4ZY1A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10r
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
519
structure length
518
Chain Sequence
b'ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable M17 family aminopeptidase
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
total genus 168
structure length 518
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zy1A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zy1A02
1CPSA 4GVVA 4ZY2A 2XEIA 5HVHA 4MCPA 4J5RA 3SIIA 1ZG9A 2Q51A 2AFWA 4UIAA 4FUUA 2PJ2A 1ZLHA 5FSXA 3PEIA 2PJ8A 4LQGA 5LYLA 3IIBA 2F8HA 1CBXA 4X2TA 2POKA 3B3CA 3D66A 2ZEDA 1ZG8A 1AYEA 2IJZA 4JLLA 3MN8A 3N5FA 3GLJA 3KGQA 4O23A 3WC5A 1H8LA 5DS0A 2WYRA 4R8FA 4KSIA 2FG1A 3FEDA 3NA6A 3EWQA 5FSUA 4NGRA 1PYTB 1M4LA 3WC6A 2ANPA 1HDUA 1XRYA 3EWRA 3WT4A 1ZG7A 3FMCA 2FAVA 1XMBA 3SIJA 5K8PA 3GQEA 4P10A 3GPQA 1ELMP 3SJFA 2OR4A 3B3TA 5CB3A 3D68A 4UMLA 3PB9X 4OC3A 4NGNA 5HOLA 2RFHA 4J4ZA 3CPXA 3QNVA 2AFXA 5IB9A 1ZLIA 3KR4A 2BOAA 3Q71A 5HIHA 1YLOA 3B2YA 1QQ9A 4MRIA 2O4HA 3EKEA 2XEGA 1HJZA 2ZEGA 3RAMA 1YSJA 5K8OA 1R3NA 4JGKA 2V8DA 2C1CA 4YU9A 4NGTA 5LYIA 1F2PA 3GPGA 4ZYQA 3D7DA 4A38A 2XD7A 2RB7A 3L2NA 5FSZA 3H8GA 2EK9A 2PJ0A 2PJCA 5AILA 4PXCA 1LFWA 3WC7A 4R7MA 4PXEA 3IIFA 2GLFA 3SI0A 2L8RA 3LMSA 4JYWA 1XBUA 3T8WA 3BXMA 3B7IA 5THWA 4Q7AA 3S9MA 4IHMA 4MMOA 3JRUA 4TU0A 3I1UA 1LAPA 3GUXA 1VGYA 4R6TA 1UWYA 3PBEA 5F09A 1HEEA 3BHXA 1R43A 1IY7A 3D7FA 3PRTA 2ZENA 3BI0A 4YWYA 1FNOA 3IIDA 1LAMA 4P6YA 1NJRA 5E3BA 2DX6A 3CPAA 5JGFA 3K9TA 3B35A 2PE3A 4IAVA 1PCAA 2PVWA 3PB8X 3V2BA 4JZ0A 5FSVA 1TKJA 4TNUA 4JVVA 4TWEA 1TXRA 3RZAA 3SI1A 1RTQA 4OC4A 4F9UA 3PB7X 4P4FA 3CDXA 4MHNA 5K8MA 1LANA 4PQAA 1NSAA 2PJ5A 2AFZA 4PPZA 2PJAA 4GVWA 2PJ4A 4J5QA 1TY8A 4JCAA 4A37A 2VL1A 1DE4C 4R76A 3B3VA 2ZEMA 2JBKA 4FWUA 2JBJA 3TC8A 3DGVA 7CPAA 3SIHA 3V45A 3VH9A 3HLPA 2C6GA 4EMEA 2ZOFA 1TF8A 2EEEA 4D86A 2AFOA 1DTDA 3IWWA 4MCRA 4BD9A 4UIBA 2QVPA 1TXZA 4MCSA 4UEFA 3K2KA 4FAIA 3IC1A 2PJ3A 3D67A 4OKOA 3FX6A 3NH8A 4ZX8A 2JEWA 3PB4X 2GU2A 3NH5A 1SPVA 3H8FA 4RUHA 4DJLA 4ESSA 3EWOA 3FJUA 4A39A 3S9NA 1BLLE 2J9AA 2ZOGA 4OC0A 5CPAA 2GLJA 3CT9A 2BO9A 4ZY1A 2V8GA 4OC5A 2F7VA 2AFCA 4UEZA 2Q43A 3KQZA 3NH4A 3GB0A 5HVFA 4OC2A 6CPAA 1Z2LA 1JQGA 1BPNA 2ZEFA 1CX8A 3KI9A 2FXKA 1LOKA 2EWBA 2BFRA 3FEEA 3GPOA 3HUVA 3PBBA 2ZEOA 4NFRA 4NGSA 3ETIA 4X3RA 3SJGA 1GYTA 1BPMA 2Q4ZA 4Z65A 4GM5A 4ZY0A 5LYDA 4K0CA 3EJFA 3D7GA 2ZEHA 5FSYA 1Y7EA 4MHPA 4P45A 3RBUA 2AFUA 5ELYA 3TX8A 5LRGA 3BI1A 4OP4A 2PRQA 1ARLA 2GREA 1FT7A 2DEAA 4OIDA 3JZTA 4GUAA 2CIJA 4EWTA 4ZX9A 4B6ZA 1XFOA 2QJ8A 3IO1A 2CTBA 3V7ZA 8CPAA 1Z8LA 4MHZA 2IQ6A 5DUSA 1BAVA 2PJBA 1CP7A 3FF3A 2ZEEA 5K8NA 3IFEA 3H8EA 4MCQA 4KYBA 1Z5RA 3MRUA 3EW5A 4ABKA 4UF4A 2V77A 4F8ZA 5LYFA 4F9VA 2C6CA 5D8NA 1VHEA 4NGMA 1Q7LA 2PJ7A 4CPAA 4P4BA 3WABA 1LCPA 1F57A 5JM6A 3FVLA 4NGQA 1YW6A 5CBMA 2NSMA 5CB5A 4NGPA 3S9LA 4DYOA 4DUKA 4IQYA 3LWUA 4FBEA 2QYVA 1Y0YA 4ABLA 1CP6A 4OIWA 5LRJA 4WWVA 3KZWA 2PIYA 1YD9A 3KQXA 4ETJA 1Y0RA 3IEHA 4ONWA 1YW4A 1F2OA 3GQOA 2I3CA 4P4EA 1AMPA 3EWPA 4H2KA 2O53A 4ZI6A 4EFDA 3FH4A 5LRKA 3D4UA 2ZEPA 2AFSA 2PVVA 5D29A 2ABZA 4WJBA 2AFMA 3B3WA 2EK8A 2V8HA 2VRIA 1ZR5A 3V38A 1OBRA 4AXVA 3KL9A 3EJGA 2NYQA 4A94A 1TKFA 1TKHA 1VIXA 1KWMA 4PXDA 2OOTA 4OMEA 3KASA 3DLJA 1CG2A 3SIGA 2FVGA 3D7HA 3IJ3A 2G9DA 1QMUA 4NJQA 2PIZA 3VATA 1ZR3A 5I4MA 1ARMA 5HVGA 5HXDA 4UEEA 2HC9A 5JH9A 3PFEA 3KHZA 2XEJA 4NJRA 1HDQA 2LGRA 1YMEA 2WZNA 4OC1A 3SJEA 4PXBA 4G1PA 2BCOA 3KR5A 2ZELA 1VHOA 2CF4A 2PJ9A 3ISZA 5J1QA 4X8IA 2BFQA 3SJXA 3PFOA 1VHUA 4P4JA 4ETKA 2X47A 3VFQA 2HB6A 2PJ6A 2PCUA 1IGBA 3SI2A 2ACFA 2IMOA 4W9YA 3Q6ZA 4K3NA 4MXUA 4J5SA 3FECA 2PJ1A 4IK2A 4P4DA 3VARA 4P44A 5CMSA 2C6PA 1CPXA 3PB6X 1ELLP 2V8VA 4MHYA 2XEFA 1XJOA 4P4IA 1EE3P 3ISXA 3KHXA 2CTCA 3B3SA 1TF9A 3NFZA
chains in the Genus database with same CATH superfamily
1CPSA 2ZW7A 4GVVA 5C82A 4FD7A 4CGOA 4ZY2A 4UFXA 2XEIA 4JLYA 5HVHA 1CM0A 4MCPA 3TO7A 4J5RA 4A95A 3SIIA 3BJ7A 1ZG9A 2Q51A 4JXRA 2AFWA 4UIAA 4FUUA 4GXHA 4CGPA 4E2AA 4R57A 3ZZIA 2PJ2A 1ZLHA 5FSXA 3PEIA 2PJ8A 4M6GA 4LQGA 4A31A 5LYLA 4MY3A 5I0CA 3DDDA 3BJ8A 2F8HA 1CBXA 3IIBA 4FD6A 2K5TA 2W2GA 4IUSA 4X2TA 1U6MA 2POKA 3B3CA 5EC4A 3S6GA 2HV2A 3RYOA 3D66A 2ZEDA 1ZG8A 1AYEA 2IJZA 4JLLA 3MN8A 4MI4A 3N5FA 3GLJA 1M4IA 2Q4YA 4KS9A 3KGQA 4O23A 4Y49B 3WC5A 1H8LA 3P2FA 5DS0A 2WYRA 4HPSA 3EXNA 4R8FA 4CYQA 2Q44A 4KSIA 2Z10A 2R8VA 2FG1A 2CNSA 3FEDA 3EWQA 5FSUA 3I9SA 3NA6A 1KUXA 4NGRA 3LD2A 1XIXA 1PYTB 1M4LA 3WC6A 4F0XA 2ANPA 1HDUA 2ATRA 1XRYA 3EWRA 2PDOA 3WT4A 4PSXA 1ZG7A 4I49A 4KZTA 5DWNA 5F47A 3EC4A 2PSWA 4CRZB 3FMCA 1YX0A 2FAVA 3G3SA 1XMBA 5G21A 2DXQA 1A2ZA 3SIJA 5K8PA 3IU2A 3GQEA 4P10A 3GPQA 1ELMP 2O28A 4UFVA 4KOYA 2QIRA 2OR4A 4MFPA 2OZHA 4XPLA 3SJFA 4AVCA 3EO4A 3VWDA 3B3TA 5CB3A 2B4DB 2Z3KA 2RC4A 3D68A 1AUGA 3C26A 3F0AA 5E96A 3TCVA 2CXAA 4UMLA 3PB9X 4F6AA 4QBJA 4OC3A 4KLVA 1P4NA 4NGNA 4B10A 1BO4A 2G0BA 2VI7A 1B87A 5HOLA 2RFHA 4J4ZA 3CPXA 3QNVA 2AFXA 5IB9A 1ZLIA 3KKWA 3KR4A 4NCZA 5IB0A 4UCMA 2BOAA 4H6UA 4A33A 3Q71A 3FXTA 5HIHA 1YLOA 3B2YA 2FE7A 4C2YA 2OB0A 1QQ9A 4B11A 4MRIA 2O4HA 3EKEA 2PRBA 2XEGA 1HJZA 2ZEGA 3RAMA 1YSJA 1JWQA 2GE3A 3S6FA 1R3NA 5K8OA 4JGKA 4MBUA 2V8DA 2C1CA 4YU9A 4NGTA 5CNPA 5FVJA 5LYIA 1F2PA 3GPGA 4ZYQA 3CXPA 3DSBA 3D7DA 4UWIA 4UCNA 4CYPA 5AG6A 4A38A 2XD7A 1Y9WA 2RB7A 3L2NA 5FSZA 2ZPAA 1XOVA 3H8GA 2EK9A 2PR8A 4AVAA 2PJ0A 1Z4EA 5AILA 2PJCA 4KOWA 4PXCA 2PQ8A 1S7FA 4U9ZA 1LFWA 3T9YA 3WC7A 4C2ZA 5AG4A 1NMTA 4R7MA 4PXEA 3SHPA 3IIFA 2GLFA 3SI0A 2L8RA 3LMSA 3NE8A 3ZJ0A 4JYWA 1XBUA 2Q7SA 2J8NA 2VXKA 2BUEA 3T8WA 3BXMA 3B7IA 5THWA 1MJBA 4Q7AA 3S9MA 4IHMA 4MMOA 3JRUA 4TU0A 1J4JA 3I1UA 3N7ZA 1QSNA 1LAPA 2IL4A 1VGYA 3GUXA 4R3LA 2F5IA 1IYKA 2OU2A 5IV0A 5JPHA 4R6TA 2FCKA 1N71A 4FD4A 3FB3A 1UWYA 3PBEA 5F09A 2B3VA 4HNWB 2ODFA 1IOIA 4IF5A 1Z4RA 1S5KA 2G3AA 1HEEA 3BHXA 4CAEA 1R43A 5KTAA 4YRHA 1IY7A 4II9A 3D7FA 3PRTA 2ZENA 3BI0A 4YWYA 1FNOA 3IIDA 1LAMA 2REEA 4P6YA 1NJRA 4U9YA 4K30A 3R9FA 5E3BA 2DX6A 2DPSA 3CPAA 5JGFA 3K9TA 2JLMA 3B35A 3UY5A 2PE3A 4IAVA 4XNHB 2KQVA 2D4PA 5H86A 1PCAA 2BEIA 2PVWA 3PB8X 3V2BA 4JZ0A 2D4OA 5FSVA 1TKJA 4TNUA 4AB7A 4JVVA 1KUVA 4CGNA 5BWAB 4TWEA 1TXRA 4UBRA 4L89A 4NXYA 4CAWA 3RZAA 3SI1A 1XF8A 5EBVA 1NSLA 1RTQA 1GHEA 4OC4A 1I21A 4F9UA 3PB7X 4P4FA 3CDXA 1WWZA 2AE6A 2H5MA 4MHNA 5G1ZA 5K8MA 1LANA 3P2HA 4PQAA 1QSOA 1NSAA 1YGHA 2PJ5A 4MFQA 2AFZA 4PPZA 4QC6A 2PJAA 4GVWA 2FL4A 2PJ4A 4J5QA 4J3GA 1TY8A 4JCAA 2ZW6A 3H5ZA 4A37A 1Z8TA 4RI1A 2VL1A 1DE4C 2R7HA 4CYNA 3EY5A 5F49A 4R76A 3B3VA 2ZEMA 1Z8XA 2JBKA 2JBJA 2CNTA 4FWUA 2Z3OA 4PV6A 5A27A 3TC8A 1QSTA 2EVNA 3DGVA 2PC1A 2VQYA 7CPAA 3TFYA 3SIHA 1VHSA 3V45A 3VH9A 1Q2YA 3HLPA 2C6GA 4EMEA 2ZOFA 1TF8A 2EEEA 1P0HA 2DPTA 4D86A 1IB1E 4C2XA 3V8IA 1IICA 1QSMA 2AFOA 1DTDA 1XEBA 1MJAA 1MK4A 3FIXA 3IWGA 3IWWA 4MCRA 4ONUA 4UIBA 4BD9A 2QVPA 2JZEA 4M6IA 1Q2DA 1TXZA 2Q7BA 4MCSA 4UEFA 3K2KA 4FAIA 3IC1A 4C7IA 2YNEA 2PJ3A 3F5BA 4KOSA 3D67A 4OKOA 3FX6A 2OH1A 3NH8A 4ZX8A 2JEWA 3PB4X 3G8WA 3LACA 2GU2A 3NH5A 4MFLA 1K4JA 3GY9A 1SPVA 3H8FA 4RUHA 2JZFA 4ESSA 4DJLA 5A28A 3EWOA 3FJUA 4A39A 1L0CA 1BLLE 2J9AA 2ZOGA 4OC0A 3PGPA 2GLJA 3CT9A 5CPAA 4E8OA 2BO9A 1UFHA 2GFQA 4ZY1A 4R3KA 2V8GA 2FIWA 4OC5A 2F7VA 2AFCA 4UEZA 2Q43A 3KQZA 3NH4A 4UWJA 4JWPA 3GB0A 5F48A 4OC2A 5HVFA 3R95A 3TT2A 6CPAA 1Z2LA 4OLLA 1JQGA 3JVNA 1BPNA 2ZEFA 4KOTA 4CGLA 2EO8A 3R96A 3RO0A 1CX8A 2ARHA 3KI9A 1XMTA 2FXKA 3D3SA 5G22A 4A30A 4CAXA 2NMTA 2OZGA 1LOKA 4B12A 5JQ4A 2A4NA 2EWBA 2BFRA 3FEEA 3GPOA 5GCNA 3FBUA 3HUVA 4B5OA 3PBBA 2ZEOA 4XPDC 2X7BA 4KVOE 3TOAA 2YNCA 4NFRA 4NGSA 5H84A 3FNCA 4KOXA 2JDDA 5IX3A 3ETIA 4GS4A 4X3RA 3SJGA 3TO9A 1GYTA 1BPMA 1XE4A 2Q4ZA 3IWEA 4ZY0A 4GM5A 2VEZA 5LYDA 4K0CA 3EJFA 3D7GA 2ZEHA 5FSYA 1Y7EA 4MHPA 4KSFA 4P45A 1Y7RA 4XPKA 1Z9UA 3RBUA 2EUIA 1BOBA 2AFUA 5ELYA 3TX8A 4Q36A 5LRGA 5C88A 3BI1A 4CYOA 4OP4A 2Z3LA 2GIVA 2GANA 4C68A 2PRQA 4NF1A 1RO5A 1ARLA 2GREA 2G3TA 2YNCC 4AVBA 1RXTA 4PK2A 5KTCA 1FT7A 2DEAA 4OIDA 4C7HA 3JZTA 4ZBGA 4GUAA 2BL1A 2CIJA 4ZX9A 4EWTA 4B6ZA 1XFOA 2B58A 4CGMA 2QJ8A 1YVOA 3CZXA 2CTBA 3IO1A 3V7ZA 2JEVA 4LUAA 1LRZA 8CPAA 1Z8LA 4MHZA 1YK3A 4KSAA 2B3UA 1X10A 2IQ6A 5DUSA 4JD6A 1BAVA 2DF5A 1ZO0A 2PJBA 2Q04A 1YVKA 1CP7A 2VBQA 3EFAA 3FF3A 2ZEEA 4ZGYB 5K8NA 4H89A 3IFEA 3H8EA 4MCQA 4KYBA 1Z5RA 3MRUA 3EW5A 4ABKA 4UF4A 2V77A 1IYLA 4QVTA 1IOFA 2Z3MA 4F8ZA 4KVXA 2B4DA 2Z0ZA 3LODA 5HMNA 5LYFA 2Z3NA 2P6GA 4OAEA 4B14A 2C6CA 2Q4VA 5D8NA 4F9VA 3S9NA 3S6HA 1VHEA 4XPDB 2FS5A 1Q7LA 2PJ7A 4NGMA 3S6KA 4P4BA 4CPAA 5KTDA 3WABA 1LCPA 1F57A 2P6EA 1FY7A 2REFA 5JM6A 4QB9A 3DR6A 3FVLA 4NGQA 4Z65A 3FYNA 1YLEA 3D2MA 1I12A 2R98A 4M85A 4MFJA 1YW6A 4YGOA 5CBMA 2NSMA 5CB5A 2Z3PA 4NGPA 4UCPA 3PZJA 3S9LA 4DYOA 2FSRA 4DUKA 4IQYA 3LWUA 2WPWA 2J8MA 4FBEA 2JDCA 2QYVA 1Y0YA 3QAYA 3JTKA 4JJXA 4ABLA 2WCTA 3F8KA 2RNKA 2FXFA 1CP6A 4F0YA 3NE7A 2FT0A 3T90A 4OIWA 5LRJA 4WWVA 2WPXA 3KZWA 2PIYA 1YD9A 3R1KA 3KQXA 4YFJA 4ETJA 1Y0RA 1B6BA 1QSRA 3IEHA 1YW4A 1F2OA 2WUUA 4ONWA 3QAHA 3R9GA 3PP9A 3GQOA 2I3CA 3GKRA 2Z11A 4P4EA 1X12A 2P0WA 4R87A 1AMPA 3EWPA 3D8PA 4FD5A 4E0AA 3E0KA 3CXSA 4H2KA 2O53A 4ZI6A 2R1IA 4EVYA 2ZW5A 4HNXB 2QMLA 4EFDA 4MY0A 3FH4A 3SXOA 5LRKA 2FIAA 4MFKA 3D4UA 2ZEPA 2AFSA 4B5PA 2PVVA 1M4GA 4NEXA 5D29A 2C27A 4M3SA 2ABZA 4WJBA 2JZDA 1I1DA 2AFMA 3B3WA 2EK8A 3IU1A 2B5GA 2V8HA 4U5YA 2VRIA 2BSWA 1ON0A 4Q38A 5G20A 3TE4A 4KOUA 1ZR5A 3V38A 1OBRA 4KVME 1Q2CA 3W91A 3TO6A 3TTHA 4AXVA 3A9LA 3B8GA 3KL9A 4CRYB 3EJGA 2VZZA 3DNSA 4CAFA 2NYQA 1PU9A 2I00A 1M1DA 4PSWA 4QUSA 4A94A 1TKFA 4B13A 4MFZA 3OWCA 1TKHA 2J8RA 2AJ6A 5J8CA 5AGEA 1VIXA 1KWMA 4PXDA 4OADA 1CJWA 4JXQA 2OOTA 4OMEA 3KASA 4PK3A 3DLJA 3IGRA 2ZW4A 1PUAA 4KUBA 1CG2A 3SIGA 4UA3A 1KZFA 2FVGA 3D7HA 3IJ3A 3GYAA 2G9DA 1QMUA 4NJQA 2PIZA 4HNYB 2HUZA 4NSQA 3VATA 1ZR3A 5ISVA 5I4MA 1ARMA 4M6HA 4MHDA 5HVGA 1VKCA 1WK4A 1SQHA 5EMIA 5HXDA 1Y9KA 4UEEA 3D2PA 2HC9A 4XNHC 4BBHA 4AG9A 5JH9A 3PFEA 4ORFA 3KHZA 4H6ZA 2Y0MA 4UFWA 2XEJA 4NJRA 1HDQA 2LGRA 2VZYA 4BMHA 1YMEA 2WZNA 4OC1A 4LQ6A 3SJEA 3CXQA 2YGWA 4G1PA 4PXBA 1OZPA 1TIQA 2BCOA 2WSAA 4KOVA 1NE9A 5DWMA 4BINA 3KR5A 2ZELA 1M4DA 1VHOA 2CF4A 5AG7A 2PJ9A 1S7NA 3ISZA 4L8AA 2Q0YA 5J1QA 1S3ZA 4X8IA 2BFQA 1Z8WA 3SJXA 3PFOA 1M44A 4MJ8A 1VHUA 4P4JA 1S7KA 1YR0A 2CNMA 4ETKA 2HQYA 2X47A 3VFQA 2HB6A 2KCWA 2PJ6A 3I3GA 3K9UA 2PCUA 3MGDA 2OZUA 1IGBA 3H4QA 1S7LA 3BLNA 3SI2A 2ACFA 1MJ9A 2QECA 4KORA 4DNCA 3DR8A 3GIUA 4Y49C 5F46A 4CS0B 2IMOA 4RS2A 4W9YA 4A32A 3Q6ZA 1KUYA 4K3NA 2CY2A 4J5SA 4MXUA 5AG5A 3FRMA 3WR7A 4B5PB 3FECA 1S60A 1YQEA 4A2ZA 2PJ1A 4CAVA 4IK2A 4P4DA 3VARA 1R57A 5CMSA 4P44A 2C6PA 1CPXA 3PB6X 4AG7A 2B5GB 4LX9A 1ELLP 3JUWA 4X5KA 3NFZA 2B4BA 3SXNA 2V8VA 4HKFA 4MHYA 2YNDA 4RN7A 2I79A 2XEFA 3QB8A 2EBJA 1XJOA 2P6FA 4P4IA 1IU8A 4KUAA 3R9EA 2ZXVA 3W6SA 4R9MA 1EE3P 1V0CA 4KLWA 3ISXA 1YREA 3KHXA 2CTCA 3B3SA 5HH1A 3RNZA 3VWEA 5J8FA 1TF9A 3W6XA 2PR1A 3TOBA 1IIDA
chains in the Genus database with same CATH topology
1CPSA 4GVVA 4ZY2A 2XEIA 5HVHA 4MCPA 4J5RA 3SIIA 1ZG9A 2Q51A 2AFWA 4UIAA 4FUUA 2PJ2A 1ZLHA 5FSXA 3PEIA 2PJ8A 4LQGA 5LYLA 3IIBA 2F8HA 1CBXA 4X2TA 2POKA 3B3CA 3D66A 2ZEDA 1ZG8A 1AYEA 2IJZA 4JLLA 3MN8A 3N5FA 3GLJA 3KGQA 4O23A 3WC5A 1H8LA 5DS0A 2WYRA 4R8FA 4KSIA 2FG1A 3FEDA 3NA6A 3EWQA 5FSUA 4NGRA 1PYTB 1M4LA 3WC6A 2ANPA 1HDUA 1XRYA 3EWRA 3WT4A 1ZG7A 3FMCA 2FAVA 1XMBA 3SIJA 5K8PA 3GQEA 4P10A 3GPQA 1ELMP 3SJFA 2OR4A 3B3TA 5CB3A 3D68A 4UMLA 3PB9X 4OC3A 4NGNA 5HOLA 2RFHA 4J4ZA 3CPXA 3QNVA 2AFXA 5IB9A 1ZLIA 3KR4A 2BOAA 3Q71A 5HIHA 1YLOA 3B2YA 1QQ9A 4MRIA 2O4HA 3EKEA 2XEGA 1HJZA 2ZEGA 3RAMA 1YSJA 5K8OA 1R3NA 4JGKA 2V8DA 2C1CA 4YU9A 4NGTA 5LYIA 1F2PA 3GPGA 4ZYQA 3D7DA 4A38A 2XD7A 2RB7A 3L2NA 5FSZA 3H8GA 2EK9A 2PJ0A 2PJCA 5AILA 4PXCA 1LFWA 3WC7A 4R7MA 4PXEA 3IIFA 2GLFA 3SI0A 2L8RA 3LMSA 4JYWA 1XBUA 3T8WA 3BXMA 3B7IA 5THWA 4Q7AA 3S9MA 4IHMA 4MMOA 3JRUA 4TU0A 3I1UA 1LAPA 3GUXA 1VGYA 4R6TA 1UWYA 3PBEA 5F09A 1HEEA 3BHXA 1R43A 1IY7A 3D7FA 3PRTA 2ZENA 3BI0A 4YWYA 1FNOA 3IIDA 1LAMA 4P6YA 1NJRA 5E3BA 2DX6A 3CPAA 5JGFA 3K9TA 3B35A 2PE3A 4IAVA 1PCAA 2PVWA 3PB8X 3V2BA 4JZ0A 5FSVA 1TKJA 4TNUA 4JVVA 4TWEA 1TXRA 3RZAA 3SI1A 1RTQA 4OC4A 4F9UA 3PB7X 4P4FA 3CDXA 4MHNA 5K8MA 1LANA 4PQAA 1NSAA 2PJ5A 2AFZA 4PPZA 2PJAA 4GVWA 2PJ4A 4J5QA 1TY8A 4JCAA 4A37A 2VL1A 1DE4C 4R76A 3B3VA 2ZEMA 2JBKA 4FWUA 2JBJA 3TC8A 3DGVA 7CPAA 3SIHA 3V45A 3VH9A 3HLPA 2C6GA 4EMEA 2ZOFA 1TF8A 2EEEA 4D86A 2AFOA 1DTDA 3IWWA 4MCRA 4BD9A 4UIBA 2QVPA 1TXZA 4MCSA 4UEFA 3K2KA 4FAIA 3IC1A 2PJ3A 3D67A 4OKOA 3FX6A 3NH8A 4ZX8A 2JEWA 3PB4X 2GU2A 3NH5A 1SPVA 3H8FA 4RUHA 4DJLA 4ESSA 3EWOA 3FJUA 4A39A 3S9NA 1BLLE 2J9AA 2ZOGA 4OC0A 5CPAA 2GLJA 3CT9A 2BO9A 4ZY1A 2V8GA 4OC5A 2F7VA 2AFCA 4UEZA 2Q43A 3KQZA 3NH4A 3GB0A 5HVFA 4OC2A 6CPAA 1Z2LA 1JQGA 1BPNA 2ZEFA 1CX8A 3KI9A 2FXKA 1LOKA 2EWBA 2BFRA 3FEEA 3GPOA 3HUVA 3PBBA 2ZEOA 4NFRA 4NGSA 3ETIA 4X3RA 3SJGA 1GYTA 1BPMA 2Q4ZA 4Z65A 4GM5A 4ZY0A 5LYDA 4K0CA 3EJFA 3D7GA 2ZEHA 5FSYA 1Y7EA 4MHPA 4P45A 3RBUA 2AFUA 5ELYA 3TX8A 5LRGA 3BI1A 4OP4A 2PRQA 1ARLA 2GREA 1FT7A 2DEAA 4OIDA 3JZTA 4GUAA 2CIJA 4EWTA 4ZX9A 4B6ZA 1XFOA 2QJ8A 3IO1A 2CTBA 3V7ZA 8CPAA 1Z8LA 4MHZA 2IQ6A 5DUSA 1BAVA 2PJBA 1CP7A 3FF3A 2ZEEA 5K8NA 3IFEA 3H8EA 4MCQA 4KYBA 1Z5RA 3MRUA 3EW5A 4ABKA 4UF4A 2V77A 4F8ZA 5LYFA 4F9VA 2C6CA 5D8NA 1VHEA 4NGMA 1Q7LA 2PJ7A 4CPAA 4P4BA 3WABA 1LCPA 1F57A 5JM6A 3FVLA 4NGQA 1YW6A 5CBMA 2NSMA 5CB5A 4NGPA 3S9LA 4DYOA 4DUKA 4IQYA 3LWUA 4FBEA 2QYVA 1Y0YA 4ABLA 1CP6A 4OIWA 5LRJA 4WWVA 3KZWA 2PIYA 1YD9A 3KQXA 4ETJA 1Y0RA 3IEHA 4ONWA 1YW4A 1F2OA 3GQOA 2I3CA 4P4EA 1AMPA 3EWPA 4H2KA 2O53A 4ZI6A 4EFDA 3FH4A 5LRKA 3D4UA 2ZEPA 2AFSA 2PVVA 5D29A 2ABZA 4WJBA 2AFMA 3B3WA 2EK8A 2V8HA 2VRIA 1ZR5A 3V38A 1OBRA 4AXVA 3KL9A 3EJGA 2NYQA 4A94A 1TKFA 1TKHA 1VIXA 1KWMA 4PXDA 2OOTA 4OMEA 3KASA 3DLJA 1CG2A 3SIGA 2FVGA 3D7HA 3IJ3A 2G9DA 1QMUA 4NJQA 2PIZA 3VATA 1ZR3A 5I4MA 1ARMA 5HVGA 5HXDA 4UEEA 2HC9A 5JH9A 3PFEA 3KHZA 2XEJA 4NJRA 1HDQA 2LGRA 1YMEA 2WZNA 4OC1A 3SJEA 4PXBA 4G1PA 2BCOA 3KR5A 2ZELA 1VHOA 2CF4A 2PJ9A 3ISZA 5J1QA 4X8IA 2BFQA 3SJXA 3PFOA 1VHUA 4P4JA 4ETKA 2X47A 3VFQA 2HB6A 2PJ6A 2PCUA 1IGBA 3SI2A 2ACFA 2IMOA 4W9YA 3Q6ZA 4K3NA 4MXUA 4J5SA 3FECA 2PJ1A 4IK2A 4P4DA 3VARA 4P44A 5CMSA 2C6PA 1CPXA 3PB6X 1ELLP 2V8VA 4MHYA 2XEFA 1XJOA 4P4IA 1EE3P 3ISXA 3KHXA 2CTCA 3B3SA 1TF9A 3NFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CPS A;  4GVV A;  4ZY2 A;  2XEI A;  5HVH A;  4MCP A;  4J5R A;  3SII A;  1ZG9 A;  2Q51 A;  2AFW A;  4UIA A;  4FUU A;  2PJ2 A;  1ZLH A;  5FSX A;  3PEI A;  2PJ8 A;  4LQG A;  5LYL A;  3IIB A;  2F8H A;  1CBX A;  4X2T A;  2POK A;  3B3C A;  3D66 A;  2ZED A;  1ZG8 A;  1AYE A;  2IJZ A;  4JLL A;  3MN8 A;  3N5F A;  3GLJ A;  3KGQ A;  4O23 A;  3WC5 A;  1H8L A;  5DS0 A;  2WYR A;  4R8F A;  4KSI A;  2FG1 A;  3FED A;  3NA6 A;  3EWQ A;  5FSU A;  4NGR A;  1PYT B;  1M4L A;  3WC6 A;  2ANP A;  1HDU A;  1XRY A;  3EWR A;  3WT4 A;  1ZG7 A;  3FMC A;  2FAV A;  1XMB A;  3SIJ A;  5K8P A;  3GQE A;  4P10 A;  3GPQ A;  1ELM P;  3SJF A;  2OR4 A;  3B3T A;  5CB3 A;  3D68 A;  4UML A;  3PB9 X;  4OC3 A;  4NGN A;  5HOL A;  2RFH A;  4J4Z A;  3CPX A;  3QNV A;  2AFX A;  5IB9 A;  1ZLI A;  3KR4 A;  2BOA A;  3Q71 A;  5HIH A;  1YLO A;  3B2Y A;  1QQ9 A;  4MRI A;  2O4H A;  3EKE A;  2XEG A;  1HJZ A;  2ZEG A;  3RAM A;  1YSJ A;  5K8O A;  1R3N A;  4JGK A;  2V8D A;  2C1C A;  4YU9 A;  4NGT A;  5LYI A;  1F2P A;  3GPG A;  4ZYQ A;  3D7D A;  4A38 A;  2XD7 A;  2RB7 A;  3L2N A;  5FSZ A;  3H8G A;  2EK9 A;  2PJ0 A;  2PJC A;  5AIL A;  4PXC A;  1LFW A;  3WC7 A;  4R7M A;  4PXE A;  3IIF A;  2GLF A;  3SI0 A;  2L8R A;  3LMS A;  4JYW A;  1XBU A;  3T8W A;  3BXM A;  3B7I A;  5THW A;  4Q7A A;  3S9M A;  4IHM A;  4MMO A;  3JRU A;  4TU0 A;  3I1U A;  1LAP A;  3GUX A;  1VGY A;  4R6T A;  1UWY A;  3PBE A;  5F09 A;  1HEE A;  3BHX A;  1R43 A;  1IY7 A;  3D7F A;  3PRT A;  2ZEN A;  3BI0 A;  4YWY A;  1FNO A;  3IID A;  1LAM A;  4P6Y A;  1NJR A;  5E3B A;  2DX6 A;  3CPA A;  5JGF A;  3K9T A;  3B35 A;  2PE3 A;  4IAV A;  1PCA A;  2PVW A;  3PB8 X;  3V2B A;  4JZ0 A;  5FSV A;  1TKJ A;  4TNU A;  4JVV A;  4TWE A;  1TXR A;  3RZA A;  3SI1 A;  1RTQ A;  4OC4 A;  4F9U A;  3PB7 X;  4P4F A;  3CDX A;  4MHN A;  5K8M A;  1LAN A;  4PQA A;  1NSA A;  2PJ5 A;  2AFZ A;  4PPZ A;  2PJA A;  4GVW A;  2PJ4 A;  4J5Q A;  1TY8 A;  4JCA A;  4A37 A;  2VL1 A;  1DE4 C;  4R76 A;  3B3V A;  2ZEM A;  2JBK A;  4FWU A;  2JBJ A;  3TC8 A;  3DGV A;  7CPA A;  3SIH A;  3V45 A;  3VH9 A;  3HLP A;  2C6G A;  4EME A;  2ZOF A;  1TF8 A;  2EEE A;  4D86 A;  2AFO A;  1DTD A;  3IWW A;  4MCR A;  4BD9 A;  4UIB A;  2QVP A;  1TXZ A;  4MCS A;  4UEF A;  3K2K A;  4FAI A;  3IC1 A;  2PJ3 A;  3D67 A;  4OKO A;  3FX6 A;  3NH8 A;  4ZX8 A;  2JEW A;  3PB4 X;  2GU2 A;  3NH5 A;  1SPV A;  3H8F A;  4RUH A;  4DJL A;  4ESS A;  3EWO A;  3FJU A;  4A39 A;  3S9N A;  1BLL E;  2J9A A;  2ZOG A;  4OC0 A;  5CPA A;  2GLJ A;  3CT9 A;  2BO9 A;  4ZY1 A;  2V8G A;  4OC5 A;  2F7V A;  2AFC A;  4UEZ A;  2Q43 A;  3KQZ A;  3NH4 A;  3GB0 A;  5HVF A;  4OC2 A;  6CPA A;  1Z2L A;  1JQG A;  1BPN A;  2ZEF A;  1CX8 A;  3KI9 A;  2FXK A;  1LOK A;  2EWB A;  2BFR A;  3FEE A;  3GPO A;  3HUV A;  3PBB A;  2ZEO A;  4NFR A;  4NGS A;  3ETI A;  4X3R A;  3SJG A;  1GYT A;  1BPM A;  2Q4Z A;  4Z65 A;  4GM5 A;  4ZY0 A;  5LYD A;  4K0C A;  3EJF A;  3D7G A;  2ZEH A;  5FSY A;  1Y7E A;  4MHP A;  4P45 A;  3RBU A;  2AFU A;  5ELY A;  3TX8 A;  5LRG A;  3BI1 A;  4OP4 A;  2PRQ A;  1ARL A;  2GRE A;  1FT7 A;  2DEA A;  4OID A;  3JZT A;  4GUA A;  2CIJ A;  4EWT A;  4ZX9 A;  4B6Z A;  1XFO A;  2QJ8 A;  3IO1 A;  2CTB A;  3V7Z A;  8CPA A;  1Z8L A;  4MHZ A;  2IQ6 A;  5DUS A;  1BAV A;  2PJB A;  1CP7 A;  3FF3 A;  2ZEE A;  5K8N A;  3IFE A;  3H8E A;  4MCQ A;  4KYB A;  1Z5R A;  3MRU A;  3EW5 A;  4ABK A;  4UF4 A;  2V77 A;  4F8Z A;  5LYF A;  4F9V A;  2C6C A;  5D8N A;  1VHE A;  4NGM A;  1Q7L A;  2PJ7 A;  4CPA A;  4P4B A;  3WAB A;  1LCP A;  1F57 A;  5JM6 A;  3FVL A;  4NGQ A;  1YW6 A;  5CBM A;  2NSM A;  5CB5 A;  4NGP A;  3S9L A;  4DYO A;  4DUK A;  4IQY A;  3LWU A;  4FBE A;  2QYV A;  1Y0Y A;  4ABL A;  1CP6 A;  4OIW A;  5LRJ A;  4WWV A;  3KZW A;  2PIY A;  1YD9 A;  3KQX A;  4ETJ A;  1Y0R A;  3IEH A;  4ONW A;  1YW4 A;  1F2O A;  3GQO A;  2I3C A;  4P4E A;  1AMP A;  3EWP A;  4H2K A;  2O53 A;  4ZI6 A;  4EFD A;  3FH4 A;  5LRK A;  3D4U A;  2ZEP A;  2AFS A;  2PVV A;  5D29 A;  2ABZ A;  4WJB A;  2AFM A;  3B3W A;  2EK8 A;  2V8H A;  2VRI A;  1ZR5 A;  3V38 A;  1OBR A;  4AXV A;  3KL9 A;  3EJG A;  2NYQ A;  4A94 A;  1TKF A;  1TKH A;  1VIX A;  1KWM A;  4PXD A;  2OOT A;  4OME A;  3KAS A;  3DLJ A;  1CG2 A;  3SIG A;  2FVG A;  3D7H A;  3IJ3 A;  2G9D A;  1QMU A;  4NJQ A;  2PIZ A;  3VAT A;  1ZR3 A;  5I4M A;  1ARM A;  5HVG A;  5HXD A;  4UEE A;  2HC9 A;  5JH9 A;  3PFE A;  3KHZ A;  2XEJ A;  4NJR A;  1HDQ A;  2LGR A;  1YME A;  2WZN A;  4OC1 A;  3SJE A;  4PXB A;  4G1P A;  2BCO A;  3KR5 A;  2ZEL A;  1VHO A;  2CF4 A;  2PJ9 A;  3ISZ A;  5J1Q A;  4X8I A;  2BFQ A;  3SJX A;  3PFO A;  1VHU A;  4P4J A;  4ETK A;  2X47 A;  3VFQ A;  2HB6 A;  2PJ6 A;  2PCU A;  1IGB A;  3SI2 A;  2ACF A;  2IMO A;  4W9Y A;  3Q6Z A;  4K3N A;  4MXU A;  4J5S A;  3FEC A;  2PJ1 A;  4IK2 A;  4P4D A;  3VAR A;  4P44 A;  5CMS A;  2C6P A;  1CPX A;  3PB6 X;  1ELL P;  2V8V A;  4MHY A;  2XEF A;  1XJO A;  4P4I A;  1EE3 P;  3ISX A;  3KHX A;  2CTC A;  3B3S A;  1TF9 A;  3NFZ A; 
#chains in the Genus database with same CATH topology
 1CPS A;  2ZW7 A;  4GVV A;  5C82 A;  4FD7 A;  4CGO A;  4ZY2 A;  4UFX A;  2XEI A;  4JLY A;  5HVH A;  1CM0 A;  4MCP A;  3TO7 A;  4J5R A;  4A95 A;  3SII A;  3BJ7 A;  1ZG9 A;  2Q51 A;  4JXR A;  2AFW A;  4UIA A;  4FUU A;  4GXH A;  4CGP A;  4E2A A;  4R57 A;  3ZZI A;  2PJ2 A;  1ZLH A;  5FSX A;  3PEI A;  2PJ8 A;  4M6G A;  4LQG A;  4A31 A;  5LYL A;  4MY3 A;  5I0C A;  3DDD A;  3BJ8 A;  2F8H A;  1CBX A;  3IIB A;  4FD6 A;  2K5T A;  2W2G A;  4IUS A;  4X2T A;  1U6M A;  2POK A;  3B3C A;  5EC4 A;  3S6G A;  2HV2 A;  3RYO A;  3D66 A;  2ZED A;  1ZG8 A;  1AYE A;  2IJZ A;  4JLL A;  3MN8 A;  4MI4 A;  3N5F A;  3GLJ A;  1M4I A;  2Q4Y A;  4KS9 A;  3KGQ A;  4O23 A;  4Y49 B;  3WC5 A;  1H8L A;  3P2F A;  5DS0 A;  2WYR A;  4HPS A;  3EXN A;  4R8F A;  4CYQ A;  2Q44 A;  4KSI A;  2Z10 A;  2R8V A;  2FG1 A;  2CNS A;  3FED A;  3EWQ A;  5FSU A;  3I9S A;  3NA6 A;  1KUX A;  4NGR A;  3LD2 A;  1XIX A;  1PYT B;  1M4L A;  3WC6 A;  4F0X A;  2ANP A;  1HDU A;  2ATR A;  1XRY A;  3EWR A;  2PDO A;  3WT4 A;  4PSX A;  1ZG7 A;  4I49 A;  4KZT A;  5DWN A;  5F47 A;  3EC4 A;  2PSW A;  4CRZ B;  3FMC A;  1YX0 A;  2FAV A;  3G3S A;  1XMB A;  5G21 A;  2DXQ A;  1A2Z A;  3SIJ A;  5K8P A;  3IU2 A;  3GQE A;  4P10 A;  3GPQ A;  1ELM P;  2O28 A;  4UFV A;  4KOY A;  2QIR A;  2OR4 A;  4MFP A;  2OZH A;  4XPL A;  3SJF A;  4AVC A;  3EO4 A;  3VWD A;  3B3T A;  5CB3 A;  2B4D B;  2Z3K A;  2RC4 A;  3D68 A;  1AUG A;  3C26 A;  3F0A A;  5E96 A;  3TCV A;  2CXA A;  4UML A;  3PB9 X;  4F6A A;  4QBJ A;  4OC3 A;  4KLV A;  1P4N A;  4NGN A;  4B10 A;  1BO4 A;  2G0B A;  2VI7 A;  1B87 A;  5HOL A;  2RFH A;  4J4Z A;  3CPX A;  3QNV A;  2AFX A;  5IB9 A;  1ZLI A;  3KKW A;  3KR4 A;  4NCZ A;  5IB0 A;  4UCM A;  2BOA A;  4H6U A;  4A33 A;  3Q71 A;  3FXT A;  5HIH A;  1YLO A;  3B2Y A;  2FE7 A;  4C2Y A;  2OB0 A;  1QQ9 A;  4B11 A;  4MRI A;  2O4H A;  3EKE A;  2PRB A;  2XEG A;  1HJZ A;  2ZEG A;  3RAM A;  1YSJ A;  1JWQ A;  2GE3 A;  3S6F A;  1R3N A;  5K8O A;  4JGK A;  4MBU A;  2V8D A;  2C1C A;  4YU9 A;  4NGT A;  5CNP A;  5FVJ A;  5LYI A;  1F2P A;  3GPG A;  4ZYQ A;  3CXP A;  3DSB A;  3D7D A;  4UWI A;  4UCN A;  4CYP A;  5AG6 A;  4A38 A;  2XD7 A;  1Y9W A;  2RB7 A;  3L2N A;  5FSZ A;  2ZPA A;  1XOV A;  3H8G A;  2EK9 A;  2PR8 A;  4AVA A;  2PJ0 A;  1Z4E A;  5AIL A;  2PJC A;  4KOW A;  4PXC A;  2PQ8 A;  1S7F A;  4U9Z A;  1LFW A;  3T9Y A;  3WC7 A;  4C2Z A;  5AG4 A;  1NMT A;  4R7M A;  4PXE A;  3SHP A;  3IIF A;  2GLF A;  3SI0 A;  2L8R A;  3LMS A;  3NE8 A;  3ZJ0 A;  4JYW A;  1XBU A;  2Q7S A;  2J8N A;  2VXK A;  2BUE A;  3T8W A;  3BXM A;  3B7I A;  5THW A;  1MJB A;  4Q7A A;  3S9M A;  4IHM A;  4MMO A;  3JRU A;  4TU0 A;  1J4J A;  3I1U A;  3N7Z A;  1QSN A;  1LAP A;  2IL4 A;  1VGY A;  3GUX A;  4R3L A;  2F5I A;  1IYK A;  2OU2 A;  5IV0 A;  5JPH A;  4R6T A;  2FCK A;  1N71 A;  4FD4 A;  3FB3 A;  1UWY A;  3PBE A;  5F09 A;  2B3V A;  4HNW B;  2ODF A;  1IOI A;  4IF5 A;  1Z4R A;  1S5K A;  2G3A A;  1HEE A;  3BHX A;  4CAE A;  1R43 A;  5KTA A;  4YRH A;  1IY7 A;  4II9 A;  3D7F A;  3PRT A;  2ZEN A;  3BI0 A;  4YWY A;  1FNO A;  3IID A;  1LAM A;  2REE A;  4P6Y A;  1NJR A;  4U9Y A;  4K30 A;  3R9F A;  5E3B A;  2DX6 A;  2DPS A;  3CPA A;  5JGF A;  3K9T A;  2JLM A;  3B35 A;  3UY5 A;  2PE3 A;  4IAV A;  4XNH B;  2KQV A;  2D4P A;  5H86 A;  1PCA A;  2BEI A;  2PVW A;  3PB8 X;  3V2B A;  4JZ0 A;  2D4O A;  5FSV A;  1TKJ A;  4TNU A;  4AB7 A;  4JVV A;  1KUV A;  4CGN A;  5BWA B;  4TWE A;  1TXR A;  4UBR A;  4L89 A;  4NXY A;  4CAW A;  3RZA A;  3SI1 A;  1XF8 A;  5EBV A;  1NSL A;  1RTQ A;  1GHE A;  4OC4 A;  1I21 A;  4F9U A;  3PB7 X;  4P4F A;  3CDX A;  1WWZ A;  2AE6 A;  2H5M A;  4MHN A;  5G1Z A;  5K8M A;  1LAN A;  3P2H A;  4PQA A;  1QSO A;  1NSA A;  1YGH A;  2PJ5 A;  4MFQ A;  2AFZ A;  4PPZ A;  4QC6 A;  2PJA A;  4GVW A;  2FL4 A;  2PJ4 A;  4J5Q A;  4J3G A;  1TY8 A;  4JCA A;  2ZW6 A;  3H5Z A;  4A37 A;  1Z8T A;  4RI1 A;  2VL1 A;  1DE4 C;  2R7H A;  4CYN A;  3EY5 A;  5F49 A;  4R76 A;  3B3V A;  2ZEM A;  1Z8X A;  2JBK A;  2JBJ A;  2CNT A;  4FWU A;  2Z3O A;  4PV6 A;  5A27 A;  3TC8 A;  1QST A;  2EVN A;  3DGV A;  2PC1 A;  2VQY A;  7CPA A;  3TFY A;  3SIH A;  1VHS A;  3V45 A;  3VH9 A;  1Q2Y A;  3HLP A;  2C6G A;  4EME A;  2ZOF A;  1TF8 A;  2EEE A;  1P0H A;  2DPT A;  4D86 A;  1IB1 E;  4C2X A;  3V8I A;  1IIC A;  1QSM A;  2AFO A;  1DTD A;  1XEB A;  1MJA A;  1MK4 A;  3FIX A;  3IWG A;  3IWW A;  4MCR A;  4ONU A;  4UIB A;  4BD9 A;  2QVP A;  2JZE A;  4M6I A;  1Q2D A;  1TXZ A;  2Q7B A;  4MCS A;  4UEF A;  3K2K A;  4FAI A;  3IC1 A;  4C7I A;  2YNE A;  2PJ3 A;  3F5B A;  4KOS A;  3D67 A;  4OKO A;  3FX6 A;  2OH1 A;  3NH8 A;  4ZX8 A;  2JEW A;  3PB4 X;  3G8W A;  3LAC A;  2GU2 A;  3NH5 A;  4MFL A;  1K4J A;  3GY9 A;  1SPV A;  3H8F A;  4RUH A;  2JZF A;  4ESS A;  4DJL A;  5A28 A;  3EWO A;  3FJU A;  4A39 A;  1L0C A;  1BLL E;  2J9A A;  2ZOG A;  4OC0 A;  3PGP A;  2GLJ A;  3CT9 A;  5CPA A;  4E8O A;  2BO9 A;  1UFH A;  2GFQ A;  4ZY1 A;  4R3K A;  2V8G A;  2FIW A;  4OC5 A;  2F7V A;  2AFC A;  4UEZ A;  2Q43 A;  3KQZ A;  3NH4 A;  4UWJ A;  4JWP A;  3GB0 A;  5F48 A;  4OC2 A;  5HVF A;  3R95 A;  3TT2 A;  6CPA A;  1Z2L A;  4OLL A;  1JQG A;  3JVN A;  1BPN A;  2ZEF A;  4KOT A;  4CGL A;  2EO8 A;  3R96 A;  3RO0 A;  1CX8 A;  2ARH A;  3KI9 A;  1XMT A;  2FXK A;  3D3S A;  5G22 A;  4A30 A;  4CAX A;  2NMT A;  2OZG A;  1LOK A;  4B12 A;  5JQ4 A;  2A4N A;  2EWB A;  2BFR A;  3FEE A;  3GPO A;  5GCN A;  3FBU A;  3HUV A;  4B5O A;  3PBB A;  2ZEO A;  4XPD C;  2X7B A;  4KVO E;  3TOA A;  2YNC A;  4NFR A;  4NGS A;  5H84 A;  3FNC A;  4KOX A;  2JDD A;  5IX3 A;  3ETI A;  4GS4 A;  4X3R A;  3SJG A;  3TO9 A;  1GYT A;  1BPM A;  1XE4 A;  2Q4Z A;  3IWE A;  4ZY0 A;  4GM5 A;  2VEZ A;  5LYD A;  4K0C A;  3EJF A;  3D7G A;  2ZEH A;  5FSY A;  1Y7E A;  4MHP A;  4KSF A;  4P45 A;  1Y7R A;  4XPK A;  1Z9U A;  3RBU A;  2EUI A;  1BOB A;  2AFU A;  5ELY A;  3TX8 A;  4Q36 A;  5LRG A;  5C88 A;  3BI1 A;  4CYO A;  4OP4 A;  2Z3L A;  2GIV A;  2GAN A;  4C68 A;  2PRQ A;  4NF1 A;  1RO5 A;  1ARL A;  2GRE A;  2G3T A;  2YNC C;  4AVB A;  1RXT A;  4PK2 A;  5KTC A;  1FT7 A;  2DEA A;  4OID A;  4C7H A;  3JZT A;  4ZBG A;  4GUA A;  2BL1 A;  2CIJ A;  4ZX9 A;  4EWT A;  4B6Z A;  1XFO A;  2B58 A;  4CGM A;  2QJ8 A;  1YVO A;  3CZX A;  2CTB A;  3IO1 A;  3V7Z A;  2JEV A;  4LUA A;  1LRZ A;  8CPA A;  1Z8L A;  4MHZ A;  1YK3 A;  4KSA A;  2B3U A;  1X10 A;  2IQ6 A;  5DUS A;  4JD6 A;  1BAV A;  2DF5 A;  1ZO0 A;  2PJB A;  2Q04 A;  1YVK A;  1CP7 A;  2VBQ A;  3EFA A;  3FF3 A;  2ZEE A;  4ZGY B;  5K8N A;  4H89 A;  3IFE A;  3H8E A;  4MCQ A;  4KYB A;  1Z5R A;  3MRU A;  3EW5 A;  4ABK A;  4UF4 A;  2V77 A;  1IYL A;  4QVT A;  1IOF A;  2Z3M A;  4F8Z A;  4KVX A;  2B4D A;  2Z0Z A;  3LOD A;  5HMN A;  5LYF A;  2Z3N A;  2P6G A;  4OAE A;  4B14 A;  2C6C A;  2Q4V A;  5D8N A;  4F9V A;  3S9N A;  3S6H A;  1VHE A;  4XPD B;  2FS5 A;  1Q7L A;  2PJ7 A;  4NGM A;  3S6K A;  4P4B A;  4CPA A;  5KTD A;  3WAB A;  1LCP A;  1F57 A;  2P6E A;  1FY7 A;  2REF A;  5JM6 A;  4QB9 A;  3DR6 A;  3FVL A;  4NGQ A;  4Z65 A;  3FYN A;  1YLE A;  3D2M A;  1I12 A;  2R98 A;  4M85 A;  4MFJ A;  1YW6 A;  4YGO A;  5CBM A;  2NSM A;  5CB5 A;  2Z3P A;  4NGP A;  4UCP A;  3PZJ A;  3S9L A;  4DYO A;  2FSR A;  4DUK A;  4IQY A;  3LWU A;  2WPW A;  2J8M A;  4FBE A;  2JDC A;  2QYV A;  1Y0Y A;  3QAY A;  3JTK A;  4JJX A;  4ABL A;  2WCT A;  3F8K A;  2RNK A;  2FXF A;  1CP6 A;  4F0Y A;  3NE7 A;  2FT0 A;  3T90 A;  4OIW A;  5LRJ A;  4WWV A;  2WPX A;  3KZW A;  2PIY A;  1YD9 A;  3R1K A;  3KQX A;  4YFJ A;  4ETJ A;  1Y0R A;  1B6B A;  1QSR A;  3IEH A;  1YW4 A;  1F2O A;  2WUU A;  4ONW A;  3QAH A;  3R9G A;  3PP9 A;  3GQO A;  2I3C A;  3GKR A;  2Z11 A;  4P4E A;  1X12 A;  2P0W A;  4R87 A;  1AMP A;  3EWP A;  3D8P A;  4FD5 A;  4E0A A;  3E0K A;  3CXS A;  4H2K A;  2O53 A;  4ZI6 A;  2R1I A;  4EVY A;  2ZW5 A;  4HNX B;  2QML A;  4EFD A;  4MY0 A;  3FH4 A;  3SXO A;  5LRK A;  2FIA A;  4MFK A;  3D4U A;  2ZEP A;  2AFS A;  4B5P A;  2PVV A;  1M4G A;  4NEX A;  5D29 A;  2C27 A;  4M3S A;  2ABZ A;  4WJB A;  2JZD A;  1I1D A;  2AFM A;  3B3W A;  2EK8 A;  3IU1 A;  2B5G A;  2V8H A;  4U5Y A;  2VRI A;  2BSW A;  1ON0 A;  4Q38 A;  5G20 A;  3TE4 A;  4KOU A;  1ZR5 A;  3V38 A;  1OBR A;  4KVM E;  1Q2C A;  3W91 A;  3TO6 A;  3TTH A;  4AXV A;  3A9L A;  3B8G A;  3KL9 A;  4CRY B;  3EJG A;  2VZZ A;  3DNS A;  4CAF A;  2NYQ A;  1PU9 A;  2I00 A;  1M1D A;  4PSW A;  4QUS A;  4A94 A;  1TKF A;  4B13 A;  4MFZ A;  3OWC A;  1TKH A;  2J8R A;  2AJ6 A;  5J8C A;  5AGE A;  1VIX A;  1KWM A;  4PXD A;  4OAD A;  1CJW A;  4JXQ A;  2OOT A;  4OME A;  3KAS A;  4PK3 A;  3DLJ A;  3IGR A;  2ZW4 A;  1PUA A;  4KUB A;  1CG2 A;  3SIG A;  4UA3 A;  1KZF A;  2FVG A;  3D7H A;  3IJ3 A;  3GYA A;  2G9D A;  1QMU A;  4NJQ A;  2PIZ A;  4HNY B;  2HUZ A;  4NSQ A;  3VAT A;  1ZR3 A;  5ISV A;  5I4M A;  1ARM A;  4M6H A;  4MHD A;  5HVG A;  1VKC A;  1WK4 A;  1SQH A;  5EMI A;  5HXD A;  1Y9K A;  4UEE A;  3D2P A;  2HC9 A;  4XNH C;  4BBH A;  4AG9 A;  5JH9 A;  3PFE A;  4ORF A;  3KHZ A;  4H6Z A;  2Y0M A;  4UFW A;  2XEJ A;  4NJR A;  1HDQ A;  2LGR A;  2VZY A;  4BMH A;  1YME A;  2WZN A;  4OC1 A;  4LQ6 A;  3SJE A;  3CXQ A;  2YGW A;  4G1P A;  4PXB A;  1OZP A;  1TIQ A;  2BCO A;  2WSA A;  4KOV A;  1NE9 A;  5DWM A;  4BIN A;  3KR5 A;  2ZEL A;  1M4D A;  1VHO A;  2CF4 A;  5AG7 A;  2PJ9 A;  1S7N A;  3ISZ A;  4L8A A;  2Q0Y A;  5J1Q A;  1S3Z A;  4X8I A;  2BFQ A;  1Z8W A;  3SJX A;  3PFO A;  1M44 A;  4MJ8 A;  1VHU A;  4P4J A;  1S7K A;  1YR0 A;  2CNM A;  4ETK A;  2HQY A;  2X47 A;  3VFQ A;  2HB6 A;  2KCW A;  2PJ6 A;  3I3G A;  3K9U A;  2PCU A;  3MGD A;  2OZU A;  1IGB A;  3H4Q A;  1S7L A;  3BLN A;  3SI2 A;  2ACF A;  1MJ9 A;  2QEC A;  4KOR A;  4DNC A;  3DR8 A;  3GIU A;  4Y49 C;  5F46 A;  4CS0 B;  2IMO A;  4RS2 A;  4W9Y A;  4A32 A;  3Q6Z A;  1KUY A;  4K3N A;  2CY2 A;  4J5S A;  4MXU A;  5AG5 A;  3FRM A;  3WR7 A;  4B5P B;  3FEC A;  1S60 A;  1YQE A;  4A2Z A;  2PJ1 A;  4CAV A;  4IK2 A;  4P4D A;  3VAR A;  1R57 A;  5CMS A;  4P44 A;  2C6P A;  1CPX A;  3PB6 X;  4AG7 A;  2B5G B;  4LX9 A;  1ELL P;  3JUW A;  4X5K A;  3NFZ A;  2B4B A;  3SXN A;  2V8V A;  4HKF A;  4MHY A;  2YND A;  4RN7 A;  2I79 A;  2XEF A;  3QB8 A;  2EBJ A;  1XJO A;  2P6F A;  4P4I A;  1IU8 A;  4KUA A;  3R9E A;  2ZXV A;  3W6S A;  4R9M A;  1EE3 P;  1V0C A;  4KLW A;  3ISX A;  1YRE A;  3KHX A;  2CTC A;  3B3S A;  5HH1 A;  3RNZ A;  3VWE A;  5J8F A;  1TF9 A;  3W6X A;  2PR1 A;  3TOB A;  1IID A; 
#chains in the Genus database with same CATH homology
 1CPS A;  4GVV A;  4ZY2 A;  2XEI A;  5HVH A;  4MCP A;  4J5R A;  3SII A;  1ZG9 A;  2Q51 A;  2AFW A;  4UIA A;  4FUU A;  2PJ2 A;  1ZLH A;  5FSX A;  3PEI A;  2PJ8 A;  4LQG A;  5LYL A;  3IIB A;  2F8H A;  1CBX A;  4X2T A;  2POK A;  3B3C A;  3D66 A;  2ZED A;  1ZG8 A;  1AYE A;  2IJZ A;  4JLL A;  3MN8 A;  3N5F A;  3GLJ A;  3KGQ A;  4O23 A;  3WC5 A;  1H8L A;  5DS0 A;  2WYR A;  4R8F A;  4KSI A;  2FG1 A;  3FED A;  3NA6 A;  3EWQ A;  5FSU A;  4NGR A;  1PYT B;  1M4L A;  3WC6 A;  2ANP A;  1HDU A;  1XRY A;  3EWR A;  3WT4 A;  1ZG7 A;  3FMC A;  2FAV A;  1XMB A;  3SIJ A;  5K8P A;  3GQE A;  4P10 A;  3GPQ A;  1ELM P;  3SJF A;  2OR4 A;  3B3T A;  5CB3 A;  3D68 A;  4UML A;  3PB9 X;  4OC3 A;  4NGN A;  5HOL A;  2RFH A;  4J4Z A;  3CPX A;  3QNV A;  2AFX A;  5IB9 A;  1ZLI A;  3KR4 A;  2BOA A;  3Q71 A;  5HIH A;  1YLO A;  3B2Y A;  1QQ9 A;  4MRI A;  2O4H A;  3EKE A;  2XEG A;  1HJZ A;  2ZEG A;  3RAM A;  1YSJ A;  5K8O A;  1R3N A;  4JGK A;  2V8D A;  2C1C A;  4YU9 A;  4NGT A;  5LYI A;  1F2P A;  3GPG A;  4ZYQ A;  3D7D A;  4A38 A;  2XD7 A;  2RB7 A;  3L2N A;  5FSZ A;  3H8G A;  2EK9 A;  2PJ0 A;  2PJC A;  5AIL A;  4PXC A;  1LFW A;  3WC7 A;  4R7M A;  4PXE A;  3IIF A;  2GLF A;  3SI0 A;  2L8R A;  3LMS A;  4JYW A;  1XBU A;  3T8W A;  3BXM A;  3B7I A;  5THW A;  4Q7A A;  3S9M A;  4IHM A;  4MMO A;  3JRU A;  4TU0 A;  3I1U A;  1LAP A;  3GUX A;  1VGY A;  4R6T A;  1UWY A;  3PBE A;  5F09 A;  1HEE A;  3BHX A;  1R43 A;  1IY7 A;  3D7F A;  3PRT A;  2ZEN A;  3BI0 A;  4YWY A;  1FNO A;  3IID A;  1LAM A;  4P6Y A;  1NJR A;  5E3B A;  2DX6 A;  3CPA A;  5JGF A;  3K9T A;  3B35 A;  2PE3 A;  4IAV A;  1PCA A;  2PVW A;  3PB8 X;  3V2B A;  4JZ0 A;  5FSV A;  1TKJ A;  4TNU A;  4JVV A;  4TWE A;  1TXR A;  3RZA A;  3SI1 A;  1RTQ A;  4OC4 A;  4F9U A;  3PB7 X;  4P4F A;  3CDX A;  4MHN A;  5K8M A;  1LAN A;  4PQA A;  1NSA A;  2PJ5 A;  2AFZ A;  4PPZ A;  2PJA A;  4GVW A;  2PJ4 A;  4J5Q A;  1TY8 A;  4JCA A;  4A37 A;  2VL1 A;  1DE4 C;  4R76 A;  3B3V A;  2ZEM A;  2JBK A;  4FWU A;  2JBJ A;  3TC8 A;  3DGV A;  7CPA A;  3SIH A;  3V45 A;  3VH9 A;  3HLP A;  2C6G A;  4EME A;  2ZOF A;  1TF8 A;  2EEE A;  4D86 A;  2AFO A;  1DTD A;  3IWW A;  4MCR A;  4BD9 A;  4UIB A;  2QVP A;  1TXZ A;  4MCS A;  4UEF A;  3K2K A;  4FAI A;  3IC1 A;  2PJ3 A;  3D67 A;  4OKO A;  3FX6 A;  3NH8 A;  4ZX8 A;  2JEW A;  3PB4 X;  2GU2 A;  3NH5 A;  1SPV A;  3H8F A;  4RUH A;  4DJL A;  4ESS A;  3EWO A;  3FJU A;  4A39 A;  3S9N A;  1BLL E;  2J9A A;  2ZOG A;  4OC0 A;  5CPA A;  2GLJ A;  3CT9 A;  2BO9 A;  4ZY1 A;  2V8G A;  4OC5 A;  2F7V A;  2AFC A;  4UEZ A;  2Q43 A;  3KQZ A;  3NH4 A;  3GB0 A;  5HVF A;  4OC2 A;  6CPA A;  1Z2L A;  1JQG A;  1BPN A;  2ZEF A;  1CX8 A;  3KI9 A;  2FXK A;  1LOK A;  2EWB A;  2BFR A;  3FEE A;  3GPO A;  3HUV A;  3PBB A;  2ZEO A;  4NFR A;  4NGS A;  3ETI A;  4X3R A;  3SJG A;  1GYT A;  1BPM A;  2Q4Z A;  4Z65 A;  4GM5 A;  4ZY0 A;  5LYD A;  4K0C A;  3EJF A;  3D7G A;  2ZEH A;  5FSY A;  1Y7E A;  4MHP A;  4P45 A;  3RBU A;  2AFU A;  5ELY A;  3TX8 A;  5LRG A;  3BI1 A;  4OP4 A;  2PRQ A;  1ARL A;  2GRE A;  1FT7 A;  2DEA A;  4OID A;  3JZT A;  4GUA A;  2CIJ A;  4EWT A;  4ZX9 A;  4B6Z A;  1XFO A;  2QJ8 A;  3IO1 A;  2CTB A;  3V7Z A;  8CPA A;  1Z8L A;  4MHZ A;  2IQ6 A;  5DUS A;  1BAV A;  2PJB A;  1CP7 A;  3FF3 A;  2ZEE A;  5K8N A;  3IFE A;  3H8E A;  4MCQ A;  4KYB A;  1Z5R A;  3MRU A;  3EW5 A;  4ABK A;  4UF4 A;  2V77 A;  4F8Z A;  5LYF A;  4F9V A;  2C6C A;  5D8N A;  1VHE A;  4NGM A;  1Q7L A;  2PJ7 A;  4CPA A;  4P4B A;  3WAB A;  1LCP A;  1F57 A;  5JM6 A;  3FVL A;  4NGQ A;  1YW6 A;  5CBM A;  2NSM A;  5CB5 A;  4NGP A;  3S9L A;  4DYO A;  4DUK A;  4IQY A;  3LWU A;  4FBE A;  2QYV A;  1Y0Y A;  4ABL A;  1CP6 A;  4OIW A;  5LRJ A;  4WWV A;  3KZW A;  2PIY A;  1YD9 A;  3KQX A;  4ETJ A;  1Y0R A;  3IEH A;  4ONW A;  1YW4 A;  1F2O A;  3GQO A;  2I3C A;  4P4E A;  1AMP A;  3EWP A;  4H2K A;  2O53 A;  4ZI6 A;  4EFD A;  3FH4 A;  5LRK A;  3D4U A;  2ZEP A;  2AFS A;  2PVV A;  5D29 A;  2ABZ A;  4WJB A;  2AFM A;  3B3W A;  2EK8 A;  2V8H A;  2VRI A;  1ZR5 A;  3V38 A;  1OBR A;  4AXV A;  3KL9 A;  3EJG A;  2NYQ A;  4A94 A;  1TKF A;  1TKH A;  1VIX A;  1KWM A;  4PXD A;  2OOT A;  4OME A;  3KAS A;  3DLJ A;  1CG2 A;  3SIG A;  2FVG A;  3D7H A;  3IJ3 A;  2G9D A;  1QMU A;  4NJQ A;  2PIZ A;  3VAT A;  1ZR3 A;  5I4M A;  1ARM A;  5HVG A;  5HXD A;  4UEE A;  2HC9 A;  5JH9 A;  3PFE A;  3KHZ A;  2XEJ A;  4NJR A;  1HDQ A;  2LGR A;  1YME A;  2WZN A;  4OC1 A;  3SJE A;  4PXB A;  4G1P A;  2BCO A;  3KR5 A;  2ZEL A;  1VHO A;  2CF4 A;  2PJ9 A;  3ISZ A;  5J1Q A;  4X8I A;  2BFQ A;  3SJX A;  3PFO A;  1VHU A;  4P4J A;  4ETK A;  2X47 A;  3VFQ A;  2HB6 A;  2PJ6 A;  2PCU A;  1IGB A;  3SI2 A;  2ACF A;  2IMO A;  4W9Y A;  3Q6Z A;  4K3N A;  4MXU A;  4J5S A;  3FEC A;  2PJ1 A;  4IK2 A;  4P4D A;  3VAR A;  4P44 A;  5CMS A;  2C6P A;  1CPX A;  3PB6 X;  1ELL P;  2V8V A;  4MHY A;  2XEF A;  1XJO A;  4P4I A;  1EE3 P;  3ISX A;  3KHX A;  2CTC A;  3B3S A;  1TF9 A;  3NFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...