A;  4MHY A;  2AFX A;  4FWU A;  1Z5R A;  1FNO A;  3GQO A;  1XRY A;  1CBX A;  3ETI A;  4MHP A;  4PXB A;  3K9T A;  4RUH A;  3B3T A;  5K8N A;  1LCP A;  5I4M A;  1ZG8 A;  2GLF A;  2V77 A;  4ZY1 A;  1Y0R A;  2Q4Z A;  1BPM A;  4MXU A;  2ANP A;  4NJR A;  2ZEN A;  4Z65 A;  4JLL A;  4OC4 A;  1BLL E;  5FSU A;  4JZ0 A;  4GM5 A;  1HJZ A;  4R6T A;  3PB8 X;  3EJG A;  3TC8 A;  2POK A;  3HUV A;  3PBB A;  2F7V A;  4YU9 A;  1RTQ A;  2AFO A;  2OR4 A;  1LFW A;  2NYQ A;  4ETK A;  5K8P A;  1YLO A;  5FSV A;  1Y7E A;  4A94 A;  2PJ7 A;  1XBU A;  1F2O A;  4ESS A;  1AMP A;  4UEE A;  3RZA A;  4EME A;  4R8F A;  5HVF A;  5LYD A;  3ISZ A;  3B2Y A;  1TF8 A;  5DUS A;  3KAS A;  3PRT A;  8CPA A;  3S9L A;  5F09 A;  3IIF A;  4MHN A;  3FF3 A;  2AFU A;  4P10 A;  3H8G A;  3V45 A;  4IK2 A;  2O53 A;  3D7F A;  4WJB A;  3SI0 A;  2VRI A;  4GVV A;  3ISX A;  4BD9 A;  3NFZ A;  3L2N A;  4ABK A;  1VHE A;  3IFE A;  4UF4 A;  4R76 A;  4OID A;  1DE4 C;  2CF4 A;  4MCP A;  4GVW A;  3SJG A;  5IB9 A;  4D86 A;  4MRI A;  1IY7 A;  4F8Z A;  1R3N A;  1TY8 A;  2ZEM A;  3MRU A;  3LWU A;  3WC5 A;  3EJF A;  3RAM A;  4PXC A;  3B3V A;  3RBU A;  4JCA A;  3FEC A;  2ZEL A;  3FX6 A;  4KSI A;  3GQE A;  4OC1 A;  2XEI A;  2EEE A;  5FSZ A;  4OME A;  1ZLH A;  3SJX A;  1Q7L A;  1YD9 A;  1QMU A;  3KL9 A;  1UWY A;  4ETJ A;  1ELM P;  4FUU A;  3SJE A;  2ZOG A;  1NSA A;  1ZR3 A;  5K8O A;  1ZR5 A;  3EW5 A;  3EWO A;  4X8I A;  4DYO A;  4LQG A;  2PJ9 A;  3D4U A;  3D68 A;  3IEH A;  2IJZ A;  4A38 A;  3BI1 A;  5LYF A;  2ZEH A;  3TX8 A;  5HVH A;  3VAR A;  4J4Z A;  5FSX A;  3VAT A;  4TWE A;  1YME A;  3NH5 A;  3SIJ A;  2ZEP A;  4Q7A A;  1BPN A;  2CTB A;  2CIJ A;  4G1P A;  3KR4 A;  4X3R A;  3GPO A;  4J5S A;  3IID A;  4W9Y A;  3B3S A;  2DX6 A;  3EWR A;  4OC5 A;  5CPA A;  4UIB A;  3KQX A;  7CPA A;  6CPA A;  3WAB A;  2XEG A;  1ELL P;  3D67 A;  4FBE A;  1SPV A;  3WC7 A;  2XD7 A;  3N5F A;  3QNV A;  4F9V A;  3EWP A;  1ARM A;  3DLJ A;  1TXZ A;  2FAV A;  4MCS A;  4X2T A;  1CPX A;  3K2K A;  4EWT A;  3V2B A;  3SJF A;  2VL1 A;  3CDX A;  4AXV A;  1ARL A;  1NJR A;  4P4B A;  2L8R A;  1H8L A;  2I3C A;  4DUK A;  3CPA A;  1CPS A;  2ZEO A;  3CT9 A;  4NGS A;  2PJ3 A;  1PCA A;  5LRG A;  3H8E A;  2WYR A;  2ZOF A;  4MHZ A;  3JZT A;  4FAI A;  2X47 A;  4IAV A;  3KI9 A;  1LAN A;  1BAV A;  1TKJ A;  4OP4 A;  4P4E A;  2PVV A;  4F9U A;  1TXR A;  3B7I A;  2QYV A;  2GU2 A;  2PCU A;  2PJ1 A;  5D8N A;  2EWB A;  2AFS A;  4OC3 A;  4JYW A;  4PQA A;  1ZG9 A;  2BO9 A;  2XEF A;  2PVW A;  4CPA A;  2PIY A;  3EWQ A;  3D7D A;  1VIX A;  3VFQ A;  1HDU A;  4UIA A;  5D29 A;  2QJ8 A;  2DEA A;  1F2P A;  3SIG A;  3D7G A;  2PIZ A;  3SII A;  3BXM A;  5CB3 A;  2OOT A;  1Z2L A;  3SI1 A;  2V8G A;  3WT4 A;  5LRK A;  2FXK A;  4K0C A;  3FEE A;  1HEE A;  1TKH A;  4KYB A;  2PJ2 A;  2EK8 A;  5CMS A;  1Z8L A;  3PEI A;  2C6G A;  2BFQ A;  3FH4 A;  2PJ8 A;  2PJC A;  5JM6 A;  2RFH A;  2JBK A;  3T8W A;  2V8V A;  4R7M A;  2PJ4 A;  3S9N A;  5DS0 A;  1YSJ A;  2AFC A;  2AFZ A;  3VH9 A;  1KWM A;  5HXD A;  1CG2 A;  4IHM A;  2ABZ A;  2F8H A;  2NSM A;  3NH8 A;  2HC9 A;  2AFM A;  3LMS A;  2BFR A;  4J5Q A;  4UEZ A;  2G9D A;  4A37 A;  1CP7 A;  1DTD A;  1LAM A;  3GUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...