4ZY1A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10r
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
519
structure length
518
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable M17 family aminopeptidase
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
total genus 168
structure length 518
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zy1A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zy1A02
3B7IA 3EJFA 3IFEA 2ZEPA 3WC7A 4PXEA 3IIFA 4GVWA 5LYLA 4WJBA 2PJ7A 3KR5A 4P45A 2XEIA 2C6CA 2AFCA 3SIJA 5LRGA 1FNOA 4UEZA 4ZY1A 1GYTA 1LCPA 3KHZA 2PJ6A 3FF3A 4UIAA 1TKHA 1BPMA 3H8GA 3NFZA 1NJRA 4OC5A 4UEFA 2ZELA 2O53A 5JM6A 5CB3A 3VATA 2Q43A 1YW6A 2ZOGA 1TXRA 3KI9A 4NJRA 4DUKA 2AFXA 2ZEFA 5FSXA 5E3BA 5HIHA 4MHYA 2ACFA 3GB0A 3IIDA 2PJ5A 3GQEA 3ETIA 2CF4A 3HUVA 1CX8A 1HEEA 5FSZA 3BXMA 3VH9A 4X3RA 3D7FA 2XD7A 2F7VA 3B3CA 2AFZA 4JGKA 3V45A 4LQGA 4FBEA 5CBMA 1QQ9A 3PB6X 4NGMA 4PXCA 3CPAA 4MCPA 4P10A 1BPNA 4KSIA 4ONWA 5THWA 1VIXA 1Y7EA 2EK9A 2PVVA 3NA6A 4UMLA 3I1UA 3NH5A 3SI1A 4W9YA 2AFWA 1XMBA 1TKJA 4F9UA 4MCSA 4PPZA 2PJ0A 2BO9A 3B3TA 4NGSA 2QVPA 1DE4C 2XEFA 5FSVA 4NGQA 4X2TA 5K8PA 2IQ6A 2DEAA 4ESSA 1IGBA 1RTQA 2ZEDA 4R76A 3BHXA 5F09A 3JRUA 4NGNA 1Y0RA 3MN8A 3KR4A 3BI1A 4OC2A 3V38A 4PQAA 2V8DA 4A37A 3PRTA 2G9DA 1LAPA 5HOLA 2VRIA 4ZY2A 2FG1A 3MRUA 1AMPA 2DX6A 1Y0YA 2POKA 3LMSA 3RBUA 2ZEHA 2OR4A 2ZEEA 4EWTA 3PB9X 2Q4ZA 3EWRA 3K2KA 2ANPA 1CBXA 3B35A 2Q51A 3ISXA 1YW4A 4IQYA 3PBEA 3D7DA 3IEHA 3TC8A 4TU0A 2IJZA 2J9AA 3WABA 4B6ZA 2PJ4A 4WWVA 3PB4X 3H8EA 3VARA 4ABLA 1VGYA 2XEGA 4Z65A 2BFRA 2ABZA 3SIHA 4NGTA 1CPXA 2V8GA 3PB7X 1HDUA 4MCRA 2PJAA 3SIGA 1ZG7A 3RAMA 3D66A 5D29A 3GUXA 3FEDA 2RFHA 4J5RA 3KGQA 5HVFA 4PXDA 4TWEA 4ZYQA 4P4EA 4P4JA 3PFOA 3D7GA 7CPAA 3Q71A 5JGFA 2LGRA 2CTBA 3CDXA 2QJ8A 3WT4A 3FEEA 2X47A 5LYIA 2ZEOA 3Q6ZA 4OC3A 1TKFA 4NJQA 2FVGA 3SJFA 2PJCA 4MHNA 3FH4A 2PRQA 1TY8A 5LRJA 2AFUA 1ARLA 4IHMA 4JVVA 1YMEA 4GVVA 1M4LA 2NSMA 2ZOFA 2AFSA 1Z2LA 4OKOA 4X8IA 3D7HA 1ZG9A 2OOTA 1HJZA 4GUAA 3PBBA 8CPAA 4PXBA 4R8FA 5LRKA 4DYOA 3NH8A 2WYRA 5HVGA 4UF4A 2L8RA 2PE3A 2AFOA 2C6GA 2V77A 1XBUA 4IAVA 4JLLA 5HVHA 4J4ZA 1R3NA 3KZWA 2O4HA 2ZENA 5ELYA 2GLJA 4MHPA 4CPAA 1TF8A 2AFMA 2HC9A 2PVWA 4OMEA 3GPQA 5K8OA 2GLFA 3QNVA 1Z8LA 3S9NA 3EKEA 1LOKA 4MMOA 5AILA 3V7ZA 3T8WA 3CT9A 2QYVA 4AXVA 3IIBA 5CMSA 3JZTA 2XEJA 3K9TA 3KQXA 3PEIA 1VHUA 4FUUA 3KQZA 3EWQA 3CPXA 4UEEA 1KWMA 1FT7A 2I3CA 3EWPA 3VFQA 5IB9A 5DUSA 2C6PA 1TF9A 4P44A 1ZLIA 2PJBA 3SJGA 5CB5A 4EMEA 2BCOA 5D8NA 1ZR5A 2GREA 3D68A 2PJ2A 3NH4A 5K8MA 5I4MA 4ZX8A 4IK2A 1JQGA 3WC5A 1XJOA 2EK8A 4MXUA 4GM5A 3IC1A 3V2BA 3SJEA 4P4BA 5CPAA 2ZEMA 4Q7AA 1XFOA 2GU2A 5FSYA 3D67A 2PJ3A 4P6YA 3KL9A 1ZLHA 4FWUA 4MRIA 1YLOA 3SJXA 1ELLP 2EWBA 1XRYA 4MCQA 3GQOA 4YWYA 2JEWA 4JCAA 1CPSA 4OP4A 4A38A 2CTCA 3S9MA 4K3NA 2CIJA 1Z5RA 1ARMA 4R6TA 2C1CA 4EFDA 2BOAA 4DJLA 3H8FA 3DGVA 3ISZA 1F2PA 4OIWA 3PFEA 3B2YA 4RUHA 2IMOA 2RB7A 3N5FA 2PJ8A 4OC4A 3B3WA 1Q7LA 4KYBA 4J5SA 4JZ0A 4UIBA 1EE3P 1F2OA 4TNUA 4NFRA 2WZNA 3BI0A 5J1QA 3L2NA 4OIDA 1LFWA 3TX8A 4G1PA 3EJGA 4F8ZA 2F8HA 3B3VA 1DTDA 4P4DA 2PJ9A 4OC0A 3SI2A 3GLJA 2PJ1A 4K0CA 5LYDA 2VL1A 1CG2A 1YD9A 1ZG8A 2V8VA 3KHXA 6CPAA 3B3SA 4R7MA 4O23A 3SI0A 4NGRA 2ZEGA 3IWWA 3FJUA 4ETJA 4ABKA 3FMCA 1CP6A 4P4FA 3GPGA 1SPVA 1UWYA 5DS0A 1HDQA 5FSUA 4ZX9A 4MHZA 3EWOA 2BFQA 3SIIA 2PCUA 4OC1A 2HB6A 4J5QA 2FAVA 4YU9A 4A94A 4F9VA 2JBJA 2EEEA 1AYEA 4D86A 2NYQA 3D4UA 5HXDA 3FVLA 4P4IA 1VHOA 1PCAA 1LANA 3RZAA 4FAIA 1F57A 3WC6A 3GPOA 4ZI6A 1OBRA 1LAMA 1CP7A 3IO1A 3FECA 4A39A 4H2KA 3S9LA 3IJ3A 3LWUA 2PIYA 4NGPA 1BLLE 5JH9A 3PB8X 4JYWA 5LYFA 4ZY0A 1VHEA 2FXKA 1R43A 2JBKA 1PYTB 1ELMP 2PIZA 4BD9A 1BAVA 3KASA 1IY7A 1ZR3A 3FX6A 3HLPA 1H8LA 4ETKA 1TXZA 3EW5A 1NSAA 2V8HA 1QMUA 1YSJA 5K8NA 3DLJA
chains in the Genus database with same CATH superfamily
3B7IA 3EJFA 3IFEA 2ZEPA 3WC7A 2AE6A 4IF5A 2KQVA 3VWEA 2G3AA 2EUIA 4PXEA 3IIFA 4GVWA 2Z3NA 4EVYA 3UY5A 5LYLA 3V8IA 2Y0MA 2PJ7A 3KR5A 4WJBA 4P45A 2XEIA 2C6CA 4KVOE 4CAWA 2AFCA 4CS0B 5F47A 4ONUA 3SIJA 1M4IA 5LRGA 1XOVA 1FNOA 4UEZA 1YX0A 3S6GA 4ZY1A 3QB8A 1GYTA 1LCPA 4KZTA 3KHZA 3EY5A 2IL4A 2PJ6A 2Z11A 2HQYA 1TKHA 3FF3A 4UIAA 1BPMA 3H8GA 2J8NA 5H84A 1NE9A 3NFZA 1NJRA 4OC5A 4UEFA 1TIQA 1Q2DA 2ZELA 1J4JA 4HNXB 4LX9A 5AG4A 2O53A 5JM6A 4C2XA 5CB3A 1QSRA 3VATA 3TCVA 4CRYB 4RN7A 3VWDA 4L89A 2Q43A 1YW6A 2ZOGA 1L0CA 3D3SA 1TXRA 2EVNA 2Z10A 3FIXA 3KI9A 4KOYA 4NJRA 4DUKA 5J8CA 1IOIA 2AFXA 2O28A 2ZEFA 5FSXA 4NSQA 4II9A 5E3BA 5HIHA 1CM0A 4MHYA 2ACFA 3GB0A 4QBJA 4UWJA 2Q04A 3TOAA 2R1IA 3IIDA 2EO8A 2PJ5A 3GQEA 3ETIA 3SXOA 4CYPA 2CF4A 4CAFA 2QIRA 4KVXA 2DXQA 3HUVA 4Y49C 1CX8A 1YLEA 1HEEA 2B4DB 2YNEA 5FSZA 3BXMA 4KSFA 1ZO0A 3VH9A 2OZHA 1YVKA 2DF5A 3D7FA 2XD7A 3A9LA 4X3RA 2B3VA 2WPWA 2F7VA 1MJBA 3PZJA 1M44A 3ZJ0A 1MJAA 3B3CA 2GFQA 3RO0A 4AG7A 3D8PA 2AFZA 2ZW4A 1YVOA 5JPHA 3FNCA 4JGKA 3V45A 4LQGA 4FBEA 5CBMA 1IICA 1QQ9A 2C27A 3EC4A 4KORA 3T90A 3PB6X 1YK3A 4NGMA 4PXCA 3CPAA 1PU9A 2YNCC 4M6HA 4KLVA 1XIXA 2CNSA 5H86A 4MCPA 4P10A 1BPNA 4KSIA 4UCNA 2F5IA 2EBJA 3TOBA 1S7FA 4MFKA 4F6AA 4ONWA 5THWA 1VIXA 1Y7EA 3R1KA 1S7LA 2EK9A 2PVVA 3NA6A 5I0CA 1IYKA 2YNDA 4E8OA 2G0BA 4UMLA 3I1UA 3NH5A 3SI1A 2FCKA 3R9GA 4UFVA 1S60A 4W9YA 2AFWA 1M4DA 1XMBA 2Z0ZA 1TKJA 1VKCA 4FD5A 4MCSA 3SXNA 4F9UA 3FBUA 2DPSA 3D2PA 4PPZA 2JZFA 2PJ0A 2BO9A 4YGOA 1YREA 3B3TA 2QVPA 1DE4C 4NGSA 1NSLA 3FXTA 5EMIA 3TO6A 1S7NA 2XEFA 1Z9UA 5IX3A 5FSVA 4NGQA 4X2TA 5K8PA 1SQHA 2REEA 5F49A 5C82A 2IQ6A 4M6GA 2D4OA 2DEAA 4XPDC 1P0HA 3S6HA 4ESSA 1IGBA 1Z4EA 3RNZA 4PV6A 4A32A 4X5KA 1RTQA 4U5YA 2ZXVA 2ZEDA 5BWAB 4AG9A 4R76A 3BHXA 1M1DA 2I00A 2Z3LA 5F09A 3JRUA 4NGNA 1QSMA 1Y0RA 2G3TA 3MN8A 4FD4A 3KR4A 2A4NA 3BI1A 2CNMA 4KUAA 4OC2A 1Q2CA 2V8DA 2RC4A 3CXSA 2G9DA 3LODA 3PRTA 2HUZA 4PQAA 4A37A 1LAPA 2WUUA 5HOLA 2VRIA 4E2AA 4ZY2A 2B58A 5JQ4A 3EXNA 3DNSA 4MI4A 4R3LA 2FG1A 3MRUA 5HH1A 1AMPA 2DX6A 1I1DA 1Y0YA 2WSAA 2POKA 5KTDA 3W91A 3G3SA 3LMSA 4QC6A 1S5KA 3RBUA 1VHSA 2ZEHA 2OR4A 2ZEEA 4EWTA 3PB9X 2Q4ZA 3EWRA 3K2KA 1RXTA 4CAVA 2ANPA 4CGOA 1CBXA 3B35A 2Q51A 3ISXA 4A33A 5C88A 1YW4A 4IQYA 3PBEA 3WR7A 4NF1A 3GKRA 3D7DA 3IEHA 4CRZB 3LD2A 4PK2A 4TU0A 4QVTA 3TC8A 2IJZA 4R3KA 1JWQA 4KOUA 4HNWB 2J9AA 2JDDA 3WABA 4UFWA 4MFJA 1WK4A 2VEZA 2PJ4A 4B6ZA 4B12A 4WWVA 3PB4X 3H8EA 1ON0A 3VARA 1V0CA 5HMNA 4ABLA 1VGYA 1Y7RA 2XEGA 4JXRA 3T9YA 4Z65A 2BFRA 2ABZA 3SIHA 2PRBA 4KOWA 4BBHA 4OADA 4BMHA 4NGTA 2FXFA 1CPXA 4PK3A 1I12A 2V8GA 4QUSA 4KLWA 1Z8XA 3PB7X 4C7IA 1HDUA 4MCRA 2PJAA 3SIGA 1ZG7A 3RAMA 3D66A 4KVME 4XNHC 4XPKA 1Z8WA 1U6MA 4OAEA 5D29A 3GUXA 2FT0A 2W2GA 4C2ZA 2J8RA 3FEDA 4A95A 5AGEA 3CXQA 3P2FA 2RFHA 4J5RA 4YRHA 1KUYA 1BO4A 3KGQA 2R98A 4PXDA 5HVFA 4TWEA 5DWMA 4ZYQA 4P4EA 2B4DA 3SHPA 4KOXA 3PFOA 4P4JA 2R7HA 4H6UA 3D7GA 4HNYB 7CPAA 3TE4A 3JVNA 3Q71A 4JXQA 3IU2A 4CAXA 2LGRA 1S3ZA 2CTBA 3BLNA 2QECA 2JEVA 3CDXA 3DDDA 4MFQA 4UWIA 1UFHA 2BEIA 2QJ8A 4UA3A 1MJ9A 2FS5A 5A27A 3WT4A 4A30A 3FEEA 2X47A 5LYIA 2OZGA 3Q6ZA 2ZEOA 4OC3A 1TKFA 4NJQA 2FVGA 3FYNA 2BUEA 4A2ZA 3SJFA 2OH1A 2PJCA 4MHNA 5A28A 3FH4A 3C26A 2PRQA 1TY8A 2B3UA 3MGDA 3R96A 4CGLA 1Z4RA 2Q4YA 5LRJA 2AFUA 3F5BA 2OB0A 1ARLA 4IHMA 1LRZA 4GS4A 4JVVA 1N71A 1YMEA 1K4JA 4GVVA 1M4LA 3DR6A 3IGRA 2NSMA 2ZOFA 4K30A 2AFSA 1Z2LA 5IB0A 4OKOA 4X8IA 3D7HA 1ZG9A 2OOTA 1S7KA 1HJZA 4B5PB 1BOBA 5FVJA 4GUAA 4ORFA 4AB7A 4H89A 3GIUA 3PBBA 8CPAA 4PXBA 4R8FA 1Y9WA 3S6FA 4CYQA 4JJXA 4HKFA 4LUAA 4MHDA 5G20A 5LRKA 4DYOA 3NH8A 3IU1A 3EO4A 2WYRA 4PSXA 5HVGA 5AG7A 3IWGA 3S6KA 2H5MA 2Q4VA 2VI7A 4UF4A 1X12A 2FL4A 2L8RA 2PE3A 2REFA 4I49A 2AFOA 2C6GA 4B11A 1WWZA 2V77A 1XBUA 2JZDA 2B4BA 2VZYA 4JLLA 4IAVA 5HVHA 4J4ZA 1R3NA 2CY2A 3KZWA 1YR0A 2O4HA 2ZENA 2GLJA 5ELYA 4JWPA 4MHPA 2Q0YA 2BSWA 4CPAA 1TF8A 2AFMA 2HC9A 2PVWA 3R95A 4OMEA 1IYLA 3PP9A 4KOVA 3GPQA 4HPSA 2GLFA 5K8OA 1GHEA 3QNVA 2I79A 1Z8LA 3W6XA 4QB9A 3S9NA 2Z3MA 4Q36A 3EKEA 1LOKA 3QAHA 4MMOA 2Q44A 5AILA 3V7ZA 3T8WA 2P0WA 3CT9A 2QYVA 5GCNA 4AXVA 3IIBA 5CMSA 3JZTA 2XEJA 3K9TA 2GE3A 2Q7BA 3KQXA 3PEIA 1VHUA 2PQ8A 3P2HA 4FUUA 3KQZA 3EWQA 3CPXA 4UEEA 4DNCA 1KWMA 1FT7A 2I3CA 1B87A 3EWPA 2FSRA 4CAEA 4F0XA 4U9ZA 4AVCA 4CYOA 3VFQA 2ZPAA 4UBRA 5IB9A 5DUSA 4H6ZA 2PC1A 2C6PA 5E96A 3E0KA 2ZW7A 3EFAA 1TF9A 4R9MA 2FIWA 1ZLIA 2PJBA 4P44A 4MY0A 1AUGA 4OLLA 3SJGA 5CB5A 1I21A 2KCWA 4EMEA 2BCOA 2JDCA 1YGHA 5DWNA 2D4PA 5D8NA 2JLMA 4MFLA 1ZR5A 4KSAA 4F0YA 2GREA 3D68A 1Z8TA 2PJ2A 3NH4A 5EBVA 5K8MA 1M4GA 4NEXA 3I3GA 2WPXA 5I4MA 4ZX8A 4IK2A 1JQGA 3WC5A 1XJOA 2EK8A 1KUXA 2R8VA 4GM5A 4MXUA 3IC1A 3V2BA 3SJEA 4P4BA 4CGMA 2ARHA 3R9EA 5CPAA 4M6IA 2ZEMA 1XMTA 3FRMA 4Q7AA 1XFOA 1QSOA 2GU2A 5F46A 5FSYA 1IB1E 2ZW5A 2PJ3A 3D67A 4P6YA 5KTAA 3KL9A 4Y49B 1OZPA 1XE4A 4C2YA 1ZLHA 4FWUA 4JD6A 4B14A 4MRIA 4CGNA 1YLOA 2ATRA 3SJXA 1ELLP 3G8WA 3I9SA 2EWBA 1XRYA 4MCQA 3GQOA 4YWYA 2P6FA 2VXKA 4KOSA 4A31A 2JEWA 4JCAA 1CPSA 3DSBA 4KOTA 3CZXA 4OP4A 4A38A 1XF8A 4NCZA 2CTCA 5CNPA 3S9MA 4K3NA 2CIJA 4CGPA 2RNKA 1YQEA 4UCPA 1Z5RA 3W6SA 1ARMA 2YNCA 4ZGYB 4R6TA 2C1CA 4EFDA 2AJ6A 2BOAA 4DJLA 2X7BA 3JTKA 3H8FA 3DGVA 1P4NA 3ISZA 1F2PA 2GANA 2CNTA 3B2YA 3PFEA 2IMOA 4OIWA 2DPTA 1Q2YA 2Z3KA 3TT2A 4RUHA 3JUWA 2RB7A 3N5FA 3RYOA 2PJ8A 4OC4A 3B3WA 1Q7LA 4KYBA 4J5SA 2PR8A 4AVBA 4JZ0A 2QMLA 1EE3P 2ZW6A 4UIBA 3CXPA 1F2OA 4TNUA 4NFRA 2OZUA 2JZEA 4IUSA 2WZNA 3BI0A 5J1QA 3L2NA 2VZZA 2B5GA 4OIDA 1LFWA 4L8AA 2Q7SA 4R87A 3TX8A 3F8KA 4BINA 2PR1A 4GXHA 4G1PA 3EJGA 4FD6A 2PSWA 2B5GB 4E0AA 3NE7A 2F8HA 3B3VA 4F8ZA 1DTDA 3IWEA 4P4DA 2PJ9A 1MK4A 2NMTA 4OC0A 3SI2A 4B5PA 5J8FA 2CXAA 5KTCA 2FIAA 2P6EA 4MBUA 4MY3A 2HV2A 3GLJA 2PJ1A 4K0CA 5LYDA 2VL1A 1CG2A 5IV0A 4AVAA 4MFZA 1YD9A 1ZG8A 2V8VA 4XPDB 3KHXA 6CPAA 4RI1A 4M85A 3B3SA 3TO7A 4R7MA 1KZFA 4O23A 5EC4A 3SI0A 4NGRA 4U9YA 2BL1A 2YGWA 5G22A 2ZEGA 2Z3PA 3IWWA 3FJUA 3PGPA 4ETJA 1QSNA 4ABKA 4B13A 3FMCA 4KS9A 1CP6A 3TFYA 4P4FA 3GPGA 1SPVA 1UWYA 5DS0A 4B5OA 2WCTA 1HDQA 5FSUA 4ZX9A 3KKWA 4MHZA 3EWOA 1IU8A 2BFQA 4JLYA 3GY9A 1QSTA 3SIIA 1X10A 2PCUA 4RS2A 4OC1A 2HB6A 4J5QA 2FAVA 3NE8A 4MJ8A 4YU9A 4A94A 1IIDA 3V38A 4J3GA 4C7HA 4F9VA 2JBJA 3H4QA 2EEEA 1AYEA 4D86A 2OU2A 1FY7A 2GIVA 2NYQA 3D4UA 5HXDA 4LQ6A 3FVLA 3QAYA 3F0AA 3OWCA 3K9UA 4P4IA 4UCMA 3TTHA 2FE7A 3FB3A 1VHOA 4KUBA 1PCAA 1LANA 3RZAA 3H5ZA 4FAIA 4MFPA 3R9FA 1F57A 2J8MA 1RO5A 3WC6A 2PDOA 4PSWA 3BJ7A 2VBQA 3GPOA 4ZI6A 1OBRA 3B8GA 1LAMA 1CP7A 3IO1A 3FECA 4FD7A 4H2KA 4A39A 3IJ3A 4C68A 3S9LA 4UFXA 5ISVA 4Q38A 1Y9KA 3LWUA 2PIYA 3N7ZA 4NGPA 5G21A 1BLLE 4CYNA 4NXYA 4ZBGA 2K5TA 1KUVA 3LACA 5JH9A 3PB8X 3BJ8A 1A2ZA 3D2MA 4JYWA 5LYFA 4ZY0A 1VHEA 2FXKA 1NMTA 1R43A 2ODFA 2JBKA 1CJWA 4XNHB 4M3SA 1PYTB 2VQYA 1ELMP 2PIZA 4BD9A 1BAVA 2P6GA 3KASA 4XPLA 5AG6A 5AG5A 1XEBA 1IY7A 1ZR3A 3FX6A 3HLPA 3TO9A 1H8LA 4B10A 4ETKA 1TXZA 2Z3OA 3EW5A 4YFJA 4R57A 1PUAA 1R57A 1NSAA 3ZZIA 5F48A 2V8HA 3GYAA 1QMUA 5G1ZA 1YSJA 5JGFA 3DR8A 1IOFA 5K8NA 1B6BA 3DLJA
chains in the Genus database with same CATH topology
3B7IA 3EJFA 3IFEA 2ZEPA 3WC7A 4PXEA 3IIFA 4GVWA 5LYLA 4WJBA 2PJ7A 3KR5A 4P45A 2XEIA 2C6CA 2AFCA 3SIJA 5LRGA 1FNOA 4UEZA 4ZY1A 1GYTA 1LCPA 3KHZA 2PJ6A 3FF3A 4UIAA 1TKHA 1BPMA 3H8GA 3NFZA 1NJRA 4OC5A 4UEFA 2ZELA 2O53A 5JM6A 5CB3A 3VATA 2Q43A 1YW6A 2ZOGA 1TXRA 3KI9A 4NJRA 4DUKA 2AFXA 2ZEFA 5FSXA 5E3BA 5HIHA 4MHYA 2ACFA 3GB0A 3IIDA 2PJ5A 3GQEA 3ETIA 2CF4A 3HUVA 1CX8A 1HEEA 5FSZA 3BXMA 3VH9A 4X3RA 3D7FA 2XD7A 2F7VA 3B3CA 2AFZA 4JGKA 3V45A 4LQGA 4FBEA 5CBMA 1QQ9A 3PB6X 4NGMA 4PXCA 3CPAA 4MCPA 4P10A 1BPNA 4KSIA 4ONWA 5THWA 1VIXA 1Y7EA 2EK9A 2PVVA 3NA6A 4UMLA 3I1UA 3NH5A 3SI1A 4W9YA 2AFWA 1XMBA 1TKJA 4F9UA 4MCSA 4PPZA 2PJ0A 2BO9A 3B3TA 4NGSA 2QVPA 1DE4C 2XEFA 5FSVA 4NGQA 4X2TA 5K8PA 2IQ6A 2DEAA 4ESSA 1IGBA 1RTQA 2ZEDA 4R76A 3BHXA 5F09A 3JRUA 4NGNA 1Y0RA 3MN8A 3KR4A 3BI1A 4OC2A 3V38A 4PQAA 2V8DA 4A37A 3PRTA 2G9DA 1LAPA 5HOLA 2VRIA 4ZY2A 2FG1A 3MRUA 1AMPA 2DX6A 1Y0YA 2POKA 3LMSA 3RBUA 2ZEHA 2OR4A 2ZEEA 4EWTA 3PB9X 2Q4ZA 3EWRA 3K2KA 2ANPA 1CBXA 3B35A 2Q51A 3ISXA 1YW4A 4IQYA 3PBEA 3D7DA 3IEHA 3TC8A 4TU0A 2IJZA 2J9AA 3WABA 4B6ZA 2PJ4A 4WWVA 3PB4X 3H8EA 3VARA 4ABLA 1VGYA 2XEGA 4Z65A 2BFRA 2ABZA 3SIHA 4NGTA 1CPXA 2V8GA 3PB7X 1HDUA 4MCRA 2PJAA 3SIGA 1ZG7A 3RAMA 3D66A 5D29A 3GUXA 3FEDA 2RFHA 4J5RA 3KGQA 5HVFA 4PXDA 4TWEA 4ZYQA 4P4EA 4P4JA 3PFOA 3D7GA 7CPAA 3Q71A 5JGFA 2LGRA 2CTBA 3CDXA 2QJ8A 3WT4A 3FEEA 2X47A 5LYIA 2ZEOA 3Q6ZA 4OC3A 1TKFA 4NJQA 2FVGA 3SJFA 2PJCA 4MHNA 3FH4A 2PRQA 1TY8A 5LRJA 2AFUA 1ARLA 4IHMA 4JVVA 1YMEA 4GVVA 1M4LA 2NSMA 2ZOFA 2AFSA 1Z2LA 4OKOA 4X8IA 3D7HA 1ZG9A 2OOTA 1HJZA 4GUAA 3PBBA 8CPAA 4PXBA 4R8FA 5LRKA 4DYOA 3NH8A 2WYRA 5HVGA 4UF4A 2L8RA 2PE3A 2AFOA 2C6GA 2V77A 1XBUA 4IAVA 4JLLA 5HVHA 4J4ZA 1R3NA 3KZWA 2O4HA 2ZENA 5ELYA 2GLJA 4MHPA 4CPAA 1TF8A 2AFMA 2HC9A 2PVWA 4OMEA 3GPQA 5K8OA 2GLFA 3QNVA 1Z8LA 3S9NA 3EKEA 1LOKA 4MMOA 5AILA 3V7ZA 3T8WA 3CT9A 2QYVA 4AXVA 3IIBA 5CMSA 3JZTA 2XEJA 3K9TA 3KQXA 3PEIA 1VHUA 4FUUA 3KQZA 3EWQA 3CPXA 4UEEA 1KWMA 1FT7A 2I3CA 3EWPA 3VFQA 5IB9A 5DUSA 2C6PA 1TF9A 4P44A 1ZLIA 2PJBA 3SJGA 5CB5A 4EMEA 2BCOA 5D8NA 1ZR5A 2GREA 3D68A 2PJ2A 3NH4A 5K8MA 5I4MA 4ZX8A 4IK2A 1JQGA 3WC5A 1XJOA 2EK8A 4MXUA 4GM5A 3IC1A 3V2BA 3SJEA 4P4BA 5CPAA 2ZEMA 4Q7AA 1XFOA 2GU2A 5FSYA 3D67A 2PJ3A 4P6YA 3KL9A 1ZLHA 4FWUA 4MRIA 1YLOA 3SJXA 1ELLP 2EWBA 1XRYA 4MCQA 3GQOA 4YWYA 2JEWA 4JCAA 1CPSA 4OP4A 4A38A 2CTCA 3S9MA 4K3NA 2CIJA 1Z5RA 1ARMA 4R6TA 2C1CA 4EFDA 2BOAA 4DJLA 3H8FA 3DGVA 3ISZA 1F2PA 4OIWA 3PFEA 3B2YA 4RUHA 2IMOA 2RB7A 3N5FA 2PJ8A 4OC4A 3B3WA 1Q7LA 4KYBA 4J5SA 4JZ0A 4UIBA 1EE3P 1F2OA 4TNUA 4NFRA 2WZNA 3BI0A 5J1QA 3L2NA 4OIDA 1LFWA 3TX8A 4G1PA 3EJGA 4F8ZA 2F8HA 3B3VA 1DTDA 4P4DA 2PJ9A 4OC0A 3SI2A 3GLJA 2PJ1A 4K0CA 5LYDA 2VL1A 1CG2A 1YD9A 1ZG8A 2V8VA 3KHXA 6CPAA 3B3SA 4R7MA 4O23A 3SI0A 4NGRA 2ZEGA 3IWWA 3FJUA 4ETJA 4ABKA 3FMCA 1CP6A 4P4FA 3GPGA 1SPVA 1UWYA 5DS0A 1HDQA 5FSUA 4ZX9A 4MHZA 3EWOA 2BFQA 3SIIA 2PCUA 4OC1A 2HB6A 4J5QA 2FAVA 4YU9A 4A94A 4F9VA 2JBJA 2EEEA 1AYEA 4D86A 2NYQA 3D4UA 5HXDA 3FVLA 4P4IA 1VHOA 1PCAA 1LANA 3RZAA 4FAIA 1F57A 3WC6A 3GPOA 4ZI6A 1OBRA 1LAMA 1CP7A 3IO1A 3FECA 4A39A 4H2KA 3S9LA 3IJ3A 3LWUA 2PIYA 4NGPA 1BLLE 5JH9A 3PB8X 4JYWA 5LYFA 4ZY0A 1VHEA 2FXKA 1R43A 2JBKA 1PYTB 1ELMP 2PIZA 4BD9A 1BAVA 3KASA 1IY7A 1ZR3A 3FX6A 3HLPA 1H8LA 4ETKA 1TXZA 3EW5A 1NSAA 2V8HA 1QMUA 1YSJA 5K8NA 3DLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7I A;  3EJF A;  3IFE A;  2ZEP A;  3WC7 A;  4PXE A;  3IIF A;  4GVW A;  5LYL A;  4WJB A;  2PJ7 A;  3KR5 A;  4P45 A;  2XEI A;  2C6C A;  2AFC A;  3SIJ A;  5LRG A;  1FNO A;  4UEZ A;  4ZY1 A;  1GYT A;  1LCP A;  3KHZ A;  2PJ6 A;  3FF3 A;  4UIA A;  1TKH A;  1BPM A;  3H8G A;  3NFZ A;  1NJR A;  4OC5 A;  4UEF A;  2ZEL A;  2O53 A;  5JM6 A;  5CB3 A;  3VAT A;  2Q43 A;  1YW6 A;  2ZOG A;  1TXR A;  3KI9 A;  4NJR A;  4DUK A;  2AFX A;  2ZEF A;  5FSX A;  5E3B A;  5HIH A;  4MHY A;  2ACF A;  3GB0 A;  3IID A;  2PJ5 A;  3GQE A;  3ETI A;  2CF4 A;  3HUV A;  1CX8 A;  1HEE A;  5FSZ A;  3BXM A;  3VH9 A;  4X3R A;  3D7F A;  2XD7 A;  2F7V A;  3B3C A;  2AFZ A;  4JGK A;  3V45 A;  4LQG A;  4FBE A;  5CBM A;  1QQ9 A;  3PB6 X;  4NGM A;  4PXC A;  3CPA A;  4MCP A;  4P10 A;  1BPN A;  4KSI A;  4ONW A;  5THW A;  1VIX A;  1Y7E A;  2EK9 A;  2PVV A;  3NA6 A;  4UML A;  3I1U A;  3NH5 A;  3SI1 A;  4W9Y A;  2AFW A;  1XMB A;  1TKJ A;  4F9U A;  4MCS A;  4PPZ A;  2PJ0 A;  2BO9 A;  3B3T A;  4NGS A;  2QVP A;  1DE4 C;  2XEF A;  5FSV A;  4NGQ A;  4X2T A;  5K8P A;  2IQ6 A;  2DEA A;  4ESS A;  1IGB A;  1RTQ A;  2ZED A;  4R76 A;  3BHX A;  5F09 A;  3JRU A;  4NGN A;  1Y0R A;  3MN8 A;  3KR4 A;  3BI1 A;  4OC2 A;  3V38 A;  4PQA A;  2V8D A;  4A37 A;  3PRT A;  2G9D A;  1LAP A;  5HOL A;  2VRI A;  4ZY2 A;  2FG1 A;  3MRU A;  1AMP A;  2DX6 A;  1Y0Y A;  2POK A;  3LMS A;  3RBU A;  2ZEH A;  2OR4 A;  2ZEE A;  4EWT A;  3PB9 X;  2Q4Z A;  3EWR A;  3K2K A;  2ANP A;  1CBX A;  3B35 A;  2Q51 A;  3ISX A;  1YW4 A;  4IQY A;  3PBE A;  3D7D A;  3IEH A;  3TC8 A;  4TU0 A;  2IJZ A;  2J9A A;  3WAB A;  4B6Z A;  2PJ4 A;  4WWV A;  3PB4 X;  3H8E A;  3VAR A;  4ABL A;  1VGY A;  2XEG A;  4Z65 A;  2BFR A;  2ABZ A;  3SIH A;  4NGT A;  1CPX A;  2V8G A;  3PB7 X;  1HDU A;  4MCR A;  2PJA A;  3SIG A;  1ZG7 A;  3RAM A;  3D66 A;  5D29 A;  3GUX A;  3FED A;  2RFH A;  4J5R A;  3KGQ A;  5HVF A;  4PXD A;  4TWE A;  4ZYQ A;  4P4E A;  4P4J A;  3PFO A;  3D7G A;  7CPA A;  3Q71 A;  5JGF A;  2LGR A;  2CTB A;  3CDX A;  2QJ8 A;  3WT4 A;  3FEE A;  2X47 A;  5LYI A;  2ZEO A;  3Q6Z A;  4OC3 A;  1TKF A;  4NJQ A;  2FVG A;  3SJF A;  2PJC A;  4MHN A;  3FH4 A;  2PRQ A;  1TY8 A;  5LRJ A;  2AFU A;  1ARL A;  4IHM A;  4JVV A;  1YME A;  4GVV A;  1M4L A;  2NSM A;  2ZOF A;  2AFS A;  1Z2L A;  4OKO A;  4X8I A;  3D7H A;  1ZG9 A;  2OOT A;  1HJZ A;  4GUA A;  3PBB A;  8CPA A;  4PXB A;  4R8F A;  5LRK A;  4DYO A;  3NH8 A;  2WYR A;  5HVG A;  4UF4 A;  2L8R A;  2PE3 A;  2AFO A;  2C6G A;  2V77 A;  1XBU A;  4IAV A;  4JLL A;  5HVH A;  4J4Z A;  1R3N A;  3KZW A;  2O4H A;  2ZEN A;  5ELY A;  2GLJ A;  4MHP A;  4CPA A;  1TF8 A;  2AFM A;  2HC9 A;  2PVW A;  4OME A;  3GPQ A;  5K8O A;  2GLF A;  3QNV A;  1Z8L A;  3S9N A;  3EKE A;  1LOK A;  4MMO A;  5AIL A;  3V7Z A;  3T8W A;  3CT9 A;  2QYV A;  4AXV A;  3IIB A;  5CMS A;  3JZT A;  2XEJ A;  3K9T A;  3KQX A;  3PEI A;  1VHU A;  4FUU A;  3KQZ A;  3EWQ A;  3CPX A;  4UEE A;  1KWM A;  1FT7 A;  2I3C A;  3EWP A;  3VFQ A;  5IB9 A;  5DUS A;  2C6P A;  1TF9 A;  4P44 A;  1ZLI A;  2PJB A;  3SJG A;  5CB5 A;  4EME A;  2BCO A;  5D8N A;  1ZR5 A;  2GRE A;  3D68 A;  2PJ2 A;  3NH4 A;  5K8M A;  5I4M A;  4ZX8 A;  4IK2 A;  1JQG A;  3WC5 A;  1XJO A;  2EK8 A;  4MXU A;  4GM5 A;  3IC1 A;  3V2B A;  3SJE A;  4P4B A;  5CPA A;  2ZEM A;  4Q7A A;  1XFO A;  2GU2 A;  5FSY A;  3D67 A;  2PJ3 A;  4P6Y A;  3KL9 A;  1ZLH A;  4FWU A;  4MRI A;  1YLO A;  3SJX A;  1ELL P;  2EWB A;  1XRY A;  4MCQ A;  3GQO A;  4YWY A;  2JEW A;  4JCA A;  1CPS A;  4OP4 A;  4A38 A;  2CTC A;  3S9M A;  4K3N A;  2CIJ A;  1Z5R A;  1ARM A;  4R6T A;  2C1C A;  4EFD A;  2BOA A;  4DJL A;  3H8F A;  3DGV A;  3ISZ A;  1F2P A;  4OIW A;  3PFE A;  3B2Y A;  4RUH A;  2IMO A;  2RB7 A;  3N5F A;  2PJ8 A;  4OC4 A;  3B3W A;  1Q7L A;  4KYB A;  4J5S A;  4JZ0 A;  4UIB A;  1EE3 P;  1F2O A;  4TNU A;  4NFR A;  2WZN A;  3BI0 A;  5J1Q A;  3L2N A;  4OID A;  1LFW A;  3TX8 A;  4G1P A;  3EJG A;  4F8Z A;  2F8H A;  3B3V A;  1DTD A;  4P4D A;  2PJ9 A;  4OC0 A;  3SI2 A;  3GLJ A;  2PJ1 A;  4K0C A;  5LYD A;  2VL1 A;  1CG2 A;  1YD9 A;  1ZG8 A;  2V8V A;  3KHX A;  6CPA A;  3B3S A;  4R7M A;  4O23 A;  3SI0 A;  4NGR A;  2ZEG A;  3IWW A;  3FJU A;  4ETJ A;  4ABK A;  3FMC A;  1CP6 A;  4P4F A;  3GPG A;  1SPV A;  1UWY A;  5DS0 A;  1HDQ A;  5FSU A;  4ZX9 A;  4MHZ A;  3EWO A;  2BFQ A;  3SII A;  2PCU A;  4OC1 A;  2HB6 A;  4J5Q A;  2FAV A;  4YU9 A;  4A94 A;  4F9V A;  2JBJ A;  2EEE A;  1AYE A;  4D86 A;  2NYQ A;  3D4U A;  5HXD A;  3FVL A;  4P4I A;  1VHO A;  1PCA A;  1LAN A;  3RZA A;  4FAI A;  1F57 A;  3WC6 A;  3GPO A;  4ZI6 A;  1OBR A;  1LAM A;  1CP7 A;  3IO1 A;  3FEC A;  4A39 A;  4H2K A;  3S9L A;  3IJ3 A;  3LWU A;  2PIY A;  4NGP A;  1BLL E;  5JH9 A;  3PB8 X;  4JYW A;  5LYF A;  4ZY0 A;  1VHE A;  2FXK A;  1R43 A;  2JBK A;  1PYT B;  1ELM P;  2PIZ A;  4BD9 A;  1BAV A;  3KAS A;  1IY7 A;  1ZR3 A;  3FX6 A;  3HLP A;  1H8L A;  4ETK A;  1TXZ A;  3EW5 A;  1NSA A;  2V8H A;  1QMU A;  1YSJ A;  5K8N A;  3DLJ A; 
#chains in the Genus database with same CATH topology
 3B7I A;  3EJF A;  3IFE A;  2ZEP A;  3WC7 A;  2AE6 A;  4IF5 A;  2KQV A;  3VWE A;  2G3A A;  2EUI A;  4PXE A;  3IIF A;  4GVW A;  2Z3N A;  4EVY A;  3UY5 A;  5LYL A;  3V8I A;  2Y0M A;  2PJ7 A;  3KR5 A;  4WJB A;  4P45 A;  2XEI A;  2C6C A;  4KVO E;  4CAW A;  2AFC A;  4CS0 B;  5F47 A;  4ONU A;  3SIJ A;  1M4I A;  5LRG A;  1XOV A;  1FNO A;  4UEZ A;  1YX0 A;  3S6G A;  4ZY1 A;  3QB8 A;  1GYT A;  1LCP A;  4KZT A;  3KHZ A;  3EY5 A;  2IL4 A;  2PJ6 A;  2Z11 A;  2HQY A;  1TKH A;  3FF3 A;  4UIA A;  1BPM A;  3H8G A;  2J8N A;  5H84 A;  1NE9 A;  3NFZ A;  1NJR A;  4OC5 A;  4UEF A;  1TIQ A;  1Q2D A;  2ZEL A;  1J4J A;  4HNX B;  4LX9 A;  5AG4 A;  2O53 A;  5JM6 A;  4C2X A;  5CB3 A;  1QSR A;  3VAT A;  3TCV A;  4CRY B;  4RN7 A;  3VWD A;  4L89 A;  2Q43 A;  1YW6 A;  2ZOG A;  1L0C A;  3D3S A;  1TXR A;  2EVN A;  2Z10 A;  3FIX A;  3KI9 A;  4KOY A;  4NJR A;  4DUK A;  5J8C A;  1IOI A;  2AFX A;  2O28 A;  2ZEF A;  5FSX A;  4NSQ A;  4II9 A;  5E3B A;  5HIH A;  1CM0 A;  4MHY A;  2ACF A;  3GB0 A;  4QBJ A;  4UWJ A;  2Q04 A;  3TOA A;  2R1I A;  3IID A;  2EO8 A;  2PJ5 A;  3GQE A;  3ETI A;  3SXO A;  4CYP A;  2CF4 A;  4CAF A;  2QIR A;  4KVX A;  2DXQ A;  3HUV A;  4Y49 C;  1CX8 A;  1YLE A;  1HEE A;  2B4D B;  2YNE A;  5FSZ A;  3BXM A;  4KSF A;  1ZO0 A;  3VH9 A;  2OZH A;  1YVK A;  2DF5 A;  3D7F A;  2XD7 A;  3A9L A;  4X3R A;  2B3V A;  2WPW A;  2F7V A;  1MJB A;  3PZJ A;  1M44 A;  3ZJ0 A;  1MJA A;  3B3C A;  2GFQ A;  3RO0 A;  4AG7 A;  3D8P A;  2AFZ A;  2ZW4 A;  1YVO A;  5JPH A;  3FNC A;  4JGK A;  3V45 A;  4LQG A;  4FBE A;  5CBM A;  1IIC A;  1QQ9 A;  2C27 A;  3EC4 A;  4KOR A;  3T90 A;  3PB6 X;  1YK3 A;  4NGM A;  4PXC A;  3CPA A;  1PU9 A;  2YNC C;  4M6H A;  4KLV A;  1XIX A;  2CNS A;  5H86 A;  4MCP A;  4P10 A;  1BPN A;  4KSI A;  4UCN A;  2F5I A;  2EBJ A;  3TOB A;  1S7F A;  4MFK A;  4F6A A;  4ONW A;  5THW A;  1VIX A;  1Y7E A;  3R1K A;  1S7L A;  2EK9 A;  2PVV A;  3NA6 A;  5I0C A;  1IYK A;  2YND A;  4E8O A;  2G0B A;  4UML A;  3I1U A;  3NH5 A;  3SI1 A;  2FCK A;  3R9G A;  4UFV A;  1S60 A;  4W9Y A;  2AFW A;  1M4D A;  1XMB A;  2Z0Z A;  1TKJ A;  1VKC A;  4FD5 A;  4MCS A;  3SXN A;  4F9U A;  3FBU A;  2DPS A;  3D2P A;  4PPZ A;  2JZF A;  2PJ0 A;  2BO9 A;  4YGO A;  1YRE A;  3B3T A;  2QVP A;  1DE4 C;  4NGS A;  1NSL A;  3FXT A;  5EMI A;  3TO6 A;  1S7N A;  2XEF A;  1Z9U A;  5IX3 A;  5FSV A;  4NGQ A;  4X2T A;  5K8P A;  1SQH A;  2REE A;  5F49 A;  5C82 A;  2IQ6 A;  4M6G A;  2D4O A;  2DEA A;  4XPD C;  1P0H A;  3S6H A;  4ESS A;  1IGB A;  1Z4E A;  3RNZ A;  4PV6 A;  4A32 A;  4X5K A;  1RTQ A;  4U5Y A;  2ZXV A;  2ZED A;  5BWA B;  4AG9 A;  4R76 A;  3BHX A;  1M1D A;  2I00 A;  2Z3L A;  5F09 A;  3JRU A;  4NGN A;  1QSM A;  1Y0R A;  2G3T A;  3MN8 A;  4FD4 A;  3KR4 A;  2A4N A;  3BI1 A;  2CNM A;  4KUA A;  4OC2 A;  1Q2C A;  2V8D A;  2RC4 A;  3CXS A;  2G9D A;  3LOD A;  3PRT A;  2HUZ A;  4PQA A;  4A37 A;  1LAP A;  2WUU A;  5HOL A;  2VRI A;  4E2A A;  4ZY2 A;  2B58 A;  5JQ4 A;  3EXN A;  3DNS A;  4MI4 A;  4R3L A;  2FG1 A;  3MRU A;  5HH1 A;  1AMP A;  2DX6 A;  1I1D A;  1Y0Y A;  2WSA A;  2POK A;  5KTD A;  3W91 A;  3G3S A;  3LMS A;  4QC6 A;  1S5K A;  3RBU A;  1VHS A;  2ZEH A;  2OR4 A;  2ZEE A;  4EWT A;  3PB9 X;  2Q4Z A;  3EWR A;  3K2K A;  1RXT A;  4CAV A;  2ANP A;  4CGO A;  1CBX A;  3B35 A;  2Q51 A;  3ISX A;  4A33 A;  5C88 A;  1YW4 A;  4IQY A;  3PBE A;  3WR7 A;  4NF1 A;  3GKR A;  3D7D A;  3IEH A;  4CRZ B;  3LD2 A;  4PK2 A;  4TU0 A;  4QVT A;  3TC8 A;  2IJZ A;  4R3K A;  1JWQ A;  4KOU A;  4HNW B;  2J9A A;  2JDD A;  3WAB A;  4UFW A;  4MFJ A;  1WK4 A;  2VEZ A;  2PJ4 A;  4B6Z A;  4B12 A;  4WWV A;  3PB4 X;  3H8E A;  1ON0 A;  3VAR A;  1V0C A;  5HMN A;  4ABL A;  1VGY A;  1Y7R A;  2XEG A;  4JXR A;  3T9Y A;  4Z65 A;  2BFR A;  2ABZ A;  3SIH A;  2PRB A;  4KOW A;  4BBH A;  4OAD A;  4BMH A;  4NGT A;  2FXF A;  1CPX A;  4PK3 A;  1I12 A;  2V8G A;  4QUS A;  4KLW A;  1Z8X A;  3PB7 X;  4C7I A;  1HDU A;  4MCR A;  2PJA A;  3SIG A;  1ZG7 A;  3RAM A;  3D66 A;  4KVM E;  4XNH C;  4XPK A;  1Z8W A;  1U6M A;  4OAE A;  5D29 A;  3GUX A;  2FT0 A;  2W2G A;  4C2Z A;  2J8R A;  3FED A;  4A95 A;  5AGE A;  3CXQ A;  3P2F A;  2RFH A;  4J5R A;  4YRH A;  1KUY A;  1BO4 A;  3KGQ A;  2R98 A;  4PXD A;  5HVF A;  4TWE A;  5DWM A;  4ZYQ A;  4P4E A;  2B4D A;  3SHP A;  4KOX A;  3PFO A;  4P4J A;  2R7H A;  4H6U A;  3D7G A;  4HNY B;  7CPA A;  3TE4 A;  3JVN A;  3Q71 A;  4JXQ A;  3IU2 A;  4CAX A;  2LGR A;  1S3Z A;  2CTB A;  3BLN A;  2QEC A;  2JEV A;  3CDX A;  3DDD A;  4MFQ A;  4UWI A;  1UFH A;  2BEI A;  2QJ8 A;  4UA3 A;  1MJ9 A;  2FS5 A;  5A27 A;  3WT4 A;  4A30 A;  3FEE A;  2X47 A;  5LYI A;  2OZG A;  3Q6Z A;  2ZEO A;  4OC3 A;  1TKF A;  4NJQ A;  2FVG A;  3FYN A;  2BUE A;  4A2Z A;  3SJF A;  2OH1 A;  2PJC A;  4MHN A;  5A28 A;  3FH4 A;  3C26 A;  2PRQ A;  1TY8 A;  2B3U A;  3MGD A;  3R96 A;  4CGL A;  1Z4R A;  2Q4Y A;  5LRJ A;  2AFU A;  3F5B A;  2OB0 A;  1ARL A;  4IHM A;  1LRZ A;  4GS4 A;  4JVV A;  1N71 A;  1YME A;  1K4J A;  4GVV A;  1M4L A;  3DR6 A;  3IGR A;  2NSM A;  2ZOF A;  4K30 A;  2AFS A;  1Z2L A;  5IB0 A;  4OKO A;  4X8I A;  3D7H A;  1ZG9 A;  2OOT A;  1S7K A;  1HJZ A;  4B5P B;  1BOB A;  5FVJ A;  4GUA A;  4ORF A;  4AB7 A;  4H89 A;  3GIU A;  3PBB A;  8CPA A;  4PXB A;  4R8F A;  1Y9W A;  3S6F A;  4CYQ A;  4JJX A;  4HKF A;  4LUA A;  4MHD A;  5G20 A;  5LRK A;  4DYO A;  3NH8 A;  3IU1 A;  3EO4 A;  2WYR A;  4PSX A;  5HVG A;  5AG7 A;  3IWG A;  3S6K A;  2H5M A;  2Q4V A;  2VI7 A;  4UF4 A;  1X12 A;  2FL4 A;  2L8R A;  2PE3 A;  2REF A;  4I49 A;  2AFO A;  2C6G A;  4B11 A;  1WWZ A;  2V77 A;  1XBU A;  2JZD A;  2B4B A;  2VZY A;  4JLL A;  4IAV A;  5HVH A;  4J4Z A;  1R3N A;  2CY2 A;  3KZW A;  1YR0 A;  2O4H A;  2ZEN A;  2GLJ A;  5ELY A;  4JWP A;  4MHP A;  2Q0Y A;  2BSW A;  4CPA A;  1TF8 A;  2AFM A;  2HC9 A;  2PVW A;  3R95 A;  4OME A;  1IYL A;  3PP9 A;  4KOV A;  3GPQ A;  4HPS A;  2GLF A;  5K8O A;  1GHE A;  3QNV A;  2I79 A;  1Z8L A;  3W6X A;  4QB9 A;  3S9N A;  2Z3M A;  4Q36 A;  3EKE A;  1LOK A;  3QAH A;  4MMO A;  2Q44 A;  5AIL A;  3V7Z A;  3T8W A;  2P0W A;  3CT9 A;  2QYV A;  5GCN A;  4AXV A;  3IIB A;  5CMS A;  3JZT A;  2XEJ A;  3K9T A;  2GE3 A;  2Q7B A;  3KQX A;  3PEI A;  1VHU A;  2PQ8 A;  3P2H A;  4FUU A;  3KQZ A;  3EWQ A;  3CPX A;  4UEE A;  4DNC A;  1KWM A;  1FT7 A;  2I3C A;  1B87 A;  3EWP A;  2FSR A;  4CAE A;  4F0X A;  4U9Z A;  4AVC A;  4CYO A;  3VFQ A;  2ZPA A;  4UBR A;  5IB9 A;  5DUS A;  4H6Z A;  2PC1 A;  2C6P A;  5E96 A;  3E0K A;  2ZW7 A;  3EFA A;  1TF9 A;  4R9M A;  2FIW A;  1ZLI A;  2PJB A;  4P44 A;  4MY0 A;  1AUG A;  4OLL A;  3SJG A;  5CB5 A;  1I21 A;  2KCW A;  4EME A;  2BCO A;  2JDC A;  1YGH A;  5DWN A;  2D4P A;  5D8N A;  2JLM A;  4MFL A;  1ZR5 A;  4KSA A;  4F0Y A;  2GRE A;  3D68 A;  1Z8T A;  2PJ2 A;  3NH4 A;  5EBV A;  5K8M A;  1M4G A;  4NEX A;  3I3G A;  2WPX A;  5I4M A;  4ZX8 A;  4IK2 A;  1JQG A;  3WC5 A;  1XJO A;  2EK8 A;  1KUX A;  2R8V A;  4GM5 A;  4MXU A;  3IC1 A;  3V2B A;  3SJE A;  4P4B A;  4CGM A;  2ARH A;  3R9E A;  5CPA A;  4M6I A;  2ZEM A;  1XMT A;  3FRM A;  4Q7A A;  1XFO A;  1QSO A;  2GU2 A;  5F46 A;  5FSY A;  1IB1 E;  2ZW5 A;  2PJ3 A;  3D67 A;  4P6Y A;  5KTA A;  3KL9 A;  4Y49 B;  1OZP A;  1XE4 A;  4C2Y A;  1ZLH A;  4FWU A;  4JD6 A;  4B14 A;  4MRI A;  4CGN A;  1YLO A;  2ATR A;  3SJX A;  1ELL P;  3G8W A;  3I9S A;  2EWB A;  1XRY A;  4MCQ A;  3GQO A;  4YWY A;  2P6F A;  2VXK A;  4KOS A;  4A31 A;  2JEW A;  4JCA A;  1CPS A;  3DSB A;  4KOT A;  3CZX A;  4OP4 A;  4A38 A;  1XF8 A;  4NCZ A;  2CTC A;  5CNP A;  3S9M A;  4K3N A;  2CIJ A;  4CGP A;  2RNK A;  1YQE A;  4UCP A;  1Z5R A;  3W6S A;  1ARM A;  2YNC A;  4ZGY B;  4R6T A;  2C1C A;  4EFD A;  2AJ6 A;  2BOA A;  4DJL A;  2X7B A;  3JTK A;  3H8F A;  3DGV A;  1P4N A;  3ISZ A;  1F2P A;  2GAN A;  2CNT A;  3B2Y A;  3PFE A;  2IMO A;  4OIW A;  2DPT A;  1Q2Y A;  2Z3K A;  3TT2 A;  4RUH A;  3JUW A;  2RB7 A;  3N5F A;  3RYO A;  2PJ8 A;  4OC4 A;  3B3W A;  1Q7L A;  4KYB A;  4J5S A;  2PR8 A;  4AVB A;  4JZ0 A;  2QML A;  1EE3 P;  2ZW6 A;  4UIB A;  3CXP A;  1F2O A;  4TNU A;  4NFR A;  2OZU A;  2JZE A;  4IUS A;  2WZN A;  3BI0 A;  5J1Q A;  3L2N A;  2VZZ A;  2B5G A;  4OID A;  1LFW A;  4L8A A;  2Q7S A;  4R87 A;  3TX8 A;  3F8K A;  4BIN A;  2PR1 A;  4GXH A;  4G1P A;  3EJG A;  4FD6 A;  2PSW A;  2B5G B;  4E0A A;  3NE7 A;  2F8H A;  3B3V A;  4F8Z A;  1DTD A;  3IWE A;  4P4D A;  2PJ9 A;  1MK4 A;  2NMT A;  4OC0 A;  3SI2 A;  4B5P A;  5J8F A;  2CXA A;  5KTC A;  2FIA A;  2P6E A;  4MBU A;  4MY3 A;  2HV2 A;  3GLJ A;  2PJ1 A;  4K0C A;  5LYD A;  2VL1 A;  1CG2 A;  5IV0 A;  4AVA A;  4MFZ A;  1YD9 A;  1ZG8 A;  2V8V A;  4XPD B;  3KHX A;  6CPA A;  4RI1 A;  4M85 A;  3B3S A;  3TO7 A;  4R7M A;  1KZF A;  4O23 A;  5EC4 A;  3SI0 A;  4NGR A;  4U9Y A;  2BL1 A;  2YGW A;  5G22 A;  2ZEG A;  2Z3P A;  3IWW A;  3FJU A;  3PGP A;  4ETJ A;  1QSN A;  4ABK A;  4B13 A;  3FMC A;  4KS9 A;  1CP6 A;  3TFY A;  4P4F A;  3GPG A;  1SPV A;  1UWY A;  5DS0 A;  4B5O A;  2WCT A;  1HDQ A;  5FSU A;  4ZX9 A;  3KKW A;  4MHZ A;  3EWO A;  1IU8 A;  2BFQ A;  4JLY A;  3GY9 A;  1QST A;  3SII A;  1X10 A;  2PCU A;  4RS2 A;  4OC1 A;  2HB6 A;  4J5Q A;  2FAV A;  3NE8 A;  4MJ8 A;  4YU9 A;  4A94 A;  1IID A;  3V38 A;  4J3G A;  4C7H A;  4F9V A;  2JBJ A;  3H4Q A;  2EEE A;  1AYE A;  4D86 A;  2OU2 A;  1FY7 A;  2GIV A;  2NYQ A;  3D4U A;  5HXD A;  4LQ6 A;  3FVL A;  3QAY A;  3F0A A;  3OWC A;  3K9U A;  4P4I A;  4UCM A;  3TTH A;  2FE7 A;  3FB3 A;  1VHO A;  4KUB A;  1PCA A;  1LAN A;  3RZA A;  3H5Z A;  4FAI A;  4MFP A;  3R9F A;  1F57 A;  2J8M A;  1RO5 A;  3WC6 A;  2PDO A;  4PSW A;  3BJ7 A;  2VBQ A;  3GPO A;  4ZI6 A;  1OBR A;  3B8G A;  1LAM A;  1CP7 A;  3IO1 A;  3FEC A;  4FD7 A;  4H2K A;  4A39 A;  3IJ3 A;  4C68 A;  3S9L A;  4UFX A;  5ISV A;  4Q38 A;  1Y9K A;  3LWU A;  2PIY A;  3N7Z A;  4NGP A;  5G21 A;  1BLL E;  4CYN A;  4NXY A;  4ZBG A;  2K5T A;  1KUV A;  3LAC A;  5JH9 A;  3PB8 X;  3BJ8 A;  1A2Z A;  3D2M A;  4JYW A;  5LYF A;  4ZY0 A;  1VHE A;  2FXK A;  1NMT A;  1R43 A;  2ODF A;  2JBK A;  1CJW A;  4XNH B;  4M3S A;  1PYT B;  2VQY A;  1ELM P;  2PIZ A;  4BD9 A;  1BAV A;  2P6G A;  3KAS A;  4XPL A;  5AG6 A;  5AG5 A;  1XEB A;  1IY7 A;  1ZR3 A;  3FX6 A;  3HLP A;  3TO9 A;  1H8L A;  4B10 A;  4ETK A;  1TXZ A;  2Z3O A;  3EW5 A;  4YFJ A;  4R57 A;  1PUA A;  1R57 A;  1NSA A;  3ZZI A;  5F48 A;  2V8H A;  3GYA A;  1QMU A;  5G1Z A;  1YSJ A;  5JGF A;  3DR8 A;  1IOF A;  5K8N A;  1B6B A;  3DLJ A; 
#chains in the Genus database with same CATH homology
 3B7I A;  3EJF A;  3IFE A;  2ZEP A;  3WC7 A;  4PXE A;  3IIF A;  4GVW A;  5LYL A;  4WJB A;  2PJ7 A;  3KR5 A;  4P45 A;  2XEI A;  2C6C A;  2AFC A;  3SIJ A;  5LRG A;  1FNO A;  4UEZ A;  4ZY1 A;  1GYT A;  1LCP A;  3KHZ A;  2PJ6 A;  3FF3 A;  4UIA A;  1TKH A;  1BPM A;  3H8G A;  3NFZ A;  1NJR A;  4OC5 A;  4UEF A;  2ZEL A;  2O53 A;  5JM6 A;  5CB3 A;  3VAT A;  2Q43 A;  1YW6 A;  2ZOG A;  1TXR A;  3KI9 A;  4NJR A;  4DUK A;  2AFX A;  2ZEF A;  5FSX A;  5E3B A;  5HIH A;  4MHY A;  2ACF A;  3GB0 A;  3IID A;  2PJ5 A;  3GQE A;  3ETI A;  2CF4 A;  3HUV A;  1CX8 A;  1HEE A;  5FSZ A;  3BXM A;  3VH9 A;  4X3R A;  3D7F A;  2XD7 A;  2F7V A;  3B3C A;  2AFZ A;  4JGK A;  3V45 A;  4LQG A;  4FBE A;  5CBM A;  1QQ9 A;  3PB6 X;  4NGM A;  4PXC A;  3CPA A;  4MCP A;  4P10 A;  1BPN A;  4KSI A;  4ONW A;  5THW A;  1VIX A;  1Y7E A;  2EK9 A;  2PVV A;  3NA6 A;  4UML A;  3I1U A;  3NH5 A;  3SI1 A;  4W9Y A;  2AFW A;  1XMB A;  1TKJ A;  4F9U A;  4MCS A;  4PPZ A;  2PJ0 A;  2BO9 A;  3B3T A;  4NGS A;  2QVP A;  1DE4 C;  2XEF A;  5FSV A;  4NGQ A;  4X2T A;  5K8P A;  2IQ6 A;  2DEA A;  4ESS A;  1IGB A;  1RTQ A;  2ZED A;  4R76 A;  3BHX A;  5F09 A;  3JRU A;  4NGN A;  1Y0R A;  3MN8 A;  3KR4 A;  3BI1 A;  4OC2 A;  3V38 A;  4PQA A;  2V8D A;  4A37 A;  3PRT A;  2G9D A;  1LAP A;  5HOL A;  2VRI A;  4ZY2 A;  2FG1 A;  3MRU A;  1AMP A;  2DX6 A;  1Y0Y A;  2POK A;  3LMS A;  3RBU A;  2ZEH A;  2OR4 A;  2ZEE A;  4EWT A;  3PB9 X;  2Q4Z A;  3EWR A;  3K2K A;  2ANP A;  1CBX A;  3B35 A;  2Q51 A;  3ISX A;  1YW4 A;  4IQY A;  3PBE A;  3D7D A;  3IEH A;  3TC8 A;  4TU0 A;  2IJZ A;  2J9A A;  3WAB A;  4B6Z A;  2PJ4 A;  4WWV A;  3PB4 X;  3H8E A;  3VAR A;  4ABL A;  1VGY A;  2XEG A;  4Z65 A;  2BFR A;  2ABZ A;  3SIH A;  4NGT A;  1CPX A;  2V8G A;  3PB7 X;  1HDU A;  4MCR A;  2PJA A;  3SIG A;  1ZG7 A;  3RAM A;  3D66 A;  5D29 A;  3GUX A;  3FED A;  2RFH A;  4J5R A;  3KGQ A;  5HVF A;  4PXD A;  4TWE A;  4ZYQ A;  4P4E A;  4P4J A;  3PFO A;  3D7G A;  7CPA A;  3Q71 A;  5JGF A;  2LGR A;  2CTB A;  3CDX A;  2QJ8 A;  3WT4 A;  3FEE A;  2X47 A;  5LYI A;  2ZEO A;  3Q6Z A;  4OC3 A;  1TKF A;  4NJQ A;  2FVG A;  3SJF A;  2PJC A;  4MHN A;  3FH4 A;  2PRQ A;  1TY8 A;  5LRJ A;  2AFU A;  1ARL A;  4IHM A;  4JVV A;  1YME A;  4GVV A;  1M4L A;  2NSM A;  2ZOF A;  2AFS A;  1Z2L A;  4OKO A;  4X8I A;  3D7H A;  1ZG9 A;  2OOT A;  1HJZ A;  4GUA A;  3PBB A;  8CPA A;  4PXB A;  4R8F A;  5LRK A;  4DYO A;  3NH8 A;  2WYR A;  5HVG A;  4UF4 A;  2L8R A;  2PE3 A;  2AFO A;  2C6G A;  2V77 A;  1XBU A;  4IAV A;  4JLL A;  5HVH A;  4J4Z A;  1R3N A;  3KZW A;  2O4H A;  2ZEN A;  5ELY A;  2GLJ A;  4MHP A;  4CPA A;  1TF8 A;  2AFM A;  2HC9 A;  2PVW A;  4OME A;  3GPQ A;  5K8O A;  2GLF A;  3QNV A;  1Z8L A;  3S9N A;  3EKE A;  1LOK A;  4MMO A;  5AIL A;  3V7Z A;  3T8W A;  3CT9 A;  2QYV A;  4AXV A;  3IIB A;  5CMS A;  3JZT A;  2XEJ A;  3K9T A;  3KQX A;  3PEI A;  1VHU A;  4FUU A;  3KQZ A;  3EWQ A;  3CPX A;  4UEE A;  1KWM A;  1FT7 A;  2I3C A;  3EWP A;  3VFQ A;  5IB9 A;  5DUS A;  2C6P A;  1TF9 A;  4P44 A;  1ZLI A;  2PJB A;  3SJG A;  5CB5 A;  4EME A;  2BCO A;  5D8N A;  1ZR5 A;  2GRE A;  3D68 A;  2PJ2 A;  3NH4 A;  5K8M A;  5I4M A;  4ZX8 A;  4IK2 A;  1JQG A;  3WC5 A;  1XJO A;  2EK8 A;  4MXU A;  4GM5 A;  3IC1 A;  3V2B A;  3SJE A;  4P4B A;  5CPA A;  2ZEM A;  4Q7A A;  1XFO A;  2GU2 A;  5FSY A;  3D67 A;  2PJ3 A;  4P6Y A;  3KL9 A;  1ZLH A;  4FWU A;  4MRI A;  1YLO A;  3SJX A;  1ELL P;  2EWB A;  1XRY A;  4MCQ A;  3GQO A;  4YWY A;  2JEW A;  4JCA A;  1CPS A;  4OP4 A;  4A38 A;  2CTC A;  3S9M A;  4K3N A;  2CIJ A;  1Z5R A;  1ARM A;  4R6T A;  2C1C A;  4EFD A;  2BOA A;  4DJL A;  3H8F A;  3DGV A;  3ISZ A;  1F2P A;  4OIW A;  3PFE A;  3B2Y A;  4RUH A;  2IMO A;  2RB7 A;  3N5F A;  2PJ8 A;  4OC4 A;  3B3W A;  1Q7L A;  4KYB A;  4J5S A;  4JZ0 A;  4UIB A;  1EE3 P;  1F2O A;  4TNU A;  4NFR A;  2WZN A;  3BI0 A;  5J1Q A;  3L2N A;  4OID A;  1LFW A;  3TX8 A;  4G1P A;  3EJG A;  4F8Z A;  2F8H A;  3B3V A;  1DTD A;  4P4D A;  2PJ9 A;  4OC0 A;  3SI2 A;  3GLJ A;  2PJ1 A;  4K0C A;  5LYD A;  2VL1 A;  1CG2 A;  1YD9 A;  1ZG8 A;  2V8V A;  3KHX A;  6CPA A;  3B3S A;  4R7M A;  4O23 A;  3SI0 A;  4NGR A;  2ZEG A;  3IWW A;  3FJU A;  4ETJ A;  4ABK A;  3FMC A;  1CP6 A;  4P4F A;  3GPG A;  1SPV A;  1UWY A;  5DS0 A;  1HDQ A;  5FSU A;  4ZX9 A;  4MHZ A;  3EWO A;  2BFQ A;  3SII A;  2PCU A;  4OC1 A;  2HB6 A;  4J5Q A;  2FAV A;  4YU9 A;  4A94 A;  4F9V A;  2JBJ A;  2EEE A;  1AYE A;  4D86 A;  2NYQ A;  3D4U A;  5HXD A;  3FVL A;  4P4I A;  1VHO A;  1PCA A;  1LAN A;  3RZA A;  4FAI A;  1F57 A;  3WC6 A;  3GPO A;  4ZI6 A;  1OBR A;  1LAM A;  1CP7 A;  3IO1 A;  3FEC A;  4A39 A;  4H2K A;  3S9L A;  3IJ3 A;  3LWU A;  2PIY A;  4NGP A;  1BLL E;  5JH9 A;  3PB8 X;  4JYW A;  5LYF A;  4ZY0 A;  1VHE A;  2FXK A;  1R43 A;  2JBK A;  1PYT B;  1ELM P;  2PIZ A;  4BD9 A;  1BAV A;  3KAS A;  1IY7 A;  1ZR3 A;  3FX6 A;  3HLP A;  1H8L A;  4ETK A;  1TXZ A;  3EW5 A;  1NSA A;  2V8H A;  1QMU A;  1YSJ A;  5K8N A;  3DLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...