4ZY2A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10o
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
519
structure length
519
Chain Sequence
b'ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable M17 family aminopeptidase
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
total genus 178
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zy2A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zy2A02
4MCRA 3IIDA 3WC6A 2XEFA 2ZEOA 3I1UA 5J1QA 3KQXA 2EEEA 3ETIA 2IMOA 3FJUA 4P6YA 2QJ8A 4ZX8A 2G9DA 5DUSA 4NJQA 2GLJA 2I3CA 1F2OA 2JBKA 1UWYA 4ESSA 4OP4A 3EJGA 2PJ1A 4MMOA 5LRKA 2ACFA 4ZI6A 1R43A 4OC2A 5HXDA 3BHXA 4A37A 1LOKA 3CPXA 2O4HA 1BLLE 3FMCA 3VH9A 4NGSA 4Q7AA 1TKFA 3EWPA 2Q43A 1QMUA 3IEHA 1TF8A 5LYLA 5K8PA 2FXKA 4OKOA 3BI0A 4PQAA 3FEDA 4IK2A 4MHPA 3PEIA 4P10A 4TU0A 5K8NA 1ZG7A 4P45A 3IIFA 2O53A 4P4FA 2NYQA 4KYBA 4ZY2A 3FF3A 3GQEA 2V8VA 1XJOA 4PXCA 4ETKA 2NSMA 4NGRA 3N5FA 5I4MA 4OC1A 5IB9A 4P4IA 2CTCA 3CDXA 3K9TA 4AXVA 2DEAA 5DS0A 3HLPA 2PJCA 4GM5A 3JRUA 3H8GA 5CMSA 3KASA 3B3CA 3WABA 3D4UA 4ZY1A 2AFXA 3KR4A 3D7GA 1FT7A 3D7HA 4B6ZA 3JZTA 2LGRA 4UEFA 4DUKA 3PB7X 4R8FA 2ZEPA 1YLOA 2AFWA 3SIIA 3GPGA 4R76A 1CPSA 3LWUA 4MHZA 4PXEA 4H2KA 3BXMA 5HVFA 1CBXA 4R6TA 2C6GA 4IQYA 1CX8A 3B3TA 2PRQA 5AILA 4JZ0A 3S9LA 3H8EA 1YD9A 4R7MA 3SIJA 2XEGA 4MHYA 5LRGA 4OIDA 2IQ6A 1CP7A 3V45A 1YW6A 3B3SA 3EKEA 1ARLA 1M4LA 2ZEDA 4OIWA 1LFWA 4JGKA 3FX6A 1HJZA 4ABLA 3WC5A 5HOLA 1DE4C 4K0CA 1HEEA 3V38A 5JH9A 1CPXA 2HC9A 2PE3A 4UEZA 1Y7EA 1Y0YA 2AFOA 5FSZA 1F2PA 1IGBA 3B3VA 2BFRA 2VRIA 1BPMA 1QQ9A 4UIAA 4G1PA 4ABKA 3KHXA 2ZEHA 5CB3A 3VARA 5CBMA 1ARMA 1VIXA 5F09A 1YMEA 5JM6A 3IO1A 3KI9A 4NFRA 4BD9A 3VATA 1Z5RA 2PVWA 3TC8A 2ZEFA 1VGYA 3ISZA 3V7ZA 3GUXA 4Z65A 3EWOA 4RUHA 3SI1A 4IHMA 4YU9A 1CP6A 1LAPA 2PJ9A 3PBEA 3SIGA 1PCAA 1SPVA 2AFMA 1HDQA 4F9UA 7CPAA 2V8DA 2ZEMA 3PFOA 4NGMA 3SJEA 4A39A 2PJ3A 1BPNA 3SJGA 1LCPA 1JQGA 4TNUA 3RBUA 2GREA 4WJBA 2V77A 2PVVA 3D7DA 4MRIA 2PJ2A 2QVPA 3NH5A 4ZY0A 3PRTA 4P4JA 2ZOFA 3IC1A 2CIJA 2EWBA 3FEEA 3IIBA 4O23A 4OC5A 4UIBA 2IJZA 2PIZA 3NFZA 2EK8A 2RB7A 4FUUA 1TXZA 4GUAA 1NSAA 3Q71A 3BI1A 2XEJA 3SI0A 1YW4A 4GVVA 3IFEA 4FWUA 1EE3P 3FH4A 4EWTA 4A94A 4F8ZA 3WT4A 2F8HA 4P4DA 4UF4A 3SJXA 3T8WA 1ZLHA 4OMEA 5D8NA 1R3NA 2FG1A 5D29A 4NGTA 2OOTA 1ELMP 2ZEGA 4P4BA 1VHEA 2OR4A 4J5RA 2GU2A 3IWWA 4J4ZA 5LYDA 3QNVA 1DTDA 2ZELA 1ZLIA 3PBBA 3PB4X 3EWRA 1HDUA 2V8HA 2C1CA 2PJBA 1XRYA 1TF9A 3ISXA 2DX6A 3CT9A 4ZYQA 2AFSA 1AYEA 4PXDA 1Q7LA 1PYTB 1Z2LA 2EK9A 3B7IA 5HVHA 2X47A 4DJLA 4K3NA 5FSVA 2PIYA 3PFEA 2C6PA 1H8LA 4NGPA 2C6CA 4JCAA 3KHZA 2F7VA 1F57A 2AFZA 4OC0A 2BCOA 3IJ3A 3GQOA 2CF4A 2Q51A 4OC3A 3MRUA 3KGQA 2BOAA 4MHNA 2WYRA 2JEWA 3RZAA 1ZG9A 4X8IA 4ONWA 2VL1A 3KZWA 5HVGA 2CTBA 5FSXA 5LRJA 2PJ8A 4P44A 5THWA 4F9VA 3D68A 3KR5A 4TWEA 4EMEA 1GYTA 2PJ4A 4NJRA 3D7FA 4X2TA 3SI2A 3S9NA 4W9YA 1NJRA 3KQZA 4YWYA 4MXUA 1XFOA 2JBJA 3EWQA 2ANPA 3GLJA 5JGFA 5ELYA 2J9AA 1TKJA 1TXRA 2POKA 4NGNA 4EFDA 2ABZA 3DGVA 4NGQA 3D67A 2WZNA 1VHOA 5FSYA 4GVWA 2ZOGA 5E3BA 1FNOA 4ETJA 4UMLA 1ELLP 3GB0A 2FAVA 4CPAA 2XD7A 2AFCA 3PB9X 4MCSA 3EW5A 3D66A 4P4EA 2ZENA 4FAIA 3KL9A 5K8OA 5CB5A 3NA6A 1YSJA 4UEEA 1KWMA 1Y0RA 2HB6A 4A38A 1IY7A 1VHUA 4J5QA 5LYFA 1TKHA 4PXBA 1LANA 3V2BA 2L8RA 5LYIA 3TX8A 4J5SA 2PJ7A 1ZR3A 3PB6X 4MCQA 2Q4ZA 1Z8LA 3Q6ZA 3WC7A 2QYVA 2AFUA 4PPZA 4MCPA 2PJ5A 1LAMA 5CPAA 1BAVA 3SIHA 3B2YA 1ZG8A 2BFQA 3GPOA 1XMBA 4LQGA 3B35A 2FVGA 3DLJA 3S9MA 3CPAA 2RFHA 3VFQA 1XBUA 5HIHA 4X3RA 4D86A 4JLLA 3HUVA 1CG2A 3LMSA 3NH8A 4JYWA 4JVVA 3FVLA 4IAVA 4ZX9A 3K2KA 4DYOA 4WWVA 8CPAA 4KSIA 2BO9A 3L2NA 2GLFA 3H8FA 5K8MA 3FECA 2PCUA 3GPQA 1OBRA 4OC4A 2V8GA 3RAMA 2XEIA 1RTQA 1AMPA 4FBEA 2PJAA 3MN8A 3SJFA 6CPAA 1TY8A 3NH4A 3PB8X 5FSUA 2PJ6A 2PJ0A 2ZEEA 3B3WA 3EJFA 1ZR5A
chains in the Genus database with same CATH superfamily
4MCRA 3IIDA 2WPXA 2EVNA 4MHDA 4UCPA 5KTCA 1S60A 3WC6A 2XEFA 3TO9A 2ZEOA 3I1UA 5J1QA 2OZGA 3KQXA 2EEEA 4A32A 3LODA 3P2FA 2FE7A 3ETIA 2IMOA 3FJUA 4P6YA 2QJ8A 4ZX8A 2G9DA 4MJ8A 2YNCA 1QSMA 3EC4A 4R9MA 5DUSA 4NJQA 2GLJA 2I3CA 1F2OA 2JBKA 3D2MA 1UWYA 3TO7A 4ESSA 4CYNA 3B3WA 4OP4A 1IIDA 3EJGA 1IB1E 2PJ1A 2ACFA 4MMOA 2C27A 1Q2YA 2Z3NA 4KUBA 4ZI6A 1R43A 4OC2A 1J4JA 5E96A 5HXDA 3BHXA 2JEVA 4A37A 1LOKA 4M85A 1QSOA 3CPXA 2O4HA 1BLLE 2QECA 3FMCA 3G3SA 4KSFA 4NGSA 4Q7AA 4XNHB 4UBRA 3VH9A 1TKFA 4A33A 4CAXA 3EWPA 3SXNA 2Q43A 1QMUA 3IEHA 2IL4A 2FIAA 4UCMA 4MY3A 2J8MA 4CRZB 1TF8A 5LYLA 2EBJA 5AG6A 2FXKA 4OKOA 3BI0A 2PQ8A 4PQAA 1QSTA 5F47A 2Q0YA 4FD7A 3R96A 4QBJA 2HUZA 3FEDA 4IK2A 1Z9UA 2R98A 4MHPA 3PEIA 2BL1A 4U9ZA 2P6EA 3T9YA 4P10A 4TU0A 5K8NA 2VQYA 3CXQA 4OADA 2Q4YA 1OZPA 1ZG7A 4P45A 3IU2A 3IIFA 1BOBA 2O53A 4P4FA 4MFZA 1BO4A 2NYQA 4KYBA 4ZY2A 2FS5A 2GANA 5FVJA 3FF3A 4YFJA 4HKFA 2QIRA 1M1DA 2R8VA 2CY2A 3PP9A 3GQEA 2ODFA 3MGDA 2G3AA 4JJXA 4B5OA 2V8VA 1XJOA 4PXCA 5AG5A 2FCKA 2Z3KA 4KOTA 4ETKA 2NSMA 1YVOA 4MFJA 2RC4A 2X7BA 2OU2A 2OZUA 4NGRA 3N5FA 5I4MA 4BINA 4OC1A 5IB9A 4P4IA 2CTCA 3CDXA 4DNCA 1YREA 3K9TA 4AXVA 1WK4A 1XE4A 2DEAA 2OB0A 4AVAA 1Z4RA 5DS0A 5AG7A 4CYOA 3HLPA 2Q04A 1XEBA 2J8RA 2PJCA 3QB8A 3DR8A 4EFDA 4GM5A 3JRUA 4MY0A 5LRKA 1XMTA 3H8GA 5CMSA 3KASA 3B3CA 3WABA 3KKWA 2REEA 3D8PA 1XOVA 1KZFA 4BBHA 2B4BA 4QB9A 3EO4A 3D4UA 5A27A 4QUSA 4ZY1A 2AFXA 3KR4A 4CGMA 1I1DA 3D7GA 1S7KA 1FT7A 3TFYA 4KOXA 4CYQA 4KOVA 3D7HA 4B6ZA 1GHEA 3JZTA 4LX9A 2LGRA 3TE4A 3BJ7A 4UEFA 4II9A 4DUKA 3PB7X 4R8FA 2ZEPA 1YLOA 2AFWA 4CGPA 4RS2A 3PZJA 4JLYA 3SIIA 3GPGA 4UFWA 5GCNA 4CGOA 3FB3A 4R76A 1CPSA 3LWUA 1YLEA 2YGWA 4MHZA 4PXEA 4H2KA 3S6HA 3V8IA 3BXMA 5HVFA 1CBXA 4R6TA 1KUVA 2C6GA 4IQYA 4L8AA 4IUSA 1CX8A 3B3TA 2PRQA 2G3TA 3SHPA 5AILA 4IF5A 5F48A 2H5MA 2O28A 4JZ0A 3TT2A 3S9LA 3H8EA 5CNPA 2JZDA 3FRMA 4UFXA 1YD9A 4R7MA 3SIJA 1I21A 4KLWA 2XEGA 4MHYA 2W2GA 1B87A 2ZW7A 4MFKA 4OIDA 5LRGA 2IQ6A 1CP7A 3V45A 1YW6A 3B3SA 5KTDA 3EKEA 1ARLA 2CXAA 1M4LA 2YNEA 2AE6A 4F0XA 2ZEDA 3G8WA 3WR7A 4C2ZA 4OIWA 1S7LA 1LFWA 1V0CA 3GY9A 4JGKA 3FX6A 2PR8A 1HJZA 4ABLA 2BEIA 3WC5A 3S6FA 5HOLA 1L0CA 1A2ZA 1DE4C 4K0CA 1HEEA 2B3VA 3V38A 4CAFA 2WUUA 5JH9A 1CPXA 2HC9A 1IYLA 2PE3A 4UEZA 4CGNA 4RI1A 4NEXA 1Y7EA 1Y9KA 4CAWA 1Y0YA 2AFOA 3TOBA 4R57A 1N71A 5FSZA 1F2PA 1IGBA 1MJBA 3B3VA 4AVBA 4HPSA 4C2XA 2Q4VA 1XIXA 2BFRA 2VRIA 2JZEA 2PR1A 4B5PA 1BPMA 4C7IA 1QQ9A 2FSRA 4UIAA 4M6HA 4E2AA 1M4GA 5JQ4A 3SXOA 2PDOA 4G1PA 5HMNA 4ABKA 1QSNA 2Q7SA 1Z4EA 4KOUA 1MJAA 2ZEHA 5CB3A 3KHXA 3VARA 2ATRA 3D2PA 5CBMA 1ARMA 5EC4A 1VIXA 1YVKA 5F09A 1YMEA 5JM6A 3TO6A 2DXQA 5G1ZA 3IO1A 3KI9A 4B11A 4B13A 4NFRA 1S5KA 4BD9A 3VATA 1Z5RA 2DF5A 3W91A 3FBUA 3C26A 2PVWA 4QC6A 4F0YA 5EBVA 3TC8A 5BWAB 1Q2DA 2ZEFA 3JTKA 3E0KA 1VGYA 3ISZA 2DPTA 3H5ZA 4F6AA 3V7ZA 1MK4A 3GUXA 1NSLA 4Z65A 2B4DB 3EWOA 4HNYB 2P0WA 4RUHA 3SI1A 5J8FA 2ZW5A 4IHMA 4YU9A 1CP6A 2B5GB 1LAPA 5C82A 1LRZA 3PBEA 3SIGA 1B6BA 4M3SA 1P0HA 4AG9A 1PCAA 4U9YA 4GXHA 5JPHA 2Z3PA 1SPVA 2AFMA 5AGEA 1HDQA 1SQHA 2VZZA 4F9UA 7CPAA 2V8DA 1RO5A 2ZEMA 3PFOA 4NGMA 4YRHA 2PJ3A 4UWIA 3S6GA 1BPNA 3H4QA 3SJEA 4A39A 3FXTA 3SJGA 2QMLA 1LCPA 1JQGA 4TNUA 4KVOE 2YNCC 5ISVA 3RBUA 5IB0A 1IOIA 2GREA 2V77A 4JD6A 2PVVA 3D7DA 4LQ6A 4MRIA 4WJBA 4Y49C 2PJ2A 4A30A 2R1IA 2QVPA 3NH5A 4KOYA 1Z8WA 4ZY0A 2PRBA 2Z10A 3CXSA 2D4OA 2OH1A 3PRTA 4P4JA 3RO0A 2ZOFA 3IC1A 4CAEA 5AG4A 2CIJA 2EWBA 3FEEA 3IIBA 3PGPA 4O23A 4OC5A 4UIBA 4H89A 4UWJA 2GE3A 2IJZA 2PIZA 3N7ZA 1M4IA 4H6UA 4NSQA 2CNTA 3NFZA 1S7FA 4CGLA 2I00A 2EK8A 4HNXB 3R1KA 2RB7A 4FUUA 1TXZA 4GUAA 1NSAA 2JLMA 1NMTA 1ON0A 3Q71A 3BI1A 2XEJA 3SI0A 1YW4A 4M6GA 4GVVA 3IFEA 4JXQA 4FWUA 4ORFA 2Z3OA 3UY5A 5C88A 1EE3P 3FH4A 3QAYA 2B3UA 4LUAA 4QVTA 4MFLA 4EWTA 3FIXA 4A94A 4AVCA 4F8ZA 2ZPAA 3FNCA 3GIUA 2F8HA 3WT4A 4P4DA 4UF4A 3SJXA 3T8WA 1ZLHA 4OMEA 3ZZIA 5D8NA 1R3NA 5F46A 3R9EA 5H86A 2REFA 4XPLA 2FG1A 2WPWA 2Q7BA 5D29A 4NGTA 2OOTA 1ELMP 2ZEGA 4I49A 4PSWA 1VHSA 4P4BA 3FYNA 1VHEA 3R95A 2OR4A 4J5RA 2Z3MA 2GU2A 3IWWA 4J4ZA 2CNSA 4HNWB 4UA3A 5LYDA 3QNVA 1Y7RA 2JDDA 4Y49B 1DTDA 3NE7A 3IWEA 3TTHA 2ZELA 1ZLIA 3JVNA 3PBBA 2A4NA 3PB4X 2Z11A 4X5KA 3EWRA 1Z8XA 1HDUA 4EVYA 5A28A 3ZJ0A 3F8KA 3GKRA 2V8HA 2C1CA 3IU1A 2PJBA 4A95A 1XRYA 1CM0A 2GIVA 1TF9A 2KQVA 4PV6A 3ISXA 1P4NA 4GS4A 2DX6A 3CT9A 4ZYQA 1S3ZA 4NF1A 2AFSA 2D4PA 2HQYA 1Z8TA 2P6FA 1AYEA 4ONUA 4PXDA 1Q7LA 1PYTB 1Z2LA 2EK9A 4A2ZA 4CS0B 3B7IA 5HVHA 2X47A 5DWMA 3I9SA 2J8NA 3VWDA 4DJLA 3CZXA 4K3NA 5FSVA 1QSRA 2PIYA 3PFEA 4JXRA 2C6PA 1H8LA 2VEZA 5H84A 4NGPA 2C6CA 4XPKA 4YGOA 4UFVA 4JCAA 3KHZA 2F7VA 2DPSA 2FT0A 3I3GA 2B58A 1F57A 3W6SA 2AFZA 4MBUA 2BCOA 4OC0A 5G20A 3R9GA 1IYKA 4H6ZA 3IJ3A 2Q44A 3JUWA 3GQOA 3DR6A 4KSAA 2CF4A 2Q51A 4OC3A 5HH1A 3MRUA 2CNMA 2OZHA 4AG7A 3KGQA 2BOAA 4PK2A 4MHNA 3T90A 2WYRA 2JZFA 4R3KA 2JEWA 5I0CA 2FL4A 3B8GA 3RZAA 1ZG9A 1VKCA 2AJ6A 2I79A 4BMHA 4E0AA 2Z0ZA 4X8IA 3QAHA 5G21A 4ONWA 2VL1A 4KVXA 2EO8A 4U5YA 3NE8A 3KZWA 2P6GA 2CTBA 4AB7A 5HVGA 5K8PA 1WWZA 5FSXA 5LRJA 4FD4A 4C7HA 5F49A 2ZXVA 2PJ8A 3OWCA 1PUAA 1X12A 3DDDA 1I12A 4CRYB 4P44A 5THWA 5IX3A 4F9VA 3D68A 3KR5A 4TWEA 4EMEA 1K4JA 1GYTA 2PJ4A 4NJRA 3D7FA 4X2TA 3SI2A 4C2YA 5J8CA 3S9NA 4W9YA 1NJRA 3KQZA 1Y9WA 4KS9A 1IU8A 4YWYA 4MXUA 1XFOA 2JBJA 1M4DA 3EWQA 2ANPA 2ZW6A 3GLJA 4KZTA 5JGFA 5ELYA 2J9AA 1TKJA 1TXRA 2POKA 2WSAA 3D3SA 3F0AA 4NGNA 4B14A 1JWQA 1RXTA 2ABZA 3DGVA 4NGQA 3D67A 2WZNA 1VHOA 1KUYA 2VBQA 4PSXA 1S7NA 1FY7A 5FSYA 4GVWA 2ZOGA 5E3BA 4KUAA 1FNOA 4ETJA 4MI4A 5DWNA 4KVME 5IV0A 4UMLA 4FD5A 3A9LA 2KCWA 1ELLP 5KTAA 4C68A 3GB0A 2FAVA 3DSBA 1M44A 4RN7A 4CPAA 2XD7A 2AFCA 3PB9X 4MCSA 2K5TA 3EW5A 1U6MA 2G0BA 3D66A 4P4EA 2ZENA 4FAIA 3LACA 2BSWA 3KL9A 5CB5A 5K8OA 1YR0A 3NA6A 1YSJA 4UEEA 4J3GA 1KWMA 1Y0RA 4KOSA 4CAVA 2HB6A 4A38A 2YNDA 1IY7A 1VHUA 4J5QA 4KLVA 2RNKA 4ZGYB 1AUGA 3IGRA 1TKHA 3EXNA 5LYFA 4B10A 4PXBA 4Q38A 1LANA 1IICA 3V2BA 2L8RA 5LYIA 3TX8A 4J5SA 4NXYA 2PJ7A 1ZR3A 3PB6X 4MCQA 2Q4ZA 4KOWA 1Z8LA 3W6XA 3Q6ZA 3WC7A 2QYVA 2AFUA 1PU9A 1CJWA 1YX0A 4PPZA 4MCPA 2PJ5A 1LAMA 5CPAA 1BAVA 3SIHA 3B2YA 3RYOA 1ZG8A 3DNSA 2BFQA 1YK3A 2B4DA 4M6IA 3GPOA 1XMBA 1TIQA 3F5BA 4LQGA 4UCNA 4ZBGA 3B35A 3LD2A 2FVGA 4FD6A 3DLJA 3S9MA 2PC1A 2PSWA 4MFPA 2Y0MA 3CPAA 2B5GA 3VFQA 1XBUA 2RFHA 4OLLA 4Q36A 4XPDC 5HIHA 4X3RA 4CYPA 1YQEA 4D86A 3TCVA 3CXPA 3TOAA 3BJ8A 3VWEA 4B5PB 4JLLA 3HUVA 3IWGA 4NCZA 3EY5A 4A31A 1CG2A 3LMSA 3NH8A 4JYWA 4JVVA 3FVLA 3P2HA 2VI7A 4IAVA 4ZX9A 1R57A 2GFQA 3K2KA 4R3LA 4DYOA 4WWVA 5EMIA 2R7HA 8CPAA 4JWPA 3K9UA 1IOFA 2ARHA 3EFAA 4KSIA 2FXFA 2VXKA 4OAEA 3S6KA 2NMTA 2F5IA 2BUEA 2BO9A 2ZW4A 3L2NA 2FIWA 2GLFA 3GYAA 3H8FA 1ZO0A 1NE9A 5K8MA 3FECA 4KORA 2PCUA 4E8OA 3GPQA 1OBRA 1UFHA 4OC4A 4XNHC 2V8GA 3RAMA 2XEIA 1RTQA 2HV2A 1AMPA 1MJ9A 3R9FA 4K30A 4PK3A 4FBEA 1YGHA 2PJAA 4R87A 3RNZA 3MN8A 4L89A 2WCTA 1XF8A 4B12A 3SJFA 6CPAA 1TY8A 2VZYA 3NH4A 3PB8X 1KUXA 5FSUA 4MFQA 1X10A 4XPDB 1Q2CA 2EUIA 2PJ6A 2JDCA 3BLNA 2Z3LA 2PJ0A 2ZEEA 2PJ9A 3EJFA 5G22A 1ZR5A
chains in the Genus database with same CATH topology
4MCRA 3IIDA 3WC6A 2XEFA 2ZEOA 3I1UA 5J1QA 3KQXA 2EEEA 3ETIA 2IMOA 3FJUA 4P6YA 2QJ8A 4ZX8A 2G9DA 5DUSA 4NJQA 2GLJA 2I3CA 1F2OA 2JBKA 1UWYA 4ESSA 4OP4A 3EJGA 2PJ1A 4MMOA 5LRKA 2ACFA 4ZI6A 1R43A 4OC2A 5HXDA 3BHXA 4A37A 1LOKA 3CPXA 2O4HA 1BLLE 3FMCA 3VH9A 4NGSA 4Q7AA 1TKFA 3EWPA 2Q43A 1QMUA 3IEHA 1TF8A 5LYLA 5K8PA 2FXKA 4OKOA 3BI0A 4PQAA 3FEDA 4IK2A 4MHPA 3PEIA 4P10A 4TU0A 5K8NA 1ZG7A 4P45A 3IIFA 2O53A 4P4FA 2NYQA 4KYBA 4ZY2A 3FF3A 3GQEA 2V8VA 1XJOA 4PXCA 4ETKA 2NSMA 4NGRA 3N5FA 5I4MA 4OC1A 5IB9A 4P4IA 2CTCA 3CDXA 3K9TA 4AXVA 2DEAA 5DS0A 3HLPA 2PJCA 4GM5A 3JRUA 3H8GA 5CMSA 3KASA 3B3CA 3WABA 3D4UA 4ZY1A 2AFXA 3KR4A 3D7GA 1FT7A 3D7HA 4B6ZA 3JZTA 2LGRA 4UEFA 4DUKA 3PB7X 4R8FA 2ZEPA 1YLOA 2AFWA 3SIIA 3GPGA 4R76A 1CPSA 3LWUA 4MHZA 4PXEA 4H2KA 3BXMA 5HVFA 1CBXA 4R6TA 2C6GA 4IQYA 1CX8A 3B3TA 2PRQA 5AILA 4JZ0A 3S9LA 3H8EA 1YD9A 4R7MA 3SIJA 2XEGA 4MHYA 5LRGA 4OIDA 2IQ6A 1CP7A 3V45A 1YW6A 3B3SA 3EKEA 1ARLA 1M4LA 2ZEDA 4OIWA 1LFWA 4JGKA 3FX6A 1HJZA 4ABLA 3WC5A 5HOLA 1DE4C 4K0CA 1HEEA 3V38A 5JH9A 1CPXA 2HC9A 2PE3A 4UEZA 1Y7EA 1Y0YA 2AFOA 5FSZA 1F2PA 1IGBA 3B3VA 2BFRA 2VRIA 1BPMA 1QQ9A 4UIAA 4G1PA 4ABKA 3KHXA 2ZEHA 5CB3A 3VARA 5CBMA 1ARMA 1VIXA 5F09A 1YMEA 5JM6A 3IO1A 3KI9A 4NFRA 4BD9A 3VATA 1Z5RA 2PVWA 3TC8A 2ZEFA 1VGYA 3ISZA 3V7ZA 3GUXA 4Z65A 3EWOA 4RUHA 3SI1A 4IHMA 4YU9A 1CP6A 1LAPA 2PJ9A 3PBEA 3SIGA 1PCAA 1SPVA 2AFMA 1HDQA 4F9UA 7CPAA 2V8DA 2ZEMA 3PFOA 4NGMA 3SJEA 4A39A 2PJ3A 1BPNA 3SJGA 1LCPA 1JQGA 4TNUA 3RBUA 2GREA 4WJBA 2V77A 2PVVA 3D7DA 4MRIA 2PJ2A 2QVPA 3NH5A 4ZY0A 3PRTA 4P4JA 2ZOFA 3IC1A 2CIJA 2EWBA 3FEEA 3IIBA 4O23A 4OC5A 4UIBA 2IJZA 2PIZA 3NFZA 2EK8A 2RB7A 4FUUA 1TXZA 4GUAA 1NSAA 3Q71A 3BI1A 2XEJA 3SI0A 1YW4A 4GVVA 3IFEA 4FWUA 1EE3P 3FH4A 4EWTA 4A94A 4F8ZA 3WT4A 2F8HA 4P4DA 4UF4A 3SJXA 3T8WA 1ZLHA 4OMEA 5D8NA 1R3NA 2FG1A 5D29A 4NGTA 2OOTA 1ELMP 2ZEGA 4P4BA 1VHEA 2OR4A 4J5RA 2GU2A 3IWWA 4J4ZA 5LYDA 3QNVA 1DTDA 2ZELA 1ZLIA 3PBBA 3PB4X 3EWRA 1HDUA 2V8HA 2C1CA 2PJBA 1XRYA 1TF9A 3ISXA 2DX6A 3CT9A 4ZYQA 2AFSA 1AYEA 4PXDA 1Q7LA 1PYTB 1Z2LA 2EK9A 3B7IA 5HVHA 2X47A 4DJLA 4K3NA 5FSVA 2PIYA 3PFEA 2C6PA 1H8LA 4NGPA 2C6CA 4JCAA 3KHZA 2F7VA 1F57A 2AFZA 4OC0A 2BCOA 3IJ3A 3GQOA 2CF4A 2Q51A 4OC3A 3MRUA 3KGQA 2BOAA 4MHNA 2WYRA 2JEWA 3RZAA 1ZG9A 4X8IA 4ONWA 2VL1A 3KZWA 5HVGA 2CTBA 5FSXA 5LRJA 2PJ8A 4P44A 5THWA 4F9VA 3D68A 3KR5A 4TWEA 4EMEA 1GYTA 2PJ4A 4NJRA 3D7FA 4X2TA 3SI2A 3S9NA 4W9YA 1NJRA 3KQZA 4YWYA 4MXUA 1XFOA 2JBJA 3EWQA 2ANPA 3GLJA 5JGFA 5ELYA 2J9AA 1TKJA 1TXRA 2POKA 4NGNA 4EFDA 2ABZA 3DGVA 4NGQA 3D67A 2WZNA 1VHOA 5FSYA 4GVWA 2ZOGA 5E3BA 1FNOA 4ETJA 4UMLA 1ELLP 3GB0A 2FAVA 4CPAA 2XD7A 2AFCA 3PB9X 4MCSA 3EW5A 3D66A 4P4EA 2ZENA 4FAIA 3KL9A 5K8OA 5CB5A 3NA6A 1YSJA 4UEEA 1KWMA 1Y0RA 2HB6A 4A38A 1IY7A 1VHUA 4J5QA 5LYFA 1TKHA 4PXBA 1LANA 3V2BA 2L8RA 5LYIA 3TX8A 4J5SA 2PJ7A 1ZR3A 3PB6X 4MCQA 2Q4ZA 1Z8LA 3Q6ZA 3WC7A 2QYVA 2AFUA 4PPZA 4MCPA 2PJ5A 1LAMA 5CPAA 1BAVA 3SIHA 3B2YA 1ZG8A 2BFQA 3GPOA 1XMBA 4LQGA 3B35A 2FVGA 3DLJA 3S9MA 3CPAA 2RFHA 3VFQA 1XBUA 5HIHA 4X3RA 4D86A 4JLLA 3HUVA 1CG2A 3LMSA 3NH8A 4JYWA 4JVVA 3FVLA 4IAVA 4ZX9A 3K2KA 4DYOA 4WWVA 8CPAA 4KSIA 2BO9A 3L2NA 2GLFA 3H8FA 5K8MA 3FECA 2PCUA 3GPQA 1OBRA 4OC4A 2V8GA 3RAMA 2XEIA 1RTQA 1AMPA 4FBEA 2PJAA 3MN8A 3SJFA 6CPAA 1TY8A 3NH4A 3PB8X 5FSUA 2PJ6A 2PJ0A 2ZEEA 3B3WA 3EJFA 1ZR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MCR A;  3IID A;  3WC6 A;  2XEF A;  2ZEO A;  3I1U A;  5J1Q A;  3KQX A;  2EEE A;  3ETI A;  2IMO A;  3FJU A;  4P6Y A;  2QJ8 A;  4ZX8 A;  2G9D A;  5DUS A;  4NJQ A;  2GLJ A;  2I3C A;  1F2O A;  2JBK A;  1UWY A;  4ESS A;  4OP4 A;  3EJG A;  2PJ1 A;  4MMO A;  5LRK A;  2ACF A;  4ZI6 A;  1R43 A;  4OC2 A;  5HXD A;  3BHX A;  4A37 A;  1LOK A;  3CPX A;  2O4H A;  1BLL E;  3FMC A;  3VH9 A;  4NGS A;  4Q7A A;  1TKF A;  3EWP A;  2Q43 A;  1QMU A;  3IEH A;  1TF8 A;  5LYL A;  5K8P A;  2FXK A;  4OKO A;  3BI0 A;  4PQA A;  3FED A;  4IK2 A;  4MHP A;  3PEI A;  4P10 A;  4TU0 A;  5K8N A;  1ZG7 A;  4P45 A;  3IIF A;  2O53 A;  4P4F A;  2NYQ A;  4KYB A;  4ZY2 A;  3FF3 A;  3GQE A;  2V8V A;  1XJO A;  4PXC A;  4ETK A;  2NSM A;  4NGR A;  3N5F A;  5I4M A;  4OC1 A;  5IB9 A;  4P4I A;  2CTC A;  3CDX A;  3K9T A;  4AXV A;  2DEA A;  5DS0 A;  3HLP A;  2PJC A;  4GM5 A;  3JRU A;  3H8G A;  5CMS A;  3KAS A;  3B3C A;  3WAB A;  3D4U A;  4ZY1 A;  2AFX A;  3KR4 A;  3D7G A;  1FT7 A;  3D7H A;  4B6Z A;  3JZT A;  2LGR A;  4UEF A;  4DUK A;  3PB7 X;  4R8F A;  2ZEP A;  1YLO A;  2AFW A;  3SII A;  3GPG A;  4R76 A;  1CPS A;  3LWU A;  4MHZ A;  4PXE A;  4H2K A;  3BXM A;  5HVF A;  1CBX A;  4R6T A;  2C6G A;  4IQY A;  1CX8 A;  3B3T A;  2PRQ A;  5AIL A;  4JZ0 A;  3S9L A;  3H8E A;  1YD9 A;  4R7M A;  3SIJ A;  2XEG A;  4MHY A;  5LRG A;  4OID A;  2IQ6 A;  1CP7 A;  3V45 A;  1YW6 A;  3B3S A;  3EKE A;  1ARL A;  1M4L A;  2ZED A;  4OIW A;  1LFW A;  4JGK A;  3FX6 A;  1HJZ A;  4ABL A;  3WC5 A;  5HOL A;  1DE4 C;  4K0C A;  1HEE A;  3V38 A;  5JH9 A;  1CPX A;  2HC9 A;  2PE3 A;  4UEZ A;  1Y7E A;  1Y0Y A;  2AFO A;  5FSZ A;  1F2P A;  1IGB A;  3B3V A;  2BFR A;  2VRI A;  1BPM A;  1QQ9 A;  4UIA A;  4G1P A;  4ABK A;  3KHX A;  2ZEH A;  5CB3 A;  3VAR A;  5CBM A;  1ARM A;  1VIX A;  5F09 A;  1YME A;  5JM6 A;  3IO1 A;  3KI9 A;  4NFR A;  4BD9 A;  3VAT A;  1Z5R A;  2PVW A;  3TC8 A;  2ZEF A;  1VGY A;  3ISZ A;  3V7Z A;  3GUX A;  4Z65 A;  3EWO A;  4RUH A;  3SI1 A;  4IHM A;  4YU9 A;  1CP6 A;  1LAP A;  2PJ9 A;  3PBE A;  3SIG A;  1PCA A;  1SPV A;  2AFM A;  1HDQ A;  4F9U A;  7CPA A;  2V8D A;  2ZEM A;  3PFO A;  4NGM A;  3SJE A;  4A39 A;  2PJ3 A;  1BPN A;  3SJG A;  1LCP A;  1JQG A;  4TNU A;  3RBU A;  2GRE A;  4WJB A;  2V77 A;  2PVV A;  3D7D A;  4MRI A;  2PJ2 A;  2QVP A;  3NH5 A;  4ZY0 A;  3PRT A;  4P4J A;  2ZOF A;  3IC1 A;  2CIJ A;  2EWB A;  3FEE A;  3IIB A;  4O23 A;  4OC5 A;  4UIB A;  2IJZ A;  2PIZ A;  3NFZ A;  2EK8 A;  2RB7 A;  4FUU A;  1TXZ A;  4GUA A;  1NSA A;  3Q71 A;  3BI1 A;  2XEJ A;  3SI0 A;  1YW4 A;  4GVV A;  3IFE A;  4FWU A;  1EE3 P;  3FH4 A;  4EWT A;  4A94 A;  4F8Z A;  3WT4 A;  2F8H A;  4P4D A;  4UF4 A;  3SJX A;  3T8W A;  1ZLH A;  4OME A;  5D8N A;  1R3N A;  2FG1 A;  5D29 A;  4NGT A;  2OOT A;  1ELM P;  2ZEG A;  4P4B A;  1VHE A;  2OR4 A;  4J5R A;  2GU2 A;  3IWW A;  4J4Z A;  5LYD A;  3QNV A;  1DTD A;  2ZEL A;  1ZLI A;  3PBB A;  3PB4 X;  3EWR A;  1HDU A;  2V8H A;  2C1C A;  2PJB A;  1XRY A;  1TF9 A;  3ISX A;  2DX6 A;  3CT9 A;  4ZYQ A;  2AFS A;  1AYE A;  4PXD A;  1Q7L A;  1PYT B;  1Z2L A;  2EK9 A;  3B7I A;  5HVH A;  2X47 A;  4DJL A;  4K3N A;  5FSV A;  2PIY A;  3PFE A;  2C6P A;  1H8L A;  4NGP A;  2C6C A;  4JCA A;  3KHZ A;  2F7V A;  1F57 A;  2AFZ A;  4OC0 A;  2BCO A;  3IJ3 A;  3GQO A;  2CF4 A;  2Q51 A;  4OC3 A;  3MRU A;  3KGQ A;  2BOA A;  4MHN A;  2WYR A;  2JEW A;  3RZA A;  1ZG9 A;  4X8I A;  4ONW A;  2VL1 A;  3KZW A;  5HVG A;  2CTB A;  5FSX A;  5LRJ A;  2PJ8 A;  4P44 A;  5THW A;  4F9V A;  3D68 A;  3KR5 A;  4TWE A;  4EME A;  1GYT A;  2PJ4 A;  4NJR A;  3D7F A;  4X2T A;  3SI2 A;  3S9N A;  4W9Y A;  1NJR A;  3KQZ A;  4YWY A;  4MXU A;  1XFO A;  2JBJ A;  3EWQ A;  2ANP A;  3GLJ A;  5JGF A;  5ELY A;  2J9A A;  1TKJ A;  1TXR A;  2POK A;  4NGN A;  4EFD A;  2ABZ A;  3DGV A;  4NGQ A;  3D67 A;  2WZN A;  1VHO A;  5FSY A;  4GVW A;  2ZOG A;  5E3B A;  1FNO A;  4ETJ A;  4UML A;  1ELL P;  3GB0 A;  2FAV A;  4CPA A;  2XD7 A;  2AFC A;  3PB9 X;  4MCS A;  3EW5 A;  3D66 A;  4P4E A;  2ZEN A;  4FAI A;  3KL9 A;  5K8O A;  5CB5 A;  3NA6 A;  1YSJ A;  4UEE A;  1KWM A;  1Y0R A;  2HB6 A;  4A38 A;  1IY7 A;  1VHU A;  4J5Q A;  5LYF A;  1TKH A;  4PXB A;  1LAN A;  3V2B A;  2L8R A;  5LYI A;  3TX8 A;  4J5S A;  2PJ7 A;  1ZR3 A;  3PB6 X;  4MCQ A;  2Q4Z A;  1Z8L A;  3Q6Z A;  3WC7 A;  2QYV A;  2AFU A;  4PPZ A;  4MCP A;  2PJ5 A;  1LAM A;  5CPA A;  1BAV A;  3SIH A;  3B2Y A;  1ZG8 A;  2BFQ A;  3GPO A;  1XMB A;  4LQG A;  3B35 A;  2FVG A;  3DLJ A;  3S9M A;  3CPA A;  2RFH A;  3VFQ A;  1XBU A;  5HIH A;  4X3R A;  4D86 A;  4JLL A;  3HUV A;  1CG2 A;  3LMS A;  3NH8 A;  4JYW A;  4JVV A;  3FVL A;  4IAV A;  4ZX9 A;  3K2K A;  4DYO A;  4WWV A;  8CPA A;  4KSI A;  2BO9 A;  3L2N A;  2GLF A;  3H8F A;  5K8M A;  3FEC A;  2PCU A;  3GPQ A;  1OBR A;  4OC4 A;  2V8G A;  3RAM A;  2XEI A;  1RTQ A;  1AMP A;  4FBE A;  2PJA A;  3MN8 A;  3SJF A;  6CPA A;  1TY8 A;  3NH4 A;  3PB8 X;  5FSU A;  2PJ6 A;  2PJ0 A;  2ZEE A;  3B3W A;  3EJF A;  1ZR5 A; 
#chains in the Genus database with same CATH topology
 4MCR A;  3IID A;  2WPX A;  2EVN A;  4MHD A;  4UCP A;  5KTC A;  1S60 A;  3WC6 A;  2XEF A;  3TO9 A;  2ZEO A;  3I1U A;  5J1Q A;  2OZG A;  3KQX A;  2EEE A;  4A32 A;  3LOD A;  3P2F A;  2FE7 A;  3ETI A;  2IMO A;  3FJU A;  4P6Y A;  2QJ8 A;  4ZX8 A;  2G9D A;  4MJ8 A;  2YNC A;  1QSM A;  3EC4 A;  4R9M A;  5DUS A;  4NJQ A;  2GLJ A;  2I3C A;  1F2O A;  2JBK A;  3D2M A;  1UWY A;  3TO7 A;  4ESS A;  4CYN A;  3B3W A;  4OP4 A;  1IID A;  3EJG A;  1IB1 E;  2PJ1 A;  2ACF A;  4MMO A;  2C27 A;  1Q2Y A;  2Z3N A;  4KUB A;  4ZI6 A;  1R43 A;  4OC2 A;  1J4J A;  5E96 A;  5HXD A;  3BHX A;  2JEV A;  4A37 A;  1LOK A;  4M85 A;  1QSO A;  3CPX A;  2O4H A;  1BLL E;  2QEC A;  3FMC A;  3G3S A;  4KSF A;  4NGS A;  4Q7A A;  4XNH B;  4UBR A;  3VH9 A;  1TKF A;  4A33 A;  4CAX A;  3EWP A;  3SXN A;  2Q43 A;  1QMU A;  3IEH A;  2IL4 A;  2FIA A;  4UCM A;  4MY3 A;  2J8M A;  4CRZ B;  1TF8 A;  5LYL A;  2EBJ A;  5AG6 A;  2FXK A;  4OKO A;  3BI0 A;  2PQ8 A;  4PQA A;  1QST A;  5F47 A;  2Q0Y A;  4FD7 A;  3R96 A;  4QBJ A;  2HUZ A;  3FED A;  4IK2 A;  1Z9U A;  2R98 A;  4MHP A;  3PEI A;  2BL1 A;  4U9Z A;  2P6E A;  3T9Y A;  4P10 A;  4TU0 A;  5K8N A;  2VQY A;  3CXQ A;  4OAD A;  2Q4Y A;  1OZP A;  1ZG7 A;  4P45 A;  3IU2 A;  3IIF A;  1BOB A;  2O53 A;  4P4F A;  4MFZ A;  1BO4 A;  2NYQ A;  4KYB A;  4ZY2 A;  2FS5 A;  2GAN A;  5FVJ A;  3FF3 A;  4YFJ A;  4HKF A;  2QIR A;  1M1D A;  2R8V A;  2CY2 A;  3PP9 A;  3GQE A;  2ODF A;  3MGD A;  2G3A A;  4JJX A;  4B5O A;  2V8V A;  1XJO A;  4PXC A;  5AG5 A;  2FCK A;  2Z3K A;  4KOT A;  4ETK A;  2NSM A;  1YVO A;  4MFJ A;  2RC4 A;  2X7B A;  2OU2 A;  2OZU A;  4NGR A;  3N5F A;  5I4M A;  4BIN A;  4OC1 A;  5IB9 A;  4P4I A;  2CTC A;  3CDX A;  4DNC A;  1YRE A;  3K9T A;  4AXV A;  1WK4 A;  1XE4 A;  2DEA A;  2OB0 A;  4AVA A;  1Z4R A;  5DS0 A;  5AG7 A;  4CYO A;  3HLP A;  2Q04 A;  1XEB A;  2J8R A;  2PJC A;  3QB8 A;  3DR8 A;  4EFD A;  4GM5 A;  3JRU A;  4MY0 A;  5LRK A;  1XMT A;  3H8G A;  5CMS A;  3KAS A;  3B3C A;  3WAB A;  3KKW A;  2REE A;  3D8P A;  1XOV A;  1KZF A;  4BBH A;  2B4B A;  4QB9 A;  3EO4 A;  3D4U A;  5A27 A;  4QUS A;  4ZY1 A;  2AFX A;  3KR4 A;  4CGM A;  1I1D A;  3D7G A;  1S7K A;  1FT7 A;  3TFY A;  4KOX A;  4CYQ A;  4KOV A;  3D7H A;  4B6Z A;  1GHE A;  3JZT A;  4LX9 A;  2LGR A;  3TE4 A;  3BJ7 A;  4UEF A;  4II9 A;  4DUK A;  3PB7 X;  4R8F A;  2ZEP A;  1YLO A;  2AFW A;  4CGP A;  4RS2 A;  3PZJ A;  4JLY A;  3SII A;  3GPG A;  4UFW A;  5GCN A;  4CGO A;  3FB3 A;  4R76 A;  1CPS A;  3LWU A;  1YLE A;  2YGW A;  4MHZ A;  4PXE A;  4H2K A;  3S6H A;  3V8I A;  3BXM A;  5HVF A;  1CBX A;  4R6T A;  1KUV A;  2C6G A;  4IQY A;  4L8A A;  4IUS A;  1CX8 A;  3B3T A;  2PRQ A;  2G3T A;  3SHP A;  5AIL A;  4IF5 A;  5F48 A;  2H5M A;  2O28 A;  4JZ0 A;  3TT2 A;  3S9L A;  3H8E A;  5CNP A;  2JZD A;  3FRM A;  4UFX A;  1YD9 A;  4R7M A;  3SIJ A;  1I21 A;  4KLW A;  2XEG A;  4MHY A;  2W2G A;  1B87 A;  2ZW7 A;  4MFK A;  4OID A;  5LRG A;  2IQ6 A;  1CP7 A;  3V45 A;  1YW6 A;  3B3S A;  5KTD A;  3EKE A;  1ARL A;  2CXA A;  1M4L A;  2YNE A;  2AE6 A;  4F0X A;  2ZED A;  3G8W A;  3WR7 A;  4C2Z A;  4OIW A;  1S7L A;  1LFW A;  1V0C A;  3GY9 A;  4JGK A;  3FX6 A;  2PR8 A;  1HJZ A;  4ABL A;  2BEI A;  3WC5 A;  3S6F A;  5HOL A;  1L0C A;  1A2Z A;  1DE4 C;  4K0C A;  1HEE A;  2B3V A;  3V38 A;  4CAF A;  2WUU A;  5JH9 A;  1CPX A;  2HC9 A;  1IYL A;  2PE3 A;  4UEZ A;  4CGN A;  4RI1 A;  4NEX A;  1Y7E A;  1Y9K A;  4CAW A;  1Y0Y A;  2AFO A;  3TOB A;  4R57 A;  1N71 A;  5FSZ A;  1F2P A;  1IGB A;  1MJB A;  3B3V A;  4AVB A;  4HPS A;  4C2X A;  2Q4V A;  1XIX A;  2BFR A;  2VRI A;  2JZE A;  2PR1 A;  4B5P A;  1BPM A;  4C7I A;  1QQ9 A;  2FSR A;  4UIA A;  4M6H A;  4E2A A;  1M4G A;  5JQ4 A;  3SXO A;  2PDO A;  4G1P A;  5HMN A;  4ABK A;  1QSN A;  2Q7S A;  1Z4E A;  4KOU A;  1MJA A;  2ZEH A;  5CB3 A;  3KHX A;  3VAR A;  2ATR A;  3D2P A;  5CBM A;  1ARM A;  5EC4 A;  1VIX A;  1YVK A;  5F09 A;  1YME A;  5JM6 A;  3TO6 A;  2DXQ A;  5G1Z A;  3IO1 A;  3KI9 A;  4B11 A;  4B13 A;  4NFR A;  1S5K A;  4BD9 A;  3VAT A;  1Z5R A;  2DF5 A;  3W91 A;  3FBU A;  3C26 A;  2PVW A;  4QC6 A;  4F0Y A;  5EBV A;  3TC8 A;  5BWA B;  1Q2D A;  2ZEF A;  3JTK A;  3E0K A;  1VGY A;  3ISZ A;  2DPT A;  3H5Z A;  4F6A A;  3V7Z A;  1MK4 A;  3GUX A;  1NSL A;  4Z65 A;  2B4D B;  3EWO A;  4HNY B;  2P0W A;  4RUH A;  3SI1 A;  5J8F A;  2ZW5 A;  4IHM A;  4YU9 A;  1CP6 A;  2B5G B;  1LAP A;  5C82 A;  1LRZ A;  3PBE A;  3SIG A;  1B6B A;  4M3S A;  1P0H A;  4AG9 A;  1PCA A;  4U9Y A;  4GXH A;  5JPH A;  2Z3P A;  1SPV A;  2AFM A;  5AGE A;  1HDQ A;  1SQH A;  2VZZ A;  4F9U A;  7CPA A;  2V8D A;  1RO5 A;  2ZEM A;  3PFO A;  4NGM A;  4YRH A;  2PJ3 A;  4UWI A;  3S6G A;  1BPN A;  3H4Q A;  3SJE A;  4A39 A;  3FXT A;  3SJG A;  2QML A;  1LCP A;  1JQG A;  4TNU A;  4KVO E;  2YNC C;  5ISV A;  3RBU A;  5IB0 A;  1IOI A;  2GRE A;  2V77 A;  4JD6 A;  2PVV A;  3D7D A;  4LQ6 A;  4MRI A;  4WJB A;  4Y49 C;  2PJ2 A;  4A30 A;  2R1I A;  2QVP A;  3NH5 A;  4KOY A;  1Z8W A;  4ZY0 A;  2PRB A;  2Z10 A;  3CXS A;  2D4O A;  2OH1 A;  3PRT A;  4P4J A;  3RO0 A;  2ZOF A;  3IC1 A;  4CAE A;  5AG4 A;  2CIJ A;  2EWB A;  3FEE A;  3IIB A;  3PGP A;  4O23 A;  4OC5 A;  4UIB A;  4H89 A;  4UWJ A;  2GE3 A;  2IJZ A;  2PIZ A;  3N7Z A;  1M4I A;  4H6U A;  4NSQ A;  2CNT A;  3NFZ A;  1S7F A;  4CGL A;  2I00 A;  2EK8 A;  4HNX B;  3R1K A;  2RB7 A;  4FUU A;  1TXZ A;  4GUA A;  1NSA A;  2JLM A;  1NMT A;  1ON0 A;  3Q71 A;  3BI1 A;  2XEJ A;  3SI0 A;  1YW4 A;  4M6G A;  4GVV A;  3IFE A;  4JXQ A;  4FWU A;  4ORF A;  2Z3O A;  3UY5 A;  5C88 A;  1EE3 P;  3FH4 A;  3QAY A;  2B3U A;  4LUA A;  4QVT A;  4MFL A;  4EWT A;  3FIX A;  4A94 A;  4AVC A;  4F8Z A;  2ZPA A;  3FNC A;  3GIU A;  2F8H A;  3WT4 A;  4P4D A;  4UF4 A;  3SJX A;  3T8W A;  1ZLH A;  4OME A;  3ZZI A;  5D8N A;  1R3N A;  5F46 A;  3R9E A;  5H86 A;  2REF A;  4XPL A;  2FG1 A;  2WPW A;  2Q7B A;  5D29 A;  4NGT A;  2OOT A;  1ELM P;  2ZEG A;  4I49 A;  4PSW A;  1VHS A;  4P4B A;  3FYN A;  1VHE A;  3R95 A;  2OR4 A;  4J5R A;  2Z3M A;  2GU2 A;  3IWW A;  4J4Z A;  2CNS A;  4HNW B;  4UA3 A;  5LYD A;  3QNV A;  1Y7R A;  2JDD A;  4Y49 B;  1DTD A;  3NE7 A;  3IWE A;  3TTH A;  2ZEL A;  1ZLI A;  3JVN A;  3PBB A;  2A4N A;  3PB4 X;  2Z11 A;  4X5K A;  3EWR A;  1Z8X A;  1HDU A;  4EVY A;  5A28 A;  3ZJ0 A;  3F8K A;  3GKR A;  2V8H A;  2C1C A;  3IU1 A;  2PJB A;  4A95 A;  1XRY A;  1CM0 A;  2GIV A;  1TF9 A;  2KQV A;  4PV6 A;  3ISX A;  1P4N A;  4GS4 A;  2DX6 A;  3CT9 A;  4ZYQ A;  1S3Z A;  4NF1 A;  2AFS A;  2D4P A;  2HQY A;  1Z8T A;  2P6F A;  1AYE A;  4ONU A;  4PXD A;  1Q7L A;  1PYT B;  1Z2L A;  2EK9 A;  4A2Z A;  4CS0 B;  3B7I A;  5HVH A;  2X47 A;  5DWM A;  3I9S A;  2J8N A;  3VWD A;  4DJL A;  3CZX A;  4K3N A;  5FSV A;  1QSR A;  2PIY A;  3PFE A;  4JXR A;  2C6P A;  1H8L A;  2VEZ A;  5H84 A;  4NGP A;  2C6C A;  4XPK A;  4YGO A;  4UFV A;  4JCA A;  3KHZ A;  2F7V A;  2DPS A;  2FT0 A;  3I3G A;  2B58 A;  1F57 A;  3W6S A;  2AFZ A;  4MBU A;  2BCO A;  4OC0 A;  5G20 A;  3R9G A;  1IYK A;  4H6Z A;  3IJ3 A;  2Q44 A;  3JUW A;  3GQO A;  3DR6 A;  4KSA A;  2CF4 A;  2Q51 A;  4OC3 A;  5HH1 A;  3MRU A;  2CNM A;  2OZH A;  4AG7 A;  3KGQ A;  2BOA A;  4PK2 A;  4MHN A;  3T90 A;  2WYR A;  2JZF A;  4R3K A;  2JEW A;  5I0C A;  2FL4 A;  3B8G A;  3RZA A;  1ZG9 A;  1VKC A;  2AJ6 A;  2I79 A;  4BMH A;  4E0A A;  2Z0Z A;  4X8I A;  3QAH A;  5G21 A;  4ONW A;  2VL1 A;  4KVX A;  2EO8 A;  4U5Y A;  3NE8 A;  3KZW A;  2P6G A;  2CTB A;  4AB7 A;  5HVG A;  5K8P A;  1WWZ A;  5FSX A;  5LRJ A;  4FD4 A;  4C7H A;  5F49 A;  2ZXV A;  2PJ8 A;  3OWC A;  1PUA A;  1X12 A;  3DDD A;  1I12 A;  4CRY B;  4P44 A;  5THW A;  5IX3 A;  4F9V A;  3D68 A;  3KR5 A;  4TWE A;  4EME A;  1K4J A;  1GYT A;  2PJ4 A;  4NJR A;  3D7F A;  4X2T A;  3SI2 A;  4C2Y A;  5J8C A;  3S9N A;  4W9Y A;  1NJR A;  3KQZ A;  1Y9W A;  4KS9 A;  1IU8 A;  4YWY A;  4MXU A;  1XFO A;  2JBJ A;  1M4D A;  3EWQ A;  2ANP A;  2ZW6 A;  3GLJ A;  4KZT A;  5JGF A;  5ELY A;  2J9A A;  1TKJ A;  1TXR A;  2POK A;  2WSA A;  3D3S A;  3F0A A;  4NGN A;  4B14 A;  1JWQ A;  1RXT A;  2ABZ A;  3DGV A;  4NGQ A;  3D67 A;  2WZN A;  1VHO A;  1KUY A;  2VBQ A;  4PSX A;  1S7N A;  1FY7 A;  5FSY A;  4GVW A;  2ZOG A;  5E3B A;  4KUA A;  1FNO A;  4ETJ A;  4MI4 A;  5DWN A;  4KVM E;  5IV0 A;  4UML A;  4FD5 A;  3A9L A;  2KCW A;  1ELL P;  5KTA A;  4C68 A;  3GB0 A;  2FAV A;  3DSB A;  1M44 A;  4RN7 A;  4CPA A;  2XD7 A;  2AFC A;  3PB9 X;  4MCS A;  2K5T A;  3EW5 A;  1U6M A;  2G0B A;  3D66 A;  4P4E A;  2ZEN A;  4FAI A;  3LAC A;  2BSW A;  3KL9 A;  5CB5 A;  5K8O A;  1YR0 A;  3NA6 A;  1YSJ A;  4UEE A;  4J3G A;  1KWM A;  1Y0R A;  4KOS A;  4CAV A;  2HB6 A;  4A38 A;  2YND A;  1IY7 A;  1VHU A;  4J5Q A;  4KLV A;  2RNK A;  4ZGY B;  1AUG A;  3IGR A;  1TKH A;  3EXN A;  5LYF A;  4B10 A;  4PXB A;  4Q38 A;  1LAN A;  1IIC A;  3V2B A;  2L8R A;  5LYI A;  3TX8 A;  4J5S A;  4NXY A;  2PJ7 A;  1ZR3 A;  3PB6 X;  4MCQ A;  2Q4Z A;  4KOW A;  1Z8L A;  3W6X A;  3Q6Z A;  3WC7 A;  2QYV A;  2AFU A;  1PU9 A;  1CJW A;  1YX0 A;  4PPZ A;  4MCP A;  2PJ5 A;  1LAM A;  5CPA A;  1BAV A;  3SIH A;  3B2Y A;  3RYO A;  1ZG8 A;  3DNS A;  2BFQ A;  1YK3 A;  2B4D A;  4M6I A;  3GPO A;  1XMB A;  1TIQ A;  3F5B A;  4LQG A;  4UCN A;  4ZBG A;  3B35 A;  3LD2 A;  2FVG A;  4FD6 A;  3DLJ A;  3S9M A;  2PC1 A;  2PSW A;  4MFP A;  2Y0M A;  3CPA A;  2B5G A;  3VFQ A;  1XBU A;  2RFH A;  4OLL A;  4Q36 A;  4XPD C;  5HIH A;  4X3R A;  4CYP A;  1YQE A;  4D86 A;  3TCV A;  3CXP A;  3TOA A;  3BJ8 A;  3VWE A;  4B5P B;  4JLL A;  3HUV A;  3IWG A;  4NCZ A;  3EY5 A;  4A31 A;  1CG2 A;  3LMS A;  3NH8 A;  4JYW A;  4JVV A;  3FVL A;  3P2H A;  2VI7 A;  4IAV A;  4ZX9 A;  1R57 A;  2GFQ A;  3K2K A;  4R3L A;  4DYO A;  4WWV A;  5EMI A;  2R7H A;  8CPA A;  4JWP A;  3K9U A;  1IOF A;  2ARH A;  3EFA A;  4KSI A;  2FXF A;  2VXK A;  4OAE A;  3S6K A;  2NMT A;  2F5I A;  2BUE A;  2BO9 A;  2ZW4 A;  3L2N A;  2FIW A;  2GLF A;  3GYA A;  3H8F A;  1ZO0 A;  1NE9 A;  5K8M A;  3FEC A;  4KOR A;  2PCU A;  4E8O A;  3GPQ A;  1OBR A;  1UFH A;  4OC4 A;  4XNH C;  2V8G A;  3RAM A;  2XEI A;  1RTQ A;  2HV2 A;  1AMP A;  1MJ9 A;  3R9F A;  4K30 A;  4PK3 A;  4FBE A;  1YGH A;  2PJA A;  4R87 A;  3RNZ A;  3MN8 A;  4L89 A;  2WCT A;  1XF8 A;  4B12 A;  3SJF A;  6CPA A;  1TY8 A;  2VZY A;  3NH4 A;  3PB8 X;  1KUX A;  5FSU A;  4MFQ A;  1X10 A;  4XPD B;  1Q2C A;  2EUI A;  2PJ6 A;  2JDC A;  3BLN A;  2Z3L A;  2PJ0 A;  2ZEE A;  2PJ9 A;  3EJF A;  5G22 A;  1ZR5 A; 
#chains in the Genus database with same CATH homology
 4MCR A;  3IID A;  3WC6 A;  2XEF A;  2ZEO A;  3I1U A;  5J1Q A;  3KQX A;  2EEE A;  3ETI A;  2IMO A;  3FJU A;  4P6Y A;  2QJ8 A;  4ZX8 A;  2G9D A;  5DUS A;  4NJQ A;  2GLJ A;  2I3C A;  1F2O A;  2JBK A;  1UWY A;  4ESS A;  4OP4 A;  3EJG A;  2PJ1 A;  4MMO A;  5LRK A;  2ACF A;  4ZI6 A;  1R43 A;  4OC2 A;  5HXD A;  3BHX A;  4A37 A;  1LOK A;  3CPX A;  2O4H A;  1BLL E;  3FMC A;  3VH9 A;  4NGS A;  4Q7A A;  1TKF A;  3EWP A;  2Q43 A;  1QMU A;  3IEH A;  1TF8 A;  5LYL A;  5K8P A;  2FXK A;  4OKO A;  3BI0 A;  4PQA A;  3FED A;  4IK2 A;  4MHP A;  3PEI A;  4P10 A;  4TU0 A;  5K8N A;  1ZG7 A;  4P45 A;  3IIF A;  2O53 A;  4P4F A;  2NYQ A;  4KYB A;  4ZY2 A;  3FF3 A;  3GQE A;  2V8V A;  1XJO A;  4PXC A;  4ETK A;  2NSM A;  4NGR A;  3N5F A;  5I4M A;  4OC1 A;  5IB9 A;  4P4I A;  2CTC A;  3CDX A;  3K9T A;  4AXV A;  2DEA A;  5DS0 A;  3HLP A;  2PJC A;  4GM5 A;  3JRU A;  3H8G A;  5CMS A;  3KAS A;  3B3C A;  3WAB A;  3D4U A;  4ZY1 A;  2AFX A;  3KR4 A;  3D7G A;  1FT7 A;  3D7H A;  4B6Z A;  3JZT A;  2LGR A;  4UEF A;  4DUK A;  3PB7 X;  4R8F A;  2ZEP A;  1YLO A;  2AFW A;  3SII A;  3GPG A;  4R76 A;  1CPS A;  3LWU A;  4MHZ A;  4PXE A;  4H2K A;  3BXM A;  5HVF A;  1CBX A;  4R6T A;  2C6G A;  4IQY A;  1CX8 A;  3B3T A;  2PRQ A;  5AIL A;  4JZ0 A;  3S9L A;  3H8E A;  1YD9 A;  4R7M A;  3SIJ A;  2XEG A;  4MHY A;  5LRG A;  4OID A;  2IQ6 A;  1CP7 A;  3V45 A;  1YW6 A;  3B3S A;  3EKE A;  1ARL A;  1M4L A;  2ZED A;  4OIW A;  1LFW A;  4JGK A;  3FX6 A;  1HJZ A;  4ABL A;  3WC5 A;  5HOL A;  1DE4 C;  4K0C A;  1HEE A;  3V38 A;  5JH9 A;  1CPX A;  2HC9 A;  2PE3 A;  4UEZ A;  1Y7E A;  1Y0Y A;  2AFO A;  5FSZ A;  1F2P A;  1IGB A;  3B3V A;  2BFR A;  2VRI A;  1BPM A;  1QQ9 A;  4UIA A;  4G1P A;  4ABK A;  3KHX A;  2ZEH A;  5CB3 A;  3VAR A;  5CBM A;  1ARM A;  1VIX A;  5F09 A;  1YME A;  5JM6 A;  3IO1 A;  3KI9 A;  4NFR A;  4BD9 A;  3VAT A;  1Z5R A;  2PVW A;  3TC8 A;  2ZEF A;  1VGY A;  3ISZ A;  3V7Z A;  3GUX A;  4Z65 A;  3EWO A;  4RUH A;  3SI1 A;  4IHM A;  4YU9 A;  1CP6 A;  1LAP A;  2PJ9 A;  3PBE A;  3SIG A;  1PCA A;  1SPV A;  2AFM A;  1HDQ A;  4F9U A;  7CPA A;  2V8D A;  2ZEM A;  3PFO A;  4NGM A;  3SJE A;  4A39 A;  2PJ3 A;  1BPN A;  3SJG A;  1LCP A;  1JQG A;  4TNU A;  3RBU A;  2GRE A;  4WJB A;  2V77 A;  2PVV A;  3D7D A;  4MRI A;  2PJ2 A;  2QVP A;  3NH5 A;  4ZY0 A;  3PRT A;  4P4J A;  2ZOF A;  3IC1 A;  2CIJ A;  2EWB A;  3FEE A;  3IIB A;  4O23 A;  4OC5 A;  4UIB A;  2IJZ A;  2PIZ A;  3NFZ A;  2EK8 A;  2RB7 A;  4FUU A;  1TXZ A;  4GUA A;  1NSA A;  3Q71 A;  3BI1 A;  2XEJ A;  3SI0 A;  1YW4 A;  4GVV A;  3IFE A;  4FWU A;  1EE3 P;  3FH4 A;  4EWT A;  4A94 A;  4F8Z A;  3WT4 A;  2F8H A;  4P4D A;  4UF4 A;  3SJX A;  3T8W A;  1ZLH A;  4OME A;  5D8N A;  1R3N A;  2FG1 A;  5D29 A;  4NGT A;  2OOT A;  1ELM P;  2ZEG A;  4P4B A;  1VHE A;  2OR4 A;  4J5R A;  2GU2 A;  3IWW A;  4J4Z A;  5LYD A;  3QNV A;  1DTD A;  2ZEL A;  1ZLI A;  3PBB A;  3PB4 X;  3EWR A;  1HDU A;  2V8H A;  2C1C A;  2PJB A;  1XRY A;  1TF9 A;  3ISX A;  2DX6 A;  3CT9 A;  4ZYQ A;  2AFS A;  1AYE A;  4PXD A;  1Q7L A;  1PYT B;  1Z2L A;  2EK9 A;  3B7I A;  5HVH A;  2X47 A;  4DJL A;  4K3N A;  5FSV A;  2PIY A;  3PFE A;  2C6P A;  1H8L A;  4NGP A;  2C6C A;  4JCA A;  3KHZ A;  2F7V A;  1F57 A;  2AFZ A;  4OC0 A;  2BCO A;  3IJ3 A;  3GQO A;  2CF4 A;  2Q51 A;  4OC3 A;  3MRU A;  3KGQ A;  2BOA A;  4MHN A;  2WYR A;  2JEW A;  3RZA A;  1ZG9 A;  4X8I A;  4ONW A;  2VL1 A;  3KZW A;  5HVG A;  2CTB A;  5FSX A;  5LRJ A;  2PJ8 A;  4P44 A;  5THW A;  4F9V A;  3D68 A;  3KR5 A;  4TWE A;  4EME A;  1GYT A;  2PJ4 A;  4NJR A;  3D7F A;  4X2T A;  3SI2 A;  3S9N A;  4W9Y A;  1NJR A;  3KQZ A;  4YWY A;  4MXU A;  1XFO A;  2JBJ A;  3EWQ A;  2ANP A;  3GLJ A;  5JGF A;  5ELY A;  2J9A A;  1TKJ A;  1TXR A;  2POK A;  4NGN A;  4EFD A;  2ABZ A;  3DGV A;  4NGQ A;  3D67 A;  2WZN A;  1VHO A;  5FSY A;  4GVW A;  2ZOG A;  5E3B A;  1FNO A;  4ETJ A;  4UML A;  1ELL P;  3GB0 A;  2FAV A;  4CPA A;  2XD7 A;  2AFC A;  3PB9 X;  4MCS A;  3EW5 A;  3D66 A;  4P4E A;  2ZEN A;  4FAI A;  3KL9 A;  5K8O A;  5CB5 A;  3NA6 A;  1YSJ A;  4UEE A;  1KWM A;  1Y0R A;  2HB6 A;  4A38 A;  1IY7 A;  1VHU A;  4J5Q A;  5LYF A;  1TKH A;  4PXB A;  1LAN A;  3V2B A;  2L8R A;  5LYI A;  3TX8 A;  4J5S A;  2PJ7 A;  1ZR3 A;  3PB6 X;  4MCQ A;  2Q4Z A;  1Z8L A;  3Q6Z A;  3WC7 A;  2QYV A;  2AFU A;  4PPZ A;  4MCP A;  2PJ5 A;  1LAM A;  5CPA A;  1BAV A;  3SIH A;  3B2Y A;  1ZG8 A;  2BFQ A;  3GPO A;  1XMB A;  4LQG A;  3B35 A;  2FVG A;  3DLJ A;  3S9M A;  3CPA A;  2RFH A;  3VFQ A;  1XBU A;  5HIH A;  4X3R A;  4D86 A;  4JLL A;  3HUV A;  1CG2 A;  3LMS A;  3NH8 A;  4JYW A;  4JVV A;  3FVL A;  4IAV A;  4ZX9 A;  3K2K A;  4DYO A;  4WWV A;  8CPA A;  4KSI A;  2BO9 A;  3L2N A;  2GLF A;  3H8F A;  5K8M A;  3FEC A;  2PCU A;  3GPQ A;  1OBR A;  4OC4 A;  2V8G A;  3RAM A;  2XEI A;  1RTQ A;  1AMP A;  4FBE A;  2PJA A;  3MN8 A;  3SJF A;  6CPA A;  1TY8 A;  3NH4 A;  3PB8 X;  5FSU A;  2PJ6 A;  2PJ0 A;  2ZEE A;  3B3W A;  3EJF A;  1ZR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...