4ZY2A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10o
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Probable M17 family aminopeptidase
total genus 178
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zy2A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zy2A02
1VIXA 4OIDA 4TU0A 4BD9A 1PCAA 1F2OA 4OMEA 4DJLA 4ABKA 3CPXA 2ABZA 1XBUA 2ZEDA 4J5RA 3HUVA 1VGYA 1ARMA 4MCPA 3NH4A 1ZG9A 4OC3A 4WWVA 5DS0A 3NA6A 1BAVA 4TNUA 3KR4A 3H8FA 1ZG8A 4JGKA 4EMEA 3BI0A 4PXEA 3SI1A 4EWTA 2OOTA 2AFMA 1Y7EA 4DYOA 5F09A 2FXKA 5LYIA 2WZNA 4LQGA 3LMSA 5FSUA 2FVGA 4FBEA 2CTBA 4P4DA 2V8GA 3D4UA 3S9NA 1CBXA 3TX8A 3WC6A 3SJXA 3GQEA 5HXDA 3PB7X 5CMSA 3I1UA 3SJEA 3JZTA 2ANPA 2AFSA 3ISZA 4MRIA 3DGVA 4R6TA 4UIAA 2CTCA 2DX6A 1BLLE 4X3RA 2O53A 1IGBA 5K8NA 3SIIA 4OKOA 1TKHA 3HLPA 5IB9A 2Q43A 1BPNA 1JQGA 3FVLA 1OBRA 4UIBA 3SI0A 1XJOA 2Q4ZA 1IY7A 2PE3A 4F9UA 3L2NA 4NJQA 2C6CA 2CF4A 2PJ7A 2XEFA 3EJGA 3VFQA 4R8FA 2BFRA 1SPVA 4UEEA 2ZEFA 1ZG7A 3IEHA 5HOLA 3B3CA 4CPAA 4ZY1A 1NSAA 3RZAA 1LANA 4IQYA 3FEEA 4MHNA 3DLJA 2GREA 3WT4A 4R7MA 2ZEOA 4NJRA 2PCUA 3B2YA 1NJRA 3PB9X 4YU9A 3KGQA 2ZOFA 3MRUA 2IJZA 4MMOA 4P10A 4Z65A 1CG2A 5CB5A 3FEDA 1BPMA 1PYTB 1YW4A 4GVWA 4OC2A 4NGMA 2EK8A 4K3NA 4ZI6A 3FMCA 2HC9A 2L8RA 1TXZA 5LYDA 2EEEA 4A94A 2PJ0A 2WYRA 4MHYA 3IWWA 3WC5A 4IHMA 3N5FA 3SJFA 4JZ0A 2PJ8A 3BI1A 5FSZA 1TY8A 4P4BA 2V8VA 3BHXA 4MCSA 4A39A 1Z5RA 2GLJA 2O4HA 2AFXA 3D7FA 3CT9A 2ZELA 3VATA 2ZEGA 5J1QA 3NFZA 2VL1A 2BOAA 3IIDA 4NGSA 4RUHA 7CPAA 1EE3P 2QVPA 4NGPA 2POKA 2C1CA 2EWBA 2ZENA 4GVVA 4KSIA 4ETJA 4YWYA 3B35A 3CDXA 3D68A 3EJFA 1LFWA 3WC7A 2PJ1A 1YMEA 3RBUA 1Z8LA 4P45A 3KI9A 3V2BA 4MHZA 4P4JA 4X2TA 4PPZA 4R76A 3EKEA 4J5SA 2F7VA 5CBMA 3FF3A 4GM5A 5LRJA 1CX8A 3KZWA 3H8GA 4JCAA 3PFEA 5DUSA 4UF4A 4ABLA 3GUXA 4O23A 1Y0YA 3SJGA 2PVWA 2QYVA 2BCOA 5JM6A 2F8HA 1ZR3A 3LWUA 1GYTA 1ARLA 3SIHA 4EFDA 1ZLIA 1VHUA 2PJ9A 4F9VA 2PJ5A 1TF9A 3GLJA 4ETKA 5K8OA 3GQOA 4K0CA 4NFRA 4TWEA 4MHPA 5HVGA 3V45A 4FUUA 3KQZA 2AFOA 3Q71A 2PIYA 2PJCA 2I3CA 2ZEPA 2PJ3A 1QQ9A 3IIFA 5E3BA 2JEWA 3EWQA 1CPXA 3IC1A 2XEIA 1TXRA 4P44A 3IFEA 3TC8A 5LYFA 1AYEA 4UEFA 4MCQA 3QNVA 3RAMA 5JGFA 4IK2A 2GLFA 4FAIA 1Y0RA 2V77A 4X8IA 3PRTA 3VARA 2FG1A 3KHZA 1R3NA 2ACFA 3B3WA 2XD7A 2AFUA 1TKFA 5FSVA 1VHEA 1HDUA 4P6YA 1UWYA 2RB7A 2JBKA 3KR5A 1VHOA 4D86A 5D8NA 1R43A 2PJ2A 4UEZA 3PFOA 3V38A 4AXVA 5D29A 2X47A 3KQXA 5JH9A 4NGTA 2Q51A 1AMPA 3PBBA 4P4IA 1XMBA 1DE4C 1H8LA 1YSJA 1FT7A 1YD9A 4J5QA 2XEGA 2PIZA 1TKJA 5LYLA 1XRYA 2ZEMA 2ZEHA 4OC4A 3WABA 3FJUA 2NYQA 1M4LA 3EWOA 2PJ6A 2BO9A 4P4FA 3EWRA 3SIGA 1DTDA 3D66A 3Q6ZA 5ELYA 3FX6A 3GB0A 4ONWA 4B6ZA 8CPAA 5LRKA 4KYBA 3PB6X 4NGNA 4A37A 4DUKA 4ZX8A 5AILA 4J4ZA 3PBEA 4OIWA 5THWA 5HVHA 4OP4A 1LAMA 2EK9A 4OC0A 4FWUA 1F2PA 1LAPA 4A38A 3IO1A 4ZY0A 1XFOA 1RTQA 1Q7LA 4MXUA 3K9TA 4OC5A 5HIHA 3T8WA 2PJAA 4JYWA 4W9YA 1LOKA 2ZOGA 3K2KA 2AFCA 1YW6A 2BFQA 3D67A 5I4MA 1HJZA 3S9MA 2FAVA 2ZEEA 2G9DA 3PEIA 4OC1A 4PQAA 5K8MA 3B3SA 6CPAA 5LRGA 1KWMA 2HB6A 3H8EA 4PXBA 1F57A 3D7HA 4G1PA 3S9LA 2J9AA 1ELMP 2PJ4A 3IIBA 2V8DA 4ZYQA 2OR4A 3GPOA 3B3VA 3B7IA 2AFZA 3IJ3A 2XEJA 3CPAA 3KL9A 4GUAA 3MN8A 1HEEA 4JLLA 4PXDA 3EW5A 2GU2A 1FNOA 4NGQA 1ZLHA 2QJ8A 3B3TA 3EWPA 4ZY2A 1TF8A 1YLOA 5FSYA 3SIJA 1LCPA 3FECA 5K8PA 3KHXA 2LGRA 4UMLA 2CIJA 3PB8X 1CP6A 3JRUA 2V8HA 4MCRA 4ZX9A 3NH5A 4Q7AA 3GPGA 2JBJA 2DEAA 3BXMA 3ETIA 5CPAA 2VRIA 1ZR5A 2IQ6A 4IAVA 3KASA 2PRQA 3SI2A 1CPSA 5FSXA 2NSMA 2C6GA 3FH4A 1HDQA 3ISXA 1CP7A 3V7ZA 5HVFA 3NH8A 4P4EA 4ESSA 4H2KA 4F8ZA 4JVVA 2RFHA 2IMOA 4WJBA 2C6PA 1ELLP 5CB3A 4PXCA 1QMUA 3PB4X 3GPQA 3VH9A 2PJBA 3D7GA 3D7DA 2AFWA 2PVVA 4NGRA 1Z2LA
chains in the Genus database with same CATH superfamily
1VIXA 2DPSA 4YRHA 4OIDA 3QAHA 4TU0A 4BD9A 1PCAA 1F2OA 3IU1A 4KLVA 4OMEA 4ABKA 4DJLA 3CPXA 2ABZA 1XBUA 2ZEDA 1S5KA 4J5RA 3HUVA 2R7HA 2KQVA 1VGYA 4M6GA 4ZBGA 1ARMA 4HNYB 4MCPA 1K4JA 2F5IA 3OWCA 4KORA 4LUAA 3NH4A 4A33A 4F6AA 2EVNA 1ZG9A 5BWAB 4OC3A 4WWVA 2ZW4A 5DS0A 2HQYA 3NA6A 2Z3MA 2Q0YA 4L8AA 2I00A 1BAVA 5G21A 4TNUA 3EY5A 3KR4A 3H8FA 1R57A 4QBJA 1ZG8A 5J8CA 4NSQA 1RO5A 4JGKA 3T90A 4EMEA 2B3VA 3BI0A 5DWNA 4FD7A 4PXEA 3SI1A 4EWTA 2VZYA 2AFMA 4KOYA 4H6UA 4MFKA 2OOTA 1Y7EA 3R9EA 5A28A 2B58A 4DYOA 2AJ6A 5F09A 2FXKA 5LYIA 3RYOA 2WZNA 3NE8A 4LQGA 2ZW7A 3KKWA 3LMSA 4M85A 3PGPA 3UY5A 5FSUA 2ARHA 2FVGA 2CTBA 4P4DA 4M6HA 3W6SA 1M4IA 2V8GA 1IU8A 2A4NA 3D4UA 1XEBA 4CGOA 3S9NA 1CBXA 2R1IA 3TX8A 3EC4A 3GQEA 3SJXA 3PB7X 5CMSA 3WC6A 4CAEA 5HXDA 4AG7A 5JQ4A 3I1UA 3SJEA 1Y7RA 1YQEA 3JZTA 1RXTA 2ANPA 2AFSA 3ISZA 3DSBA 4MRIA 3DGVA 4R6TA 4UCMA 2VEZA 2CTCA 3D2MA 4UIAA 2YNEA 4A2ZA 2DX6A 1BLLE 4KOSA 4X3RA 2O53A 1IGBA 3BJ7A 2J8NA 4LQ6A 2CXAA 4BBHA 4QUSA 4JJXA 3DDDA 3PZJA 3TT2A 5K8NA 4F0XA 1XIXA 3SIIA 4CGNA 4OKOA 2YGWA 2BEIA 3DR6A 1TKHA 3HLPA 4LX9A 5IB0A 2JZDA 4PK3A 2Q43A 5IB9A 1MJ9A 1LRZA 1BPNA 1JQGA 3FVLA 1OBRA 4UIBA 3SI0A 1XJOA 2Q4ZA 1IY7A 2PE3A 3DNSA 4F9UA 3L2NA 1I21A 4HPSA 1GHEA 2C6CA 2PQ8A 2PR1A 4NJQA 2CF4A 5AGEA 2PJ7A 5C88A 2XEFA 3EJGA 3H5ZA 2Z0ZA 4E8OA 3VFQA 4R8FA 2BFRA 1NSLA 1SPVA 4XNHB 4E2AA 5EMIA 4A95A 4FD6A 4UEEA 4B13A 4ZGYB 2ZEFA 4MFJA 4KS9A 4U9YA 4YGOA 4ORFA 1M4GA 1ZG7A 2OH1A 1Y9WA 2IL4A 5E96A 3IEHA 4AXVA 5HOLA 3B3CA 2VXKA 4CPAA 1NSAA 4ZY1A 1N71A 2P0WA 3BJ8A 3RZAA 4F0YA 1LANA 4IQYA 3FEEA 2FT0A 2VBQA 2Z3OA 4MHNA 3I3GA 2GREA 3DLJA 3WT4A 4R7MA 3EO4A 2ZEOA 1TIQA 4NJRA 2PCUA 3W91A 3P2HA 5AG7A 3B2YA 1NJRA 4KUBA 1IICA 3PB9X 4YU9A 1Q2CA 3KGQA 2ZOFA 3CXSA 4IF5A 3MRUA 3TCVA 2FS5A 2IJZA 3W6XA 2K5TA 4MMOA 4P10A 2GIVA 4JD6A 1CG2A 4Z65A 5CB5A 3FEDA 3RNZA 3R9FA 2ZW6A 1BPMA 1QSOA 1PYTB 1YW4A 3TO7A 4AVCA 4Q38A 4GXHA 4GVWA 4OC2A 4CGPA 4NGMA 5KTCA 2B4BA 2EK8A 4FD5A 5F49A 4K3NA 2OB0A 2Q4VA 1XF8A 4ZI6A 3FMCA 2HC9A 4CGLA 2L8RA 1TXZA 5LYDA 1S7KA 4KOTA 4B5PA 2EEEA 2Z3NA 4XPKA 2PJ0A 5AG5A 4A94A 2W2GA 2WYRA 4MHYA 4R9MA 2B5GB 3IWWA 4AVAA 4NXYA 3WC5A 3JVNA 4B12A 4IHMA 3TE4A 3N5FA 4GS4A 3SJFA 4JZ0A 2PJ8A 3BI1A 2VI7A 5F47A 5H84A 4CRZB 3GKRA 5FSZA 1TY8A 4P4BA 2V8VA 2QECA 1CJWA 3BHXA 3CZXA 4MCSA 1Z5RA 2DPTA 5FVJA 4A39A 2GLJA 2O4HA 2AFXA 3D7FA 1PUAA 3CT9A 2EUIA 3TFYA 1S60A 2ZELA 1YX0A 4BMHA 2CY2A 3VATA 2ZEGA 1I1DA 5J1QA 3NFZA 2VL1A 4XNHC 2BOAA 3VWDA 1B87A 1QSRA 1Z8XA 2BUEA 2QIRA 3IIDA 4NGSA 2YNDA 2HV2A 1A2ZA 4H89A 1EE3P 2QVPA 4RUHA 7CPAA 3PP9A 4NGPA 2POKA 2C1CA 2EWBA 2ZENA 3S6FA 3CXQA 4GVVA 2P6GA 4KSIA 4MY3A 4ETJA 4YWYA 1NMTA 4B5PB 3B35A 3CDXA 3D68A 4QB9A 2ZPAA 3EJFA 5IV0A 1LFWA 3K9UA 3WC7A 4KOUA 2PJ1A 1YMEA 1YVKA 4JXQA 4CRYB 2REEA 3G8WA 4KLWA 4YFJA 2I79A 4OADA 3RBUA 4MFLA 1Z8LA 4P45A 3KI9A 3V2BA 4MHZA 4P4JA 4X2TA 4PPZA 4R76A 3EKEA 4J5SA 5JPHA 1YK3A 2F7VA 2G3TA 3B8GA 4CAVA 1X12A 3FYNA 5CBMA 4B10A 3FF3A 4GM5A 5LRJA 1CX8A 4H6ZA 3KZWA 3H8GA 4JCAA 1VHSA 3PFEA 5DUSA 4KVME 4UF4A 4ABLA 3DR8A 3GUXA 5F48A 4O23A 1Y0YA 3SJGA 4E0AA 2PVWA 1S7NA 3TOAA 2QYVA 2WPWA 2KCWA 2BCOA 5JM6A 2Q7SA 3GIUA 4ONUA 4PV6A 4I49A 1M4DA 5KTAA 1IYLA 1IYKA 1WK4A 2F8HA 1VKCA 1ZR3A 3LWUA 5A27A 5G1ZA 2O28A 1GYTA 1MJBA 1ARLA 2Z3PA 3LACA 4UCPA 3F0AA 3SIHA 2GANA 4EFDA 1ZLIA 1VHUA 2PJ9A 4F9VA 2FSRA 2PJ5A 1TF9A 4CAWA 4C7IA 3GLJA 1WWZA 4ETKA 3V8IA 5K8OA 3GQOA 4MBUA 4K0CA 4NFRA 4TWEA 2ZXVA 2B5GA 4MHPA 5HVGA 3FIXA 3V45A 4II9A 4FUUA 5AG6A 3KQZA 2AFOA 3Q71A 3T9YA 2PIYA 4KOVA 4PSXA 2PJCA 2I3CA 1B6BA 3SHPA 2EO8A 1JWQA 2ZEPA 2PJ3A 1FY7A 1QQ9A 3IIFA 4HKFA 4UBRA 5AG4A 3F5BA 5E3BA 2JEWA 2PC1A 4JLYA 3EWQA 1CPXA 3IC1A 2XEIA 1TXRA 4P44A 1YGHA 3IFEA 3TC8A 1Z4EA 3TO6A 5LYFA 1AYEA 4UEFA 2JDDA 4MCQA 1YREA 3QNVA 2WSAA 3RAMA 5JGFA 2B4DA 2GLFA 4IK2A 4QVTA 2YNCA 4FAIA 4UWIA 3C26A 1Y0RA 2RC4A 2V77A 4X8IA 1UFHA 3PRTA 3VARA 2FG1A 3G3SA 1R3NA 3KHZA 4KSFA 4M6IA 2ACFA 1OZPA 1MK4A 3B3WA 1CM0A 2XD7A 2AFUA 1TKFA 5FSVA 1Q2DA 1VHEA 1HDUA 1M1DA 4P6YA 1UWYA 2H5MA 2JBKA 2REFA 3KR5A 1VHOA 2RB7A 1Z9UA 3FB3A 3IGRA 4R3KA 1KUVA 1M44A 4D86A 2D4OA 5D8NA 1R43A 2PJ2A 4R3LA 4B11A 3ZJ0A 2C27A 3PFOA 4UEZA 3SXNA 1P0HA 3TOBA 3V38A 1L0CA 2X47A 3KQXA 1BO4A 4NGTA 5D29A 4QC6A 2Q51A 4UWJA 5EBVA 1AMPA 1IB1E 1ON0A 1QSMA 3PBBA 4P4IA 1PU9A 1XMBA 3VWEA 4R57A 1DE4C 2GFQA 1H8LA 1P4NA 1YSJA 4M3SA 4MFPA 4MY0A 1SQHA 5C82A 2RNKA 1FT7A 4EVYA 1YD9A 4J5QA 4MFQA 2XEGA 2PIZA 1TKJA 3S6GA 3S6KA 5LYLA 2R8VA 1XRYA 4HNXB 4AVBA 2ZEMA 2ZEHA 4OC4A 3WABA 3FJUA 2NYQA 1Q2YA 1M4LA 4KVXA 3EWOA 4XPDC 2PJ6A 2BO9A 4C2ZA 4C68A 4KSAA 2ATRA 4P4FA 3EWRA 3SIGA 2BL1A 2GE3A 1DTDA 1Y9KA 3D66A 2JLMA 3FRMA 3D3SA 3TO9A 3Q6ZA 5ELYA 3R95A 3FX6A 3GB0A 3QAYA 4ONWA 4B6ZA 4KUAA 4B5OA 4CYNA 8CPAA 5LRKA 4KYBA 3PB6X 4NGNA 2R98A 2DXQA 2OZUA 3H4QA 2JEVA 1AUGA 4A37A 4DUKA 4ZX8A 4J4ZA 5AILA 2QMLA 3PBEA 4OIWA 5THWA 3RO0A 5HVHA 4OP4A 1LAMA 4NF1A 2DF5A 2VQYA 2EK9A 4OC0A 4FWUA 1F2PA 1LAPA 2CNTA 2YNCC 4A38A 3LD2A 4PSWA 3IO1A 4ZY0A 1YLEA 2G3AA 2WCTA 1XFOA 1RTQA 1Q7LA 1XOVA 2OU2A 2PRBA 4K30A 4MXUA 3K9TA 4UFXA 3IWGA 4OC5A 3SXOA 5HIHA 3T8WA 2CNSA 2J8RA 2PJAA 3E0KA 4JYWA 4W9YA 1LOKA 4UCNA 2ZOGA 3K2KA 2AFCA 2Z11A 4L89A 2Q7BA 1YW6A 2BFQA 4IUSA 3JUWA 2JZEA 4Y49B 1MJAA 2Q4YA 3BLNA 3D67A 1Z4RA 1V0CA 2P6EA 4KOXA 5I4MA 1HJZA 2EBJA 3S9MA 2FAVA 4NCZA 4A32A 2ZEEA 4KZTA 2G9DA 1YVOA 1XE4A 5F46A 3PEIA 1ZO0A 1KUYA 3CXPA 4OC1A 2WUUA 2FCKA 4PQAA 3GYAA 4X5KA 1IOIA 5K8MA 3B3SA 2JZFA 4Y49C 5LRGA 6CPAA 1KWMA 2HB6A 1S3ZA 3H8EA 4PXBA 5I0CA 3FXTA 4RI1A 2P6FA 4MJ8A 4UA3A 4U9ZA 1F57A 3ZZIA 3D7HA 4UFWA 4CYOA 4G1PA 3S9LA 2J9AA 1ELMP 5G20A 4CAXA 2PJ4A 5HMNA 3IIBA 2V8DA 4ZYQA 2OR4A 3GPOA 3B3VA 1I12A 3B7IA 2AFZA 3IJ3A 3NE7A 3WR7A 1XMTA 2XEJA 3CPAA 4XPDB 4C2XA 1X10A 3P2FA 4PK2A 3KL9A 4GUAA 5HH1A 3MN8A 1HEEA 4JLLA 4C2YA 2Z10A 4XPLA 1QSTA 4PXDA 3QB8A 1NE9A 5ISVA 3EW5A 2GU2A 2FIWA 1FNOA 2Z3LA 5J8FA 4NGQA 1IOFA 1ZLHA 2QJ8A 2JDCA 4CYPA 2AE6A 3EWPA 4ZY2A 1TF8A 1YLOA 5FSYA 3SIJA 3B3TA 1LCPA 3D8PA 3GY9A 3FECA 2FL4A 5K8PA 1S7FA 3KHXA 4DNCA 2LGRA 1IIDA 4NEXA 3R1KA 3R9GA 4C7HA 4UMLA 2CIJA 3PB8X 1CP6A 2Y0MA 4MFZA 3JRUA 3F8KA 2PR8A 2V8HA 2PSWA 3N7ZA 4KOWA 3FBUA 4R87A 4RS2A 4MCRA 4ZX9A 3NH5A 4Q7AA 3GPGA 2JBJA 2DEAA 3TTHA 3BXMA 3A9LA 3ETIA 5CPAA 2OZHA 4HNWB 2VRIA 1QSNA 1ZR5A 5CNPA 5EC4A 2G0BA 2Q44A 2IQ6A 4MI4A 2X7BA 3R96A 2B3UA 2FE7A 4IAVA 3KASA 2VZZA 3EFAA 4FBEA 5KTDA 1U6MA 2PRQA 3SI2A 5DWMA 1CPSA 5FSXA 1J4JA 4JXRA 5JH9A 2D4PA 2HUZA 1KZFA 5GCNA 2PDOA 3S6HA 4AB7A 2NSMA 2FXFA 3MGDA 2BSWA 1KUXA 2C6GA 4U5YA 5G22A 3FH4A 1HDQA 3ISXA 4CYQA 5IX3A 2ZW5A 3LODA 4B14A 2Q04A 4BINA 1Z8WA 1CP7A 2Z3KA 1YR0A 2J8MA 3V7ZA 3I9SA 2NMTA 3NH8A 5HVFA 1BOBA 4P4EA 3EXNA 2CNMA 4J3GA 4AG9A 4ESSA 4H2KA 4MHDA 4OLLA 4F8ZA 4JVVA 2RFHA 4CAFA 4CS0B 2IMOA 4FD4A 2WPXA 2B4DB 4JWPA 3IWEA 4WJBA 5H86A 2C6PA 1ELLP 5CB3A 3FNCA 4PXCA 4A30A 4UFVA 1QMUA 2FIAA 3PB4X 2OZGA 1Z8TA 4Q36A 4RN7A 3GPQA 2ODFA 1S7LA 3IU2A 4CGMA 4OAEA 2PJBA 3VH9A 3D7GA 3D7DA 2AFWA 4A31A 3D2PA 4KVOE 2PVVA 3JTKA 4NGRA 1Z2LA
chains in the Genus database with same CATH topology
1VIXA 4OIDA 4TU0A 4BD9A 1PCAA 1F2OA 4OMEA 4DJLA 4ABKA 3CPXA 2ABZA 1XBUA 2ZEDA 4J5RA 3HUVA 1VGYA 1ARMA 4MCPA 3NH4A 1ZG9A 4OC3A 4WWVA 5DS0A 3NA6A 1BAVA 4TNUA 3KR4A 3H8FA 1ZG8A 4JGKA 4EMEA 3BI0A 4PXEA 3SI1A 4EWTA 2OOTA 2AFMA 1Y7EA 4DYOA 5F09A 2FXKA 5LYIA 2WZNA 4LQGA 3LMSA 5FSUA 2FVGA 4FBEA 2CTBA 4P4DA 2V8GA 3D4UA 3S9NA 1CBXA 3TX8A 3WC6A 3SJXA 3GQEA 5HXDA 3PB7X 5CMSA 3I1UA 3SJEA 3JZTA 2ANPA 2AFSA 3ISZA 4MRIA 3DGVA 4R6TA 4UIAA 2CTCA 2DX6A 1BLLE 4X3RA 2O53A 1IGBA 5K8NA 3SIIA 4OKOA 1TKHA 3HLPA 5IB9A 2Q43A 1BPNA 1JQGA 3FVLA 1OBRA 4UIBA 3SI0A 1XJOA 2Q4ZA 1IY7A 2PE3A 4F9UA 3L2NA 4NJQA 2C6CA 2CF4A 2PJ7A 2XEFA 3EJGA 3VFQA 4R8FA 2BFRA 1SPVA 4UEEA 2ZEFA 1ZG7A 3IEHA 5HOLA 3B3CA 4CPAA 4ZY1A 1NSAA 3RZAA 1LANA 4IQYA 3FEEA 4MHNA 3DLJA 2GREA 3WT4A 4R7MA 2ZEOA 4NJRA 2PCUA 3B2YA 1NJRA 3PB9X 4YU9A 3KGQA 2ZOFA 3MRUA 2IJZA 4MMOA 4P10A 4Z65A 1CG2A 5CB5A 3FEDA 1BPMA 1PYTB 1YW4A 4GVWA 4OC2A 4NGMA 2EK8A 4K3NA 4ZI6A 3FMCA 2HC9A 2L8RA 1TXZA 5LYDA 2EEEA 4A94A 2PJ0A 2WYRA 4MHYA 3IWWA 3WC5A 4IHMA 3N5FA 3SJFA 4JZ0A 2PJ8A 3BI1A 5FSZA 1TY8A 4P4BA 2V8VA 3BHXA 4MCSA 4A39A 1Z5RA 2GLJA 2O4HA 2AFXA 3D7FA 3CT9A 2ZELA 3VATA 2ZEGA 5J1QA 3NFZA 2VL1A 2BOAA 3IIDA 4NGSA 4RUHA 7CPAA 1EE3P 2QVPA 4NGPA 2POKA 2C1CA 2EWBA 2ZENA 4GVVA 4KSIA 4ETJA 4YWYA 3B35A 3CDXA 3D68A 3EJFA 1LFWA 3WC7A 2PJ1A 1YMEA 3RBUA 1Z8LA 4P45A 3KI9A 3V2BA 4MHZA 4P4JA 4X2TA 4PPZA 4R76A 3EKEA 4J5SA 2F7VA 5CBMA 3FF3A 4GM5A 5LRJA 1CX8A 3KZWA 3H8GA 4JCAA 3PFEA 5DUSA 4UF4A 4ABLA 3GUXA 4O23A 1Y0YA 3SJGA 2PVWA 2QYVA 2BCOA 5JM6A 2F8HA 1ZR3A 3LWUA 1GYTA 1ARLA 3SIHA 4EFDA 1ZLIA 1VHUA 2PJ9A 4F9VA 2PJ5A 1TF9A 3GLJA 4ETKA 5K8OA 3GQOA 4K0CA 4NFRA 4TWEA 4MHPA 5HVGA 3V45A 4FUUA 3KQZA 2AFOA 3Q71A 2PIYA 2PJCA 2I3CA 2ZEPA 2PJ3A 1QQ9A 3IIFA 5E3BA 2JEWA 3EWQA 1CPXA 3IC1A 2XEIA 1TXRA 4P44A 3IFEA 3TC8A 5LYFA 1AYEA 4UEFA 4MCQA 3QNVA 3RAMA 5JGFA 4IK2A 2GLFA 4FAIA 1Y0RA 2V77A 4X8IA 3PRTA 3VARA 2FG1A 3KHZA 1R3NA 2ACFA 3B3WA 2XD7A 2AFUA 1TKFA 5FSVA 1VHEA 1HDUA 4P6YA 1UWYA 2RB7A 2JBKA 3KR5A 1VHOA 4D86A 5D8NA 1R43A 2PJ2A 4UEZA 3PFOA 3V38A 4AXVA 5D29A 2X47A 3KQXA 5JH9A 4NGTA 2Q51A 1AMPA 3PBBA 4P4IA 1XMBA 1DE4C 1H8LA 1YSJA 1FT7A 1YD9A 4J5QA 2XEGA 2PIZA 1TKJA 5LYLA 1XRYA 2ZEMA 2ZEHA 4OC4A 3WABA 3FJUA 2NYQA 1M4LA 3EWOA 2PJ6A 2BO9A 4P4FA 3EWRA 3SIGA 1DTDA 3D66A 3Q6ZA 5ELYA 3FX6A 3GB0A 4ONWA 4B6ZA 8CPAA 5LRKA 4KYBA 3PB6X 4NGNA 4A37A 4DUKA 4ZX8A 5AILA 4J4ZA 3PBEA 4OIWA 5THWA 5HVHA 4OP4A 1LAMA 2EK9A 4OC0A 4FWUA 1F2PA 1LAPA 4A38A 3IO1A 4ZY0A 1XFOA 1RTQA 1Q7LA 4MXUA 3K9TA 4OC5A 5HIHA 3T8WA 2PJAA 4JYWA 4W9YA 1LOKA 2ZOGA 3K2KA 2AFCA 1YW6A 2BFQA 3D67A 5I4MA 1HJZA 3S9MA 2FAVA 2ZEEA 2G9DA 3PEIA 4OC1A 4PQAA 5K8MA 3B3SA 6CPAA 5LRGA 1KWMA 2HB6A 3H8EA 4PXBA 1F57A 3D7HA 4G1PA 3S9LA 2J9AA 1ELMP 2PJ4A 3IIBA 2V8DA 4ZYQA 2OR4A 3GPOA 3B3VA 3B7IA 2AFZA 3IJ3A 2XEJA 3CPAA 3KL9A 4GUAA 3MN8A 1HEEA 4JLLA 4PXDA 3EW5A 2GU2A 1FNOA 4NGQA 1ZLHA 2QJ8A 3B3TA 3EWPA 4ZY2A 1TF8A 1YLOA 5FSYA 3SIJA 1LCPA 3FECA 5K8PA 3KHXA 2LGRA 4UMLA 2CIJA 3PB8X 1CP6A 3JRUA 2V8HA 4MCRA 4ZX9A 3NH5A 4Q7AA 3GPGA 2JBJA 2DEAA 3BXMA 3ETIA 5CPAA 2VRIA 1ZR5A 2IQ6A 4IAVA 3KASA 2PRQA 3SI2A 1CPSA 5FSXA 2NSMA 2C6GA 3FH4A 1HDQA 3ISXA 1CP7A 3V7ZA 5HVFA 3NH8A 4P4EA 4ESSA 4H2KA 4F8ZA 4JVVA 2RFHA 2IMOA 4WJBA 2C6PA 1ELLP 5CB3A 4PXCA 1QMUA 3PB4X 3GPQA 3VH9A 2PJBA 3D7GA 3D7DA 2AFWA 2PVVA 4NGRA 1Z2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIX A;  4OID A;  4TU0 A;  4BD9 A;  1PCA A;  1F2O A;  4OME A;  4DJL A;  4ABK A;  3CPX A;  2ABZ A;  1XBU A;  2ZED A;  4J5R A;  3HUV A;  1VGY A;  1ARM A;  4MCP A;  3NH4 A;  1ZG9 A;  4OC3 A;  4WWV A;  5DS0 A;  3NA6 A;  1BAV A;  4TNU A;  3KR4 A;  3H8F A;  1ZG8 A;  4JGK A;  4EME A;  3BI0 A;  4PXE A;  3SI1 A;  4EWT A;  2OOT A;  2AFM A;  1Y7E A;  4DYO A;  5F09 A;  2FXK A;  5LYI A;  2WZN A;  4LQG A;  3LMS A;  5FSU A;  2FVG A;  4FBE A;  2CTB A;  4P4D A;  2V8G A;  3D4U A;  3S9N A;  1CBX A;  3TX8 A;  3WC6 A;  3SJX A;  3GQE A;  5HXD A;  3PB7 X;  5CMS A;  3I1U A;  3SJE A;  3JZT A;  2ANP A;  2AFS A;  3ISZ A;  4MRI A;  3DGV A;  4R6T A;  4UIA A;  2CTC A;  2DX6 A;  1BLL E;  4X3R A;  2O53 A;  1IGB A;  5K8N A;  3SII A;  4OKO A;  1TKH A;  3HLP A;  5IB9 A;  2Q43 A;  1BPN A;  1JQG A;  3FVL A;  1OBR A;  4UIB A;  3SI0 A;  1XJO A;  2Q4Z A;  1IY7 A;  2PE3 A;  4F9U A;  3L2N A;  4NJQ A;  2C6C A;  2CF4 A;  2PJ7 A;  2XEF A;  3EJG A;  3VFQ A;  4R8F A;  2BFR A;  1SPV A;  4UEE A;  2ZEF A;  1ZG7 A;  3IEH A;  5HOL A;  3B3C A;  4CPA A;  4ZY1 A;  1NSA A;  3RZA A;  1LAN A;  4IQY A;  3FEE A;  4MHN A;  3DLJ A;  2GRE A;  3WT4 A;  4R7M A;  2ZEO A;  4NJR A;  2PCU A;  3B2Y A;  1NJR A;  3PB9 X;  4YU9 A;  3KGQ A;  2ZOF A;  3MRU A;  2IJZ A;  4MMO A;  4P10 A;  4Z65 A;  1CG2 A;  5CB5 A;  3FED A;  1BPM A;  1PYT B;  1YW4 A;  4GVW A;  4OC2 A;  4NGM A;  2EK8 A;  4K3N A;  4ZI6 A;  3FMC A;  2HC9 A;  2L8R A;  1TXZ A;  5LYD A;  2EEE A;  4A94 A;  2PJ0 A;  2WYR A;  4MHY A;  3IWW A;  3WC5 A;  4IHM A;  3N5F A;  3SJF A;  4JZ0 A;  2PJ8 A;  3BI1 A;  5FSZ A;  1TY8 A;  4P4B A;  2V8V A;  3BHX A;  4MCS A;  4A39 A;  1Z5R A;  2GLJ A;  2O4H A;  2AFX A;  3D7F A;  3CT9 A;  2ZEL A;  3VAT A;  2ZEG A;  5J1Q A;  3NFZ A;  2VL1 A;  2BOA A;  3IID A;  4NGS A;  4RUH A;  7CPA A;  1EE3 P;  2QVP A;  4NGP A;  2POK A;  2C1C A;  2EWB A;  2ZEN A;  4GVV A;  4KSI A;  4ETJ A;  4YWY A;  3B35 A;  3CDX A;  3D68 A;  3EJF A;  1LFW A;  3WC7 A;  2PJ1 A;  1YME A;  3RBU A;  1Z8L A;  4P45 A;  3KI9 A;  3V2B A;  4MHZ A;  4P4J A;  4X2T A;  4PPZ A;  4R76 A;  3EKE A;  4J5S A;  2F7V A;  5CBM A;  3FF3 A;  4GM5 A;  5LRJ A;  1CX8 A;  3KZW A;  3H8G A;  4JCA A;  3PFE A;  5DUS A;  4UF4 A;  4ABL A;  3GUX A;  4O23 A;  1Y0Y A;  3SJG A;  2PVW A;  2QYV A;  2BCO A;  5JM6 A;  2F8H A;  1ZR3 A;  3LWU A;  1GYT A;  1ARL A;  3SIH A;  4EFD A;  1ZLI A;  1VHU A;  2PJ9 A;  4F9V A;  2PJ5 A;  1TF9 A;  3GLJ A;  4ETK A;  5K8O A;  3GQO A;  4K0C A;  4NFR A;  4TWE A;  4MHP A;  5HVG A;  3V45 A;  4FUU A;  3KQZ A;  2AFO A;  3Q71 A;  2PIY A;  2PJC A;  2I3C A;  2ZEP A;  2PJ3 A;  1QQ9 A;  3IIF A;  5E3B A;  2JEW A;  3EWQ A;  1CPX A;  3IC1 A;  2XEI A;  1TXR A;  4P44 A;  3IFE A;  3TC8 A;  5LYF A;  1AYE A;  4UEF A;  4MCQ A;  3QNV A;  3RAM A;  5JGF A;  4IK2 A;  2GLF A;  4FAI A;  1Y0R A;  2V77 A;  4X8I A;  3PRT A;  3VAR A;  2FG1 A;  3KHZ A;  1R3N A;  2ACF A;  3B3W A;  2XD7 A;  2AFU A;  1TKF A;  5FSV A;  1VHE A;  1HDU A;  4P6Y A;  1UWY A;  2RB7 A;  2JBK A;  3KR5 A;  1VHO A;  4D86 A;  5D8N A;  1R43 A;  2PJ2 A;  4UEZ A;  3PFO A;  3V38 A;  4AXV A;  5D29 A;  2X47 A;  3KQX A;  5JH9 A;  4NGT A;  2Q51 A;  1AMP A;  3PBB A;  4P4I A;  1XMB A;  1DE4 C;  1H8L A;  1YSJ A;  1FT7 A;  1YD9 A;  4J5Q A;  2XEG A;  2PIZ A;  1TKJ A;  5LYL A;  1XRY A;  2ZEM A;  2ZEH A;  4OC4 A;  3WAB A;  3FJU A;  2NYQ A;  1M4L A;  3EWO A;  2PJ6 A;  2BO9 A;  4P4F A;  3EWR A;  3SIG A;  1DTD A;  3D66 A;  3Q6Z A;  5ELY A;  3FX6 A;  3GB0 A;  4ONW A;  4B6Z A;  8CPA A;  5LRK A;  4KYB A;  3PB6 X;  4NGN A;  4A37 A;  4DUK A;  4ZX8 A;  5AIL A;  4J4Z A;  3PBE A;  4OIW A;  5THW A;  5HVH A;  4OP4 A;  1LAM A;  2EK9 A;  4OC0 A;  4FWU A;  1F2P A;  1LAP A;  4A38 A;  3IO1 A;  4ZY0 A;  1XFO A;  1RTQ A;  1Q7L A;  4MXU A;  3K9T A;  4OC5 A;  5HIH A;  3T8W A;  2PJA A;  4JYW A;  4W9Y A;  1LOK A;  2ZOG A;  3K2K A;  2AFC A;  1YW6 A;  2BFQ A;  3D67 A;  5I4M A;  1HJZ A;  3S9M A;  2FAV A;  2ZEE A;  2G9D A;  3PEI A;  4OC1 A;  4PQA A;  5K8M A;  3B3S A;  6CPA A;  5LRG A;  1KWM A;  2HB6 A;  3H8E A;  4PXB A;  1F57 A;  3D7H A;  4G1P A;  3S9L A;  2J9A A;  1ELM P;  2PJ4 A;  3IIB A;  2V8D A;  4ZYQ A;  2OR4 A;  3GPO A;  3B3V A;  3B7I A;  2AFZ A;  3IJ3 A;  2XEJ A;  3CPA A;  3KL9 A;  4GUA A;  3MN8 A;  1HEE A;  4JLL A;  4PXD A;  3EW5 A;  2GU2 A;  1FNO A;  4NGQ A;  1ZLH A;  2QJ8 A;  3B3T A;  3EWP A;  4ZY2 A;  1TF8 A;  1YLO A;  5FSY A;  3SIJ A;  1LCP A;  3FEC A;  5K8P A;  3KHX A;  2LGR A;  4UML A;  2CIJ A;  3PB8 X;  1CP6 A;  3JRU A;  2V8H A;  4MCR A;  4ZX9 A;  3NH5 A;  4Q7A A;  3GPG A;  2JBJ A;  2DEA A;  3BXM A;  3ETI A;  5CPA A;  2VRI A;  1ZR5 A;  2IQ6 A;  4IAV A;  3KAS A;  2PRQ A;  3SI2 A;  1CPS A;  5FSX A;  2NSM A;  2C6G A;  3FH4 A;  1HDQ A;  3ISX A;  1CP7 A;  3V7Z A;  5HVF A;  3NH8 A;  4P4E A;  4ESS A;  4H2K A;  4F8Z A;  4JVV A;  2RFH A;  2IMO A;  4WJB A;  2C6P A;  1ELL P;  5CB3 A;  4PXC A;  1QMU A;  3PB4 X;  3GPQ A;  3VH9 A;  2PJB A;  3D7G A;  3D7D A;  2AFW A;  2PVV A;  4NGR A;  1Z2L A; 
#chains in the Genus database with same CATH topology
 1VIX A;  2DPS A;  4YRH A;  4OID A;  3QAH A;  4TU0 A;  4BD9 A;  1PCA A;  1F2O A;  3IU1 A;  4KLV A;  4OME A;  4ABK A;  4DJL A;  3CPX A;  2ABZ A;  1XBU A;  2ZED A;  1S5K A;  4J5R A;  3HUV A;  2R7H A;  2KQV A;  1VGY A;  4M6G A;  4ZBG A;  1ARM A;  4HNY B;  4MCP A;  1K4J A;  2F5I A;  3OWC A;  4KOR A;  4LUA A;  3NH4 A;  4A33 A;  4F6A A;  2EVN A;  1ZG9 A;  5BWA B;  4OC3 A;  4WWV A;  2ZW4 A;  5DS0 A;  2HQY A;  3NA6 A;  2Z3M A;  2Q0Y A;  4L8A A;  2I00 A;  1BAV A;  5G21 A;  4TNU A;  3EY5 A;  3KR4 A;  3H8F A;  1R57 A;  4QBJ A;  1ZG8 A;  5J8C A;  4NSQ A;  1RO5 A;  4JGK A;  3T90 A;  4EME A;  2B3V A;  3BI0 A;  5DWN A;  4FD7 A;  4PXE A;  3SI1 A;  4EWT A;  2VZY A;  2AFM A;  4KOY A;  4H6U A;  4MFK A;  2OOT A;  1Y7E A;  3R9E A;  5A28 A;  2B58 A;  4DYO A;  2AJ6 A;  5F09 A;  2FXK A;  5LYI A;  3RYO A;  2WZN A;  3NE8 A;  4LQG A;  2ZW7 A;  3KKW A;  3LMS A;  4M85 A;  3PGP A;  3UY5 A;  5FSU A;  2ARH A;  2FVG A;  2CTB A;  4P4D A;  4M6H A;  3W6S A;  1M4I A;  2V8G A;  1IU8 A;  2A4N A;  3D4U A;  1XEB A;  4CGO A;  3S9N A;  1CBX A;  2R1I A;  3TX8 A;  3EC4 A;  3GQE A;  3SJX A;  3PB7 X;  5CMS A;  3WC6 A;  4CAE A;  5HXD A;  4AG7 A;  5JQ4 A;  3I1U A;  3SJE A;  1Y7R A;  1YQE A;  3JZT A;  1RXT A;  2ANP A;  2AFS A;  3ISZ A;  3DSB A;  4MRI A;  3DGV A;  4R6T A;  4UCM A;  2VEZ A;  2CTC A;  3D2M A;  4UIA A;  2YNE A;  4A2Z A;  2DX6 A;  1BLL E;  4KOS A;  4X3R A;  2O53 A;  1IGB A;  3BJ7 A;  2J8N A;  4LQ6 A;  2CXA A;  4BBH A;  4QUS A;  4JJX A;  3DDD A;  3PZJ A;  3TT2 A;  5K8N A;  4F0X A;  1XIX A;  3SII A;  4CGN A;  4OKO A;  2YGW A;  2BEI A;  3DR6 A;  1TKH A;  3HLP A;  4LX9 A;  5IB0 A;  2JZD A;  4PK3 A;  2Q43 A;  5IB9 A;  1MJ9 A;  1LRZ A;  1BPN A;  1JQG A;  3FVL A;  1OBR A;  4UIB A;  3SI0 A;  1XJO A;  2Q4Z A;  1IY7 A;  2PE3 A;  3DNS A;  4F9U A;  3L2N A;  1I21 A;  4HPS A;  1GHE A;  2C6C A;  2PQ8 A;  2PR1 A;  4NJQ A;  2CF4 A;  5AGE A;  2PJ7 A;  5C88 A;  2XEF A;  3EJG A;  3H5Z A;  2Z0Z A;  4E8O A;  3VFQ A;  4R8F A;  2BFR A;  1NSL A;  1SPV A;  4XNH B;  4E2A A;  5EMI A;  4A95 A;  4FD6 A;  4UEE A;  4B13 A;  4ZGY B;  2ZEF A;  4MFJ A;  4KS9 A;  4U9Y A;  4YGO A;  4ORF A;  1M4G A;  1ZG7 A;  2OH1 A;  1Y9W A;  2IL4 A;  5E96 A;  3IEH A;  4AXV A;  5HOL A;  3B3C A;  2VXK A;  4CPA A;  1NSA A;  4ZY1 A;  1N71 A;  2P0W A;  3BJ8 A;  3RZA A;  4F0Y A;  1LAN A;  4IQY A;  3FEE A;  2FT0 A;  2VBQ A;  2Z3O A;  4MHN A;  3I3G A;  2GRE A;  3DLJ A;  3WT4 A;  4R7M A;  3EO4 A;  2ZEO A;  1TIQ A;  4NJR A;  2PCU A;  3W91 A;  3P2H A;  5AG7 A;  3B2Y A;  1NJR A;  4KUB A;  1IIC A;  3PB9 X;  4YU9 A;  1Q2C A;  3KGQ A;  2ZOF A;  3CXS A;  4IF5 A;  3MRU A;  3TCV A;  2FS5 A;  2IJZ A;  3W6X A;  2K5T A;  4MMO A;  4P10 A;  2GIV A;  4JD6 A;  1CG2 A;  4Z65 A;  5CB5 A;  3FED A;  3RNZ A;  3R9F A;  2ZW6 A;  1BPM A;  1QSO A;  1PYT B;  1YW4 A;  3TO7 A;  4AVC A;  4Q38 A;  4GXH A;  4GVW A;  4OC2 A;  4CGP A;  4NGM A;  5KTC A;  2B4B A;  2EK8 A;  4FD5 A;  5F49 A;  4K3N A;  2OB0 A;  2Q4V A;  1XF8 A;  4ZI6 A;  3FMC A;  2HC9 A;  4CGL A;  2L8R A;  1TXZ A;  5LYD A;  1S7K A;  4KOT A;  4B5P A;  2EEE A;  2Z3N A;  4XPK A;  2PJ0 A;  5AG5 A;  4A94 A;  2W2G A;  2WYR A;  4MHY A;  4R9M A;  2B5G B;  3IWW A;  4AVA A;  4NXY A;  3WC5 A;  3JVN A;  4B12 A;  4IHM A;  3TE4 A;  3N5F A;  4GS4 A;  3SJF A;  4JZ0 A;  2PJ8 A;  3BI1 A;  2VI7 A;  5F47 A;  5H84 A;  4CRZ B;  3GKR A;  5FSZ A;  1TY8 A;  4P4B A;  2V8V A;  2QEC A;  1CJW A;  3BHX A;  3CZX A;  4MCS A;  1Z5R A;  2DPT A;  5FVJ A;  4A39 A;  2GLJ A;  2O4H A;  2AFX A;  3D7F A;  1PUA A;  3CT9 A;  2EUI A;  3TFY A;  1S60 A;  2ZEL A;  1YX0 A;  4BMH A;  2CY2 A;  3VAT A;  2ZEG A;  1I1D A;  5J1Q A;  3NFZ A;  2VL1 A;  4XNH C;  2BOA A;  3VWD A;  1B87 A;  1QSR A;  1Z8X A;  2BUE A;  2QIR A;  3IID A;  4NGS A;  2YND A;  2HV2 A;  1A2Z A;  4H89 A;  1EE3 P;  2QVP A;  4RUH A;  7CPA A;  3PP9 A;  4NGP A;  2POK A;  2C1C A;  2EWB A;  2ZEN A;  3S6F A;  3CXQ A;  4GVV A;  2P6G A;  4KSI A;  4MY3 A;  4ETJ A;  4YWY A;  1NMT A;  4B5P B;  3B35 A;  3CDX A;  3D68 A;  4QB9 A;  2ZPA A;  3EJF A;  5IV0 A;  1LFW A;  3K9U A;  3WC7 A;  4KOU A;  2PJ1 A;  1YME A;  1YVK A;  4JXQ A;  4CRY B;  2REE A;  3G8W A;  4KLW A;  4YFJ A;  2I79 A;  4OAD A;  3RBU A;  4MFL A;  1Z8L A;  4P45 A;  3KI9 A;  3V2B A;  4MHZ A;  4P4J A;  4X2T A;  4PPZ A;  4R76 A;  3EKE A;  4J5S A;  5JPH A;  1YK3 A;  2F7V A;  2G3T A;  3B8G A;  4CAV A;  1X12 A;  3FYN A;  5CBM A;  4B10 A;  3FF3 A;  4GM5 A;  5LRJ A;  1CX8 A;  4H6Z A;  3KZW A;  3H8G A;  4JCA A;  1VHS A;  3PFE A;  5DUS A;  4KVM E;  4UF4 A;  4ABL A;  3DR8 A;  3GUX A;  5F48 A;  4O23 A;  1Y0Y A;  3SJG A;  4E0A A;  2PVW A;  1S7N A;  3TOA A;  2QYV A;  2WPW A;  2KCW A;  2BCO A;  5JM6 A;  2Q7S A;  3GIU A;  4ONU A;  4PV6 A;  4I49 A;  1M4D A;  5KTA A;  1IYL A;  1IYK A;  1WK4 A;  2F8H A;  1VKC A;  1ZR3 A;  3LWU A;  5A27 A;  5G1Z A;  2O28 A;  1GYT A;  1MJB A;  1ARL A;  2Z3P A;  3LAC A;  4UCP A;  3F0A A;  3SIH A;  2GAN A;  4EFD A;  1ZLI A;  1VHU A;  2PJ9 A;  4F9V A;  2FSR A;  2PJ5 A;  1TF9 A;  4CAW A;  4C7I A;  3GLJ A;  1WWZ A;  4ETK A;  3V8I A;  5K8O A;  3GQO A;  4MBU A;  4K0C A;  4NFR A;  4TWE A;  2ZXV A;  2B5G A;  4MHP A;  5HVG A;  3FIX A;  3V45 A;  4II9 A;  4FUU A;  5AG6 A;  3KQZ A;  2AFO A;  3Q71 A;  3T9Y A;  2PIY A;  4KOV A;  4PSX A;  2PJC A;  2I3C A;  1B6B A;  3SHP A;  2EO8 A;  1JWQ A;  2ZEP A;  2PJ3 A;  1FY7 A;  1QQ9 A;  3IIF A;  4HKF A;  4UBR A;  5AG4 A;  3F5B A;  5E3B A;  2JEW A;  2PC1 A;  4JLY A;  3EWQ A;  1CPX A;  3IC1 A;  2XEI A;  1TXR A;  4P44 A;  1YGH A;  3IFE A;  3TC8 A;  1Z4E A;  3TO6 A;  5LYF A;  1AYE A;  4UEF A;  2JDD A;  4MCQ A;  1YRE A;  3QNV A;  2WSA A;  3RAM A;  5JGF A;  2B4D A;  2GLF A;  4IK2 A;  4QVT A;  2YNC A;  4FAI A;  4UWI A;  3C26 A;  1Y0R A;  2RC4 A;  2V77 A;  4X8I A;  1UFH A;  3PRT A;  3VAR A;  2FG1 A;  3G3S A;  1R3N A;  3KHZ A;  4KSF A;  4M6I A;  2ACF A;  1OZP A;  1MK4 A;  3B3W A;  1CM0 A;  2XD7 A;  2AFU A;  1TKF A;  5FSV A;  1Q2D A;  1VHE A;  1HDU A;  1M1D A;  4P6Y A;  1UWY A;  2H5M A;  2JBK A;  2REF A;  3KR5 A;  1VHO A;  2RB7 A;  1Z9U A;  3FB3 A;  3IGR A;  4R3K A;  1KUV A;  1M44 A;  4D86 A;  2D4O A;  5D8N A;  1R43 A;  2PJ2 A;  4R3L A;  4B11 A;  3ZJ0 A;  2C27 A;  3PFO A;  4UEZ A;  3SXN A;  1P0H A;  3TOB A;  3V38 A;  1L0C A;  2X47 A;  3KQX A;  1BO4 A;  4NGT A;  5D29 A;  4QC6 A;  2Q51 A;  4UWJ A;  5EBV A;  1AMP A;  1IB1 E;  1ON0 A;  1QSM A;  3PBB A;  4P4I A;  1PU9 A;  1XMB A;  3VWE A;  4R57 A;  1DE4 C;  2GFQ A;  1H8L A;  1P4N A;  1YSJ A;  4M3S A;  4MFP A;  4MY0 A;  1SQH A;  5C82 A;  2RNK A;  1FT7 A;  4EVY A;  1YD9 A;  4J5Q A;  4MFQ A;  2XEG A;  2PIZ A;  1TKJ A;  3S6G A;  3S6K A;  5LYL A;  2R8V A;  1XRY A;  4HNX B;  4AVB A;  2ZEM A;  2ZEH A;  4OC4 A;  3WAB A;  3FJU A;  2NYQ A;  1Q2Y A;  1M4L A;  4KVX A;  3EWO A;  4XPD C;  2PJ6 A;  2BO9 A;  4C2Z A;  4C68 A;  4KSA A;  2ATR A;  4P4F A;  3EWR A;  3SIG A;  2BL1 A;  2GE3 A;  1DTD A;  1Y9K A;  3D66 A;  2JLM A;  3FRM A;  3D3S A;  3TO9 A;  3Q6Z A;  5ELY A;  3R95 A;  3FX6 A;  3GB0 A;  3QAY A;  4ONW A;  4B6Z A;  4KUA A;  4B5O A;  4CYN A;  8CPA A;  5LRK A;  4KYB A;  3PB6 X;  4NGN A;  2R98 A;  2DXQ A;  2OZU A;  3H4Q A;  2JEV A;  1AUG A;  4A37 A;  4DUK A;  4ZX8 A;  4J4Z A;  5AIL A;  2QML A;  3PBE A;  4OIW A;  5THW A;  3RO0 A;  5HVH A;  4OP4 A;  1LAM A;  4NF1 A;  2DF5 A;  2VQY A;  2EK9 A;  4OC0 A;  4FWU A;  1F2P A;  1LAP A;  2CNT A;  2YNC C;  4A38 A;  3LD2 A;  4PSW A;  3IO1 A;  4ZY0 A;  1YLE A;  2G3A A;  2WCT A;  1XFO A;  1RTQ A;  1Q7L A;  1XOV A;  2OU2 A;  2PRB A;  4K30 A;  4MXU A;  3K9T A;  4UFX A;  3IWG A;  4OC5 A;  3SXO A;  5HIH A;  3T8W A;  2CNS A;  2J8R A;  2PJA A;  3E0K A;  4JYW A;  4W9Y A;  1LOK A;  4UCN A;  2ZOG A;  3K2K A;  2AFC A;  2Z11 A;  4L89 A;  2Q7B A;  1YW6 A;  2BFQ A;  4IUS A;  3JUW A;  2JZE A;  4Y49 B;  1MJA A;  2Q4Y A;  3BLN A;  3D67 A;  1Z4R A;  1V0C A;  2P6E A;  4KOX A;  5I4M A;  1HJZ A;  2EBJ A;  3S9M A;  2FAV A;  4NCZ A;  4A32 A;  2ZEE A;  4KZT A;  2G9D A;  1YVO A;  1XE4 A;  5F46 A;  3PEI A;  1ZO0 A;  1KUY A;  3CXP A;  4OC1 A;  2WUU A;  2FCK A;  4PQA A;  3GYA A;  4X5K A;  1IOI A;  5K8M A;  3B3S A;  2JZF A;  4Y49 C;  5LRG A;  6CPA A;  1KWM A;  2HB6 A;  1S3Z A;  3H8E A;  4PXB A;  5I0C A;  3FXT A;  4RI1 A;  2P6F A;  4MJ8 A;  4UA3 A;  4U9Z A;  1F57 A;  3ZZI A;  3D7H A;  4UFW A;  4CYO A;  4G1P A;  3S9L A;  2J9A A;  1ELM P;  5G20 A;  4CAX A;  2PJ4 A;  5HMN A;  3IIB A;  2V8D A;  4ZYQ A;  2OR4 A;  3GPO A;  3B3V A;  1I12 A;  3B7I A;  2AFZ A;  3IJ3 A;  3NE7 A;  3WR7 A;  1XMT A;  2XEJ A;  3CPA A;  4XPD B;  4C2X A;  1X10 A;  3P2F A;  4PK2 A;  3KL9 A;  4GUA A;  5HH1 A;  3MN8 A;  1HEE A;  4JLL A;  4C2Y A;  2Z10 A;  4XPL A;  1QST A;  4PXD A;  3QB8 A;  1NE9 A;  5ISV A;  3EW5 A;  2GU2 A;  2FIW A;  1FNO A;  2Z3L A;  5J8F A;  4NGQ A;  1IOF A;  1ZLH A;  2QJ8 A;  2JDC A;  4CYP A;  2AE6 A;  3EWP A;  4ZY2 A;  1TF8 A;  1YLO A;  5FSY A;  3SIJ A;  3B3T A;  1LCP A;  3D8P A;  3GY9 A;  3FEC A;  2FL4 A;  5K8P A;  1S7F A;  3KHX A;  4DNC A;  2LGR A;  1IID A;  4NEX A;  3R1K A;  3R9G A;  4C7H A;  4UML A;  2CIJ A;  3PB8 X;  1CP6 A;  2Y0M A;  4MFZ A;  3JRU A;  3F8K A;  2PR8 A;  2V8H A;  2PSW A;  3N7Z A;  4KOW A;  3FBU A;  4R87 A;  4RS2 A;  4MCR A;  4ZX9 A;  3NH5 A;  4Q7A A;  3GPG A;  2JBJ A;  2DEA A;  3TTH A;  3BXM A;  3A9L A;  3ETI A;  5CPA A;  2OZH A;  4HNW B;  2VRI A;  1QSN A;  1ZR5 A;  5CNP A;  5EC4 A;  2G0B A;  2Q44 A;  2IQ6 A;  4MI4 A;  2X7B A;  3R96 A;  2B3U A;  2FE7 A;  4IAV A;  3KAS A;  2VZZ A;  3EFA A;  4FBE A;  5KTD A;  1U6M A;  2PRQ A;  3SI2 A;  5DWM A;  1CPS A;  5FSX A;  1J4J A;  4JXR A;  5JH9 A;  2D4P A;  2HUZ A;  1KZF A;  5GCN A;  2PDO A;  3S6H A;  4AB7 A;  2NSM A;  2FXF A;  3MGD A;  2BSW A;  1KUX A;  2C6G A;  4U5Y A;  5G22 A;  3FH4 A;  1HDQ A;  3ISX A;  4CYQ A;  5IX3 A;  2ZW5 A;  3LOD A;  4B14 A;  2Q04 A;  4BIN A;  1Z8W A;  1CP7 A;  2Z3K A;  1YR0 A;  2J8M A;  3V7Z A;  3I9S A;  2NMT A;  3NH8 A;  5HVF A;  1BOB A;  4P4E A;  3EXN A;  2CNM A;  4J3G A;  4AG9 A;  4ESS A;  4H2K A;  4MHD A;  4OLL A;  4F8Z A;  4JVV A;  2RFH A;  4CAF A;  4CS0 B;  2IMO A;  4FD4 A;  2WPX A;  2B4D B;  4JWP A;  3IWE A;  4WJB A;  5H86 A;  2C6P A;  1ELL P;  5CB3 A;  3FNC A;  4PXC A;  4A30 A;  4UFV A;  1QMU A;  2FIA A;  3PB4 X;  2OZG A;  1Z8T A;  4Q36 A;  4RN7 A;  3GPQ A;  2ODF A;  1S7L A;  3IU2 A;  4CGM A;  4OAE A;  2PJB A;  3VH9 A;  3D7G A;  3D7D A;  2AFW A;  4A31 A;  3D2P A;  4KVO E;  2PVV A;  3JTK A;  4NGR A;  1Z2L A; 
#chains in the Genus database with same CATH homology
 1VIX A;  4OID A;  4TU0 A;  4BD9 A;  1PCA A;  1F2O A;  4OME A;  4DJL A;  4ABK A;  3CPX A;  2ABZ A;  1XBU A;  2ZED A;  4J5R A;  3HUV A;  1VGY A;  1ARM A;  4MCP A;  3NH4 A;  1ZG9 A;  4OC3 A;  4WWV A;  5DS0 A;  3NA6 A;  1BAV A;  4TNU A;  3KR4 A;  3H8F A;  1ZG8 A;  4JGK A;  4EME A;  3BI0 A;  4PXE A;  3SI1 A;  4EWT A;  2OOT A;  2AFM A;  1Y7E A;  4DYO A;  5F09 A;  2FXK A;  5LYI A;  2WZN A;  4LQG A;  3LMS A;  5FSU A;  2FVG A;  4FBE A;  2CTB A;  4P4D A;  2V8G A;  3D4U A;  3S9N A;  1CBX A;  3TX8 A;  3WC6 A;  3SJX A;  3GQE A;  5HXD A;  3PB7 X;  5CMS A;  3I1U A;  3SJE A;  3JZT A;  2ANP A;  2AFS A;  3ISZ A;  4MRI A;  3DGV A;  4R6T A;  4UIA A;  2CTC A;  2DX6 A;  1BLL E;  4X3R A;  2O53 A;  1IGB A;  5K8N A;  3SII A;  4OKO A;  1TKH A;  3HLP A;  5IB9 A;  2Q43 A;  1BPN A;  1JQG A;  3FVL A;  1OBR A;  4UIB A;  3SI0 A;  1XJO A;  2Q4Z A;  1IY7 A;  2PE3 A;  4F9U A;  3L2N A;  4NJQ A;  2C6C A;  2CF4 A;  2PJ7 A;  2XEF A;  3EJG A;  3VFQ A;  4R8F A;  2BFR A;  1SPV A;  4UEE A;  2ZEF A;  1ZG7 A;  3IEH A;  5HOL A;  3B3C A;  4CPA A;  4ZY1 A;  1NSA A;  3RZA A;  1LAN A;  4IQY A;  3FEE A;  4MHN A;  3DLJ A;  2GRE A;  3WT4 A;  4R7M A;  2ZEO A;  4NJR A;  2PCU A;  3B2Y A;  1NJR A;  3PB9 X;  4YU9 A;  3KGQ A;  2ZOF A;  3MRU A;  2IJZ A;  4MMO A;  4P10 A;  4Z65 A;  1CG2 A;  5CB5 A;  3FED A;  1BPM A;  1PYT B;  1YW4 A;  4GVW A;  4OC2 A;  4NGM A;  2EK8 A;  4K3N A;  4ZI6 A;  3FMC A;  2HC9 A;  2L8R A;  1TXZ A;  5LYD A;  2EEE A;  4A94 A;  2PJ0 A;  2WYR A;  4MHY A;  3IWW A;  3WC5 A;  4IHM A;  3N5F A;  3SJF A;  4JZ0 A;  2PJ8 A;  3BI1 A;  5FSZ A;  1TY8 A;  4P4B A;  2V8V A;  3BHX A;  4MCS A;  4A39 A;  1Z5R A;  2GLJ A;  2O4H A;  2AFX A;  3D7F A;  3CT9 A;  2ZEL A;  3VAT A;  2ZEG A;  5J1Q A;  3NFZ A;  2VL1 A;  2BOA A;  3IID A;  4NGS A;  4RUH A;  7CPA A;  1EE3 P;  2QVP A;  4NGP A;  2POK A;  2C1C A;  2EWB A;  2ZEN A;  4GVV A;  4KSI A;  4ETJ A;  4YWY A;  3B35 A;  3CDX A;  3D68 A;  3EJF A;  1LFW A;  3WC7 A;  2PJ1 A;  1YME A;  3RBU A;  1Z8L A;  4P45 A;  3KI9 A;  3V2B A;  4MHZ A;  4P4J A;  4X2T A;  4PPZ A;  4R76 A;  3EKE A;  4J5S A;  2F7V A;  5CBM A;  3FF3 A;  4GM5 A;  5LRJ A;  1CX8 A;  3KZW A;  3H8G A;  4JCA A;  3PFE A;  5DUS A;  4UF4 A;  4ABL A;  3GUX A;  4O23 A;  1Y0Y A;  3SJG A;  2PVW A;  2QYV A;  2BCO A;  5JM6 A;  2F8H A;  1ZR3 A;  3LWU A;  1GYT A;  1ARL A;  3SIH A;  4EFD A;  1ZLI A;  1VHU A;  2PJ9 A;  4F9V A;  2PJ5 A;  1TF9 A;  3GLJ A;  4ETK A;  5K8O A;  3GQO A;  4K0C A;  4NFR A;  4TWE A;  4MHP A;  5HVG A;  3V45 A;  4FUU A;  3KQZ A;  2AFO A;  3Q71 A;  2PIY A;  2PJC A;  2I3C A;  2ZEP A;  2PJ3 A;  1QQ9 A;  3IIF A;  5E3B A;  2JEW A;  3EWQ A;  1CPX A;  3IC1 A;  2XEI A;  1TXR A;  4P44 A;  3IFE A;  3TC8 A;  5LYF A;  1AYE A;  4UEF A;  4MCQ A;  3QNV A;  3RAM A;  5JGF A;  4IK2 A;  2GLF A;  4FAI A;  1Y0R A;  2V77 A;  4X8I A;  3PRT A;  3VAR A;  2FG1 A;  3KHZ A;  1R3N A;  2ACF A;  3B3W A;  2XD7 A;  2AFU A;  1TKF A;  5FSV A;  1VHE A;  1HDU A;  4P6Y A;  1UWY A;  2RB7 A;  2JBK A;  3KR5 A;  1VHO A;  4D86 A;  5D8N A;  1R43 A;  2PJ2 A;  4UEZ A;  3PFO A;  3V38 A;  4AXV A;  5D29 A;  2X47 A;  3KQX A;  5JH9 A;  4NGT A;  2Q51 A;  1AMP A;  3PBB A;  4P4I A;  1XMB A;  1DE4 C;  1H8L A;  1YSJ A;  1FT7 A;  1YD9 A;  4J5Q A;  2XEG A;  2PIZ A;  1TKJ A;  5LYL A;  1XRY A;  2ZEM A;  2ZEH A;  4OC4 A;  3WAB A;  3FJU A;  2NYQ A;  1M4L A;  3EWO A;  2PJ6 A;  2BO9 A;  4P4F A;  3EWR A;  3SIG A;  1DTD A;  3D66 A;  3Q6Z A;  5ELY A;  3FX6 A;  3GB0 A;  4ONW A;  4B6Z A;  8CPA A;  5LRK A;  4KYB A;  3PB6 X;  4NGN A;  4A37 A;  4DUK A;  4ZX8 A;  5AIL A;  4J4Z A;  3PBE A;  4OIW A;  5THW A;  5HVH A;  4OP4 A;  1LAM A;  2EK9 A;  4OC0 A;  4FWU A;  1F2P A;  1LAP A;  4A38 A;  3IO1 A;  4ZY0 A;  1XFO A;  1RTQ A;  1Q7L A;  4MXU A;  3K9T A;  4OC5 A;  5HIH A;  3T8W A;  2PJA A;  4JYW A;  4W9Y A;  1LOK A;  2ZOG A;  3K2K A;  2AFC A;  1YW6 A;  2BFQ A;  3D67 A;  5I4M A;  1HJZ A;  3S9M A;  2FAV A;  2ZEE A;  2G9D A;  3PEI A;  4OC1 A;  4PQA A;  5K8M A;  3B3S A;  6CPA A;  5LRG A;  1KWM A;  2HB6 A;  3H8E A;  4PXB A;  1F57 A;  3D7H A;  4G1P A;  3S9L A;  2J9A A;  1ELM P;  2PJ4 A;  3IIB A;  2V8D A;  4ZYQ A;  2OR4 A;  3GPO A;  3B3V A;  3B7I A;  2AFZ A;  3IJ3 A;  2XEJ A;  3CPA A;  3KL9 A;  4GUA A;  3MN8 A;  1HEE A;  4JLL A;  4PXD A;  3EW5 A;  2GU2 A;  1FNO A;  4NGQ A;  1ZLH A;  2QJ8 A;  3B3T A;  3EWP A;  4ZY2 A;  1TF8 A;  1YLO A;  5FSY A;  3SIJ A;  1LCP A;  3FEC A;  5K8P A;  3KHX A;  2LGR A;  4UML A;  2CIJ A;  3PB8 X;  1CP6 A;  3JRU A;  2V8H A;  4MCR A;  4ZX9 A;  3NH5 A;  4Q7A A;  3GPG A;  2JBJ A;  2DEA A;  3BXM A;  3ETI A;  5CPA A;  2VRI A;  1ZR5 A;  2IQ6 A;  4IAV A;  3KAS A;  2PRQ A;  3SI2 A;  1CPS A;  5FSX A;  2NSM A;  2C6G A;  3FH4 A;  1HDQ A;  3ISX A;  1CP7 A;  3V7Z A;  5HVF A;  3NH8 A;  4P4E A;  4ESS A;  4H2K A;  4F8Z A;  4JVV A;  2RFH A;  2IMO A;  4WJB A;  2C6P A;  1ELL P;  5CB3 A;  4PXC A;  1QMU A;  3PB4 X;  3GPQ A;  3VH9 A;  2PJB A;  3D7G A;  3D7D A;  2AFW A;  2PVV A;  4NGR A;  1Z2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...