4ZY2A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10o
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Probable M17 family aminopeptidase
total genus 178
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zy2A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zy2A02
4A38A 4R76A 4P4IA 3GQEA 4J5RA 3EWQA 4IK2A 1QQ9A 4CPAA 4KSIA 3NA6A 2PRQA 2BO9A 2ZEEA 1R3NA 4X8IA 1CX8A 4PPZA 2NSMA 4OC5A 3MRUA 5CPAA 3K9TA 4MRIA 3B3SA 1VGYA 2WZNA 4J5QA 3EW5A 2HB6A 4MXUA 4FBEA 1LCPA 3LWUA 1VHOA 3CT9A 3KZWA 3QNVA 2F7VA 5LYFA 3RZAA 2PJ3A 4MHNA 1LAMA 5JGFA 2C6CA 4DUKA 3FX6A 2AFMA 5CB5A 4JLLA 1BLLE 2JBJA 2CTBA 3WC6A 3GQOA 1Z2LA 2AFOA 5CBMA 1CPSA 4MMOA 2FVGA 3K2KA 4B6ZA 4UEZA 3BHXA 2ZEGA 3SIHA 2ZOGA 1GYTA 5E3BA 1RTQA 1F2OA 4MHZA 2PJBA 3FVLA 4X3RA 3GPQA 3KGQA 4A39A 1VIXA 4GUAA 3WT4A 5JH9A 4IAVA 3DLJA 2AFZA 4ABKA 2G9DA 4UIAA 2QYVA 4PQAA 3KR4A 3PFEA 4MCSA 3PB8X 1AYEA 3WC7A 4UEFA 2XD7A 3SJXA 3PEIA 3NFZA 2PJ4A 4H2KA 1SPVA 2FAVA 1ARLA 2DEAA 2V8GA 3S9NA 4OC1A 5LRJA 1OBRA 3PB9X 3IWWA 1NSAA 3JRUA 1YLOA 2BFQA 3I1UA 3PBEA 5LYIA 1Z5RA 2GLJA 3FEEA 3ISZA 3SIIA 2XEFA 3D68A 4K0CA 4W9YA 4BD9A 2ZEPA 2PJ1A 1LFWA 1TKJA 4MCRA 2DX6A 3FMCA 5ELYA 3D66A 2X47A 3KASA 3PRTA 5I4MA 4OP4A 3Q6ZA 4P6YA 4NJQA 3SJFA 1TY8A 4R6TA 4OC2A 4WJBA 2XEIA 3FF3A 3MN8A 5AILA 1LOKA 1ZR3A 1CG2A 2POKA 5THWA 3SIGA 3GLJA 4GM5A 4O23A 3RBUA 1ZG9A 2ABZA 4IHMA 4P10A 2EK9A 4R8FA 1FNOA 3B3WA 4NGMA 2PE3A 4UF4A 2BOAA 2I3CA 1ELMP 1Q7LA 4P44A 1FT7A 1PYTB 5FSUA 3FJUA 4NJRA 5LYLA 4F8ZA 1YW4A 4JCAA 4DYOA 2OOTA 4JYWA 1LAPA 2ACFA 1YMEA 4UIBA 2VL1A 3WABA 4P4DA 2BFRA 5HXDA 5CMSA 1Y0RA 3S9MA 4JVVA 2ZEOA 3B3CA 3IIBA 3CDXA 2F8HA 2PIZA 2FXKA 5HOLA 3SI0A 4LQGA 2XEGA 3CPAA 5FSZA 5HVFA 3D7DA 5LRKA 4G1PA 3WC5A 4UEEA 1ZG8A 2Q51A 3Q71A 2JBKA 3RAMA 1VHUA 2ZELA 3KL9A 4Z65A 1R43A 2IJZA 1TKHA 4NGQA 3EKEA 5HVHA 5JM6A 4MCPA 3IIDA 1XFOA 3EJGA 3SIJA 1YSJA 7CPAA 1ZLIA 2EEEA 4FWUA 3V2BA 4EMEA 1AMPA 4ESSA 4ZY0A 1Y0YA 1TXRA 2PVVA 3BI1A 3KQXA 1ELLP 4NGSA 1KWMA 4DJLA 1UWYA 3ETIA 3GPGA 1QMUA 1BPMA 4OKOA 2V8HA 1ZG7A 3EWPA 4MCQA 2PJ6A 4ETJA 4R7MA 4ZX8A 4F9VA 3FH4A 4F9UA 1TF8A 2J9AA 2V8VA 2ZEFA 1ZLHA 4ZI6A 2AFXA 4EWTA 4TNUA 2AFUA 2ZENA 2L8RA 4PXEA 1H8LA 5FSVA 2GLFA 1CP6A 3NH4A 5D29A 1TF9A 4NGNA 3D7GA 4P4EA 4ZY2A 3D7HA 1VHEA 4NGPA 1BPNA 5HVGA 3GUXA 2CF4A 4PXBA 2RB7A 1XMBA 4Q7AA 2AFSA 3KHXA 3IIFA 3KR5A 4J4ZA 2AFWA 1XJOA 3IJ3A 4OC4A 3V45A 3CPXA 4RUHA 4J5SA 2V8DA 2ZEDA 4MHYA 2AFCA 2V77A 4NFRA 3H8GA 2CTCA 5K8NA 1HDUA 2VRIA 3V7ZA 2QVPA 1DTDA 1M4LA 4X2TA 2IQ6A 3IC1A 3FEDA 1HDQA 3VATA 1XBUA 2EK8A 3BXMA 4OIDA 4P4JA 3TC8A 2LGRA 4FAIA 3B7IA 3V38A 4D86A 4ONWA 5LYDA 4PXDA 1F2PA 3PBBA 6CPAA 2GREA 3T8WA 3IO1A 1ARMA 1ZR5A 4GVWA 1HJZA 3EWRA 3B3TA 4A94A 4WWVA 3H8EA 4YU9A 2WYRA 3PB6X 4ZY1A 1YW6A 3SI2A 3BI0A 5FSXA 2GU2A 2PJ7A 3SI1A 1DE4C 3KQZA 2PJCA 3FECA 2ANPA 2JEWA 3LMSA 4OC0A 1NJRA 5HIHA 5CB3A 1XRYA 4OC3A 1JQGA 1IGBA 3PFOA 1IY7A 3NH5A 3VFQA 1F57A 3PB7X 4OMEA 3GB0A 1CPXA 1LANA 2PJ8A 2PJ9A 1TKFA 2OR4A 4EFDA 2C6PA 2O4HA 4A37A 3H8FA 3SJEA 4AXVA 3B35A 1BAVA 5K8PA 3N5FA 3B3VA 1Z8LA 2PJ5A 2PIYA 4ETKA 2PJ0A 3D7FA 4ZYQA 3VH9A 3NH8A 8CPAA 2HC9A 3DGVA 1YD9A 4UMLA 4TU0A 2RFHA 4P4FA 3KHZA 1TXZA 1EE3P 3D4UA 3IFEA 4NGRA 5DS0A 5D8NA 1Y7EA 1PCAA 3B2YA 2NYQA 3HLPA 2Q43A 3S9LA 3HUVA 2BCOA 4ABLA 2PJAA 4IQYA 4FUUA 4JGKA 3JZTA 3TX8A 2O53A 3ISXA 3VARA 5F09A 3EJFA 5FSYA 3EWOA 2PVWA 1HEEA 3D67A 4GVVA 1CBXA 2C1CA 4TWEA 2EWBA 4YWYA 4ZX9A 2ZEMA 5J1QA 3GPOA 5DUSA 2ZEHA 5K8OA 3SJGA 5K8MA 4JZ0A 2PJ2A 2Q4ZA 3IEHA 2C6GA 4NGTA 2CIJA 2PCUA 2QJ8A 4P4BA 4MHPA 2XEJA 2ZOFA 1CP7A 4P45A 4PXCA 3KI9A 3PB4X 2FG1A 4KYBA 2IMOA 3L2NA 5LRGA 4K3NA 4OIWA 5IB9A
chains in the Genus database with same CATH superfamily
4R9MA 1IB1E 4A38A 3TO7A 3QAHA 4R76A 3S6FA 4H6ZA 2EVNA 4P4IA 1J4JA 3GQEA 4J5RA 1CJWA 3G3SA 3EWQA 4IK2A 1QQ9A 4CPAA 4MHDA 1B87A 3T9YA 4A31A 4KSIA 2I00A 2ZXVA 3NA6A 4QC6A 4DNCA 2FXFA 3IGRA 3FIXA 2PRQA 2BO9A 2ZEEA 1R3NA 3JTKA 1CX8A 4PPZA 4X8IA 2NSMA 3I3GA 3MRUA 3NE7A 3K9TA 2YNCA 4MRIA 4OC5A 4UCPA 5CPAA 3TO9A 3DR6A 3B3SA 4H6UA 2Q7SA 4UWIA 1VGYA 2PSWA 4J5QA 3EW5A 2HB6A 2WZNA 4MXUA 1LCPA 2BL1A 3LWUA 1VHOA 3CT9A 4A32A 3FYNA 3TOAA 2WPXA 3KZWA 4AVAA 3QNVA 4XPDB 1YVOA 2F7VA 3R1KA 5LYFA 3RZAA 2PJ3A 4MBUA 5HH1A 3TTHA 1YQEA 4MHNA 1LAMA 5JGFA 2C6CA 3VWDA 5ISVA 4C2XA 3QAYA 4II9A 2Z10A 1KUVA 4DUKA 3FX6A 4UFVA 2AFMA 2A4NA 4RS2A 1KUYA 5CB5A 4JLLA 4GXHA 1BLLE 2JBJA 2PRBA 2CTBA 3WC6A 3GQOA 4NXYA 4Y49B 1XMTA 2B3UA 3ZJ0A 1Z2LA 2AFOA 5CBMA 1CPSA 4MMOA 2FVGA 2WPWA 3K2KA 1Y9KA 4B6ZA 4UEZA 3BHXA 3BJ7A 2ZEGA 2KQVA 3IWEA 3SIHA 2IL4A 2ZOGA 1GYTA 4UCMA 5E3BA 1Q2DA 1F2OA 1RTQA 2ARHA 1P0HA 4MHZA 5IX3A 2PJBA 3FVLA 4YRHA 4UA3A 4X3RA 3GPQA 3GIUA 3KGQA 3P2FA 4A39A 2GFQA 2JEVA 4IF5A 1K4JA 2P6GA 1VIXA 1OZPA 4GUAA 2X7BA 4E2AA 4PK2A 4QVTA 3WR7A 1YREA 4BBHA 1AUGA 2Z3PA 5A28A 3WT4A 2WUUA 4IAVA 5JH9A 3TE4A 5H84A 3DLJA 2AFZA 2OZHA 2VXKA 3EO4A 2EUIA 4ABKA 2G9DA 3H4QA 4UIAA 2R1IA 4JWPA 2QYVA 4R3KA 1NSLA 2YGWA 4PQAA 3KR4A 1X12A 2FS5A 2BEIA 3PFEA 2WCTA 4MCSA 2Q7BA 4CGMA 4HKFA 2AJ6A 5F47A 3PB8X 4UFWA 1AYEA 2GANA 3WC7A 4UEFA 2XD7A 3SJXA 3PEIA 3NFZA 2JDDA 4L89A 2PJ4A 4H2KA 2D4PA 1SPVA 2B4BA 2FAVA 1ARLA 1X10A 2DEAA 2V8GA 2CNMA 3BJ8A 3S9NA 4MFPA 4OC1A 5LRJA 1OBRA 3PB9X 2H5MA 1Q2YA 3IWWA 1RXTA 1NSAA 3JRUA 1YLOA 2BFQA 4KOYA 3I1UA 5F49A 3PBEA 5HMNA 1U6MA 3V8IA 5LYIA 1FY7A 4ZGYB 4UCNA 4M6IA 5AG7A 1Z5RA 2GLJA 2YNDA 4B5PB 3FEEA 3ISZA 3SIIA 2XEFA 3D68A 4K0CA 3IU1A 4W9YA 1ZO0A 4LX9A 4MI4A 2Q0YA 1P4NA 4XNHB 2ZEPA 4BD9A 1S3ZA 2PJ1A 5AG4A 2YNCC 3CXPA 3FNCA 1LFWA 1TKJA 4HNYB 4KLWA 4K30A 4MCRA 4CYOA 2DX6A 3FXTA 3FMCA 5ELYA 3D66A 2X47A 1UFHA 3NE8A 1ON0A 3KASA 3LACA 3PRTA 5I4MA 4OP4A 1GHEA 2ZPAA 3Q6ZA 4P6YA 2Q4YA 4NJQA 1TY8A 4R6TA 4OC2A 3SJFA 5J8FA 4WJBA 2XEIA 3CXQA 2WSAA 3FF3A 3MN8A 5AILA 1B6BA 5AG6A 1LOKA 4XPLA 1ZR3A 1CG2A 1S7KA 2POKA 1M4GA 3SIGA 1YX0A 5THWA 3GLJA 4GM5A 4CS0B 5EBVA 4CYQA 5DWMA 1IICA 4NF1A 3GKRA 4O23A 1ZG9A 3RBUA 1YVKA 2ABZA 2QMLA 4IHMA 4P10A 3S6KA 4B14A 2EK9A 1M1DA 1N71A 4R8FA 1FNOA 1YGHA 1IOIA 1YK3A 3B3WA 4NGMA 2PE3A 2GIVA 4CGNA 4CGOA 2QECA 4UF4A 2BOAA 3C26A 4LQ6A 2RNKA 2J8MA 2JZEA 2I3CA 1ELMP 1Q7LA 3F0AA 1L0CA 4F0XA 2FL4A 1FT7A 3QB8A 4P44A 1S7FA 1PYTB 5FSUA 1PUAA 3DNSA 3FJUA 4NJRA 4JD6A 5LYLA 2JZDA 4F8ZA 4BMHA 1YW4A 4JCAA 3D2PA 3T90A 4DYOA 4A30A 2Z3OA 5JPHA 4E8OA 2VQYA 4JYWA 2OOTA 1LAPA 2B5GB 4KOUA 4AG7A 2CY2A 4KLVA 2ACFA 2W2GA 1QSTA 2ATRA 4KOVA 1Q2CA 1YMEA 2Z0ZA 4UIBA 1I1DA 1WK4A 4H89A 2VL1A 4MFLA 4MJ8A 2OU2A 3WABA 4C68A 4R3LA 4X5KA 4B5OA 1BOBA 4P4DA 2BFRA 4GS4A 5CMSA 5HXDA 4R57A 1XE4A 1Y0RA 2O28A 5FVJA 3S9MA 2BUEA 3PGPA 1BO4A 4KUBA 4JVVA 2ZEOA 3B3CA 3IIBA 3CDXA 3OWCA 1XOVA 1Z8XA 2F8HA 3F5BA 2PIZA 4ZBGA 4CAWA 4EVYA 2FXKA 5HOLA 4UFXA 3SI0A 4B11A 1M44A 4LQGA 4M6GA 2XEGA 3CPAA 4B10A 4MY0A 5FSZA 1NE9A 5HVFA 3D7DA 4I49A 3VWEA 2REFA 2Z3KA 5LRKA 4G1PA 2G3AA 3WC5A 4UEEA 4MFQA 1ZG8A 4QB9A 4KOXA 4NCZA 4B12A 4UBRA 3K9UA 2Q51A 2Q44A 4FD7A 3Q71A 2FCKA 2JBKA 3F8KA 2Q04A 4HNXB 4XPKA 3A9LA 3JVNA 3RAMA 3W91A 3IU2A 4FD6A 1VHUA 2ZELA 3KL9A 4CRZB 4Z65A 3TFYA 4AVBA 1R43A 4NSQA 2ZW7A 2IJZA 2Z11A 1TKHA 4NGQA 2AE6A 3EKEA 5HVHA 5JM6A 4MCPA 3IIDA 1XFOA 3EJGA 4RI1A 3SIJA 5EC4A 2ZW6A 1YSJA 4PV6A 7CPAA 1ZLIA 2EEEA 3FRMA 4FWUA 3V2BA 4KSAA 4EMEA 1AMPA 4ESSA 3ZZIA 4ZY0A 1Y0YA 4QUSA 4M85A 5KTAA 1TXRA 2PVVA 3BI1A 3KQXA 1Z4EA 1ELLP 2BSWA 4YFJA 4NGSA 1KWMA 4CAVA 4DJLA 1KUXA 1UWYA 4FD4A 5KTDA 1IOFA 3ETIA 3GPGA 1MJBA 3E0KA 4A2ZA 1QMUA 1BPMA 1MJAA 3GY9A 2JDCA 4OKOA 2V8HA 4MFKA 2K5TA 1ZG7A 3EWPA 4YGOA 2JLMA 4MCQA 5IV0A 4FD5A 2PJ6A 4ETJA 2ZW4A 4R7MA 4ZX8A 4F9VA 1MK4A 3G8WA 3FH4A 5AGEA 4F9UA 1TF8A 2J9AA 2V8VA 2ZEFA 5AG5A 1ZLHA 4ZI6A 1QSOA 1R57A 2AFXA 1QSNA 4EWTA 4TNUA 5G1ZA 4C7IA 4CYNA 2AFUA 1S60A 4J3GA 3CZXA 4OAEA 2ZENA 2L8RA 2P0WA 4PXEA 1H8LA 5G20A 5FSVA 2GLFA 2R8VA 1I12A 1CP6A 4MY3A 2FE7A 1NMTA 4KUAA 3NH4A 3CXSA 5D29A 1TF9A 3H5ZA 4NGNA 3S6GA 4ONUA 2R7HA 3D7GA 2KCWA 4P4EA 4ZY2A 3D7HA 1VHEA 1XF8A 4KS9A 4LUAA 4NGPA 1BPNA 5HVGA 3GUXA 2CF4A 4U5YA 4PXBA 2RB7A 3PZJA 4R87A 1S7NA 1JWQA 3RYOA 1XMBA 3EXNA 4PSWA 4Q7AA 2OZGA 4U9ZA 2AFSA 4JXRA 5BWAB 4Y49C 3R96A 1KZFA 3IIFA 1LRZA 2R98A 3KHXA 3KR5A 3JUWA 4J4ZA 3R9EA 4AVCA 2AFWA 3RNZA 2DPTA 4PSXA 1XJOA 3IJ3A 4OC4A 1QSMA 5G21A 5I0CA 4KOTA 4MFJA 4KVOE 2Z3MA 3V45A 3CPXA 2P6FA 4RUHA 5J8CA 4J5SA 1VHSA 2CNTA 3IWGA 3PP9A 4HPSA 5GCNA 1WWZA 2EO8A 2V8DA 2CXAA 2ZEDA 4IUSA 4XPDC 4MHYA 2AFCA 2V77A 4NFRA 3H8GA 3SHPA 1IYKA 2CTCA 2DXQA 5K8NA 1HDUA 2VRIA 3V7ZA 1I21A 2QVPA 1DTDA 1M4LA 4C2YA 4X2TA 2IQ6A 3IC1A 3FEDA 3FBUA 3SXOA 2VI7A 1HDQA 3VATA 5C88A 1XBUA 2EK8A 3BXMA 4OIDA 4P4JA 3TC8A 2LGRA 4FAIA 1QSRA 3B7IA 3V38A 4D86A 4ONWA 5LYDA 4PXDA 1F2PA 3PBBA 1V0CA 1YLEA 6CPAA 2B58A 2GREA 3T8WA 3IO1A 1ARMA 4FBEA 1ZR5A 4GVWA 1A2ZA 1CM0A 4Q38A 3TCVA 4KOSA 2G0BA 1HJZA 3EWRA 3B3TA 2B5GA 2PR1A 4WWVA 4A94A 5A27A 1YR0A 5IB0A 1TIQA 3LODA 2VZZA 3H8EA 2RC4A 4YU9A 4AB7A 5CNPA 2PC1A 2WYRA 3PB6X 3R95A 4ZY1A 2I79A 1YW6A 4OADA 3BI0A 3B8GA 2OH1A 3SI2A 5FSXA 1Y9WA 2GU2A 3D3SA 1MJ9A 2PJ7A 3SI1A 1DE4C 3KQZA 2PJCA 5JQ4A 2ANPA 2JEWA 2ODFA 3FECA 3LMSA 4KORA 4OC0A 1PU9A 1NJRA 5HIHA 5CB3A 4ORFA 5G22A 3R9FA 1XRYA 4U9YA 2CNSA 4OC3A 2HV2A 1JQGA 1IGBA 2HQYA 2PQ8A 3PFOA 4JJXA 2NMTA 1IY7A 3NH5A 3VFQA 1F57A 2B4DA 3PB7X 4OMEA 3GB0A 2Q4VA 1CPXA 1LANA 2PJ8A 2PJ9A 1TKFA 2OR4A 4EFDA 4QBJA 4KVXA 2C6PA 2O4HA 2YNEA 4A37A 1XEBA 5KTCA 3I9SA 3H8FA 2B3VA 2P6EA 2REEA 3SJEA 4PK3A 3B35A 4AXVA 2Y0MA 1BAVA 4C2ZA 4AG9A 4F0YA 2DPSA 4A33A 2B4DB 3DR8A 5K8PA 1IIDA 4JXQA 4CGLA 2J8NA 3N5FA 3B3VA 4CAEA 2G3TA 3D2MA 1Z8LA 2PJ5A 2OB0A 3P2HA 3S6HA 2PIYA 4ETKA 5E96A 5F48A 2PJ0A 3D7FA 4ZYQA 3VH9A 3R9GA 3EC4A 3BLNA 3NH8A 8CPAA 2HC9A 3DGVA 2Z3LA 1YD9A 1Z8TA 4UMLA 4TU0A 2FSRA 2RFHA 4P4FA 3N7ZA 2VEZA 3KHZA 4XNHC 1TXZA 1EE3P 3D4UA 3IFEA 1SQHA 1Z4RA 4NGRA 5DS0A 3SXNA 4CAFA 5D8NA 1S7LA 1Y7EA 4CRYB 1PCAA 4MFZA 3B2YA 3GYAA 3DDDA 5C82A 2PR8A 4M3SA 2ZW5A 2NYQA 3HLPA 2JZFA 4B5PA 2Q43A 2VZYA 3S9LA 1VKCA 2Z3NA 3HUVA 2BCOA 4UWJA 4ABLA 2PJAA 3FB3A 4IQYA 4FUUA 2D4OA 1IU8A 4F6AA 1RO5A 4JGKA 3JZTA 5EMIA 4KVME 3TX8A 2O53A 3ISXA 4NEXA 3VARA 5F09A 4OLLA 4JLYA 3EJFA 1S5KA 5FSYA 4C7HA 3TT2A 2J8RA 3RO0A 3W6XA 2C27A 1M4DA 2VBQA 4HNWB 5F46A 3TO6A 1Z8WA 3EWOA 2PVWA 2DF5A 3D8PA 4M6HA 1HEEA 3D67A 4GVVA 4KOWA 2GE3A 1CBXA 2C1CA 4TWEA 1M4IA 2EWBA 1Y7RA 2FIWA 4YWYA 2FIAA 3DSBA 4E0AA 4ZX9A 2EBJA 2ZEMA 3GPOA 5DUSA 2ZEHA 4KZTA 2F5IA 5J1QA 4Q36A 5H86A 5K8OA 3SJGA 5K8MA 4JZ0A 2PJ2A 2Q4ZA 3UY5A 3TOBA 1XIXA 2QIRA 3IEHA 2C6GA 4KSFA 4NGTA 4RN7A 2CIJA 2OZUA 2PCUA 3KKWA 2QJ8A 4CAXA 1Z9UA 4MHPA 4P4BA 3W6SA 2PDOA 2XEJA 3LD2A 2HUZA 2ZOFA 3MGDA 4L8AA 1CP7A 4P45A 4A95A 4BINA 4PXCA 3EY5A 1IYLA 3KI9A 3PB4X 5DWNA 2FG1A 4KYBA 3EFAA 2FT0A 2IMOA 3L2NA 5LRGA 4CGPA 4CYPA 4K3NA 4OIWA 5IB9A 4B13A
chains in the Genus database with same CATH topology
4A38A 4R76A 4P4IA 3GQEA 4J5RA 3EWQA 4IK2A 1QQ9A 4CPAA 4KSIA 3NA6A 2PRQA 2BO9A 2ZEEA 1R3NA 4X8IA 1CX8A 4PPZA 2NSMA 4OC5A 3MRUA 5CPAA 3K9TA 4MRIA 3B3SA 1VGYA 2WZNA 4J5QA 3EW5A 2HB6A 4MXUA 4FBEA 1LCPA 3LWUA 1VHOA 3CT9A 3KZWA 3QNVA 2F7VA 5LYFA 3RZAA 2PJ3A 4MHNA 1LAMA 5JGFA 2C6CA 4DUKA 3FX6A 2AFMA 5CB5A 4JLLA 1BLLE 2JBJA 2CTBA 3WC6A 3GQOA 1Z2LA 2AFOA 5CBMA 1CPSA 4MMOA 2FVGA 3K2KA 4B6ZA 4UEZA 3BHXA 2ZEGA 3SIHA 2ZOGA 1GYTA 5E3BA 1RTQA 1F2OA 4MHZA 2PJBA 3FVLA 4X3RA 3GPQA 3KGQA 4A39A 1VIXA 4GUAA 3WT4A 5JH9A 4IAVA 3DLJA 2AFZA 4ABKA 2G9DA 4UIAA 2QYVA 4PQAA 3KR4A 3PFEA 4MCSA 3PB8X 1AYEA 3WC7A 4UEFA 2XD7A 3SJXA 3PEIA 3NFZA 2PJ4A 4H2KA 1SPVA 2FAVA 1ARLA 2DEAA 2V8GA 3S9NA 4OC1A 5LRJA 1OBRA 3PB9X 3IWWA 1NSAA 3JRUA 1YLOA 2BFQA 3I1UA 3PBEA 5LYIA 1Z5RA 2GLJA 3FEEA 3ISZA 3SIIA 2XEFA 3D68A 4K0CA 4W9YA 4BD9A 2ZEPA 2PJ1A 1LFWA 1TKJA 4MCRA 2DX6A 3FMCA 5ELYA 3D66A 2X47A 3KASA 3PRTA 5I4MA 4OP4A 3Q6ZA 4P6YA 4NJQA 3SJFA 1TY8A 4R6TA 4OC2A 4WJBA 2XEIA 3FF3A 3MN8A 5AILA 1LOKA 1ZR3A 1CG2A 2POKA 5THWA 3SIGA 3GLJA 4GM5A 4O23A 3RBUA 1ZG9A 2ABZA 4IHMA 4P10A 2EK9A 4R8FA 1FNOA 3B3WA 4NGMA 2PE3A 4UF4A 2BOAA 2I3CA 1ELMP 1Q7LA 4P44A 1FT7A 1PYTB 5FSUA 3FJUA 4NJRA 5LYLA 4F8ZA 1YW4A 4JCAA 4DYOA 2OOTA 4JYWA 1LAPA 2ACFA 1YMEA 4UIBA 2VL1A 3WABA 4P4DA 2BFRA 5HXDA 5CMSA 1Y0RA 3S9MA 4JVVA 2ZEOA 3B3CA 3IIBA 3CDXA 2F8HA 2PIZA 2FXKA 5HOLA 3SI0A 4LQGA 2XEGA 3CPAA 5FSZA 5HVFA 3D7DA 5LRKA 4G1PA 3WC5A 4UEEA 1ZG8A 2Q51A 3Q71A 2JBKA 3RAMA 1VHUA 2ZELA 3KL9A 4Z65A 1R43A 2IJZA 1TKHA 4NGQA 3EKEA 5HVHA 5JM6A 4MCPA 3IIDA 1XFOA 3EJGA 3SIJA 1YSJA 7CPAA 1ZLIA 2EEEA 4FWUA 3V2BA 4EMEA 1AMPA 4ESSA 4ZY0A 1Y0YA 1TXRA 2PVVA 3BI1A 3KQXA 1ELLP 4NGSA 1KWMA 4DJLA 1UWYA 3ETIA 3GPGA 1QMUA 1BPMA 4OKOA 2V8HA 1ZG7A 3EWPA 4MCQA 2PJ6A 4ETJA 4R7MA 4ZX8A 4F9VA 3FH4A 4F9UA 1TF8A 2J9AA 2V8VA 2ZEFA 1ZLHA 4ZI6A 2AFXA 4EWTA 4TNUA 2AFUA 2ZENA 2L8RA 4PXEA 1H8LA 5FSVA 2GLFA 1CP6A 3NH4A 5D29A 1TF9A 4NGNA 3D7GA 4P4EA 4ZY2A 3D7HA 1VHEA 4NGPA 1BPNA 5HVGA 3GUXA 2CF4A 4PXBA 2RB7A 1XMBA 4Q7AA 2AFSA 3KHXA 3IIFA 3KR5A 4J4ZA 2AFWA 1XJOA 3IJ3A 4OC4A 3V45A 3CPXA 4RUHA 4J5SA 2V8DA 2ZEDA 4MHYA 2AFCA 2V77A 4NFRA 3H8GA 2CTCA 5K8NA 1HDUA 2VRIA 3V7ZA 2QVPA 1DTDA 1M4LA 4X2TA 2IQ6A 3IC1A 3FEDA 1HDQA 3VATA 1XBUA 2EK8A 3BXMA 4OIDA 4P4JA 3TC8A 2LGRA 4FAIA 3B7IA 3V38A 4D86A 4ONWA 5LYDA 4PXDA 1F2PA 3PBBA 6CPAA 2GREA 3T8WA 3IO1A 1ARMA 1ZR5A 4GVWA 1HJZA 3EWRA 3B3TA 4A94A 4WWVA 3H8EA 4YU9A 2WYRA 3PB6X 4ZY1A 1YW6A 3SI2A 3BI0A 5FSXA 2GU2A 2PJ7A 3SI1A 1DE4C 3KQZA 2PJCA 3FECA 2ANPA 2JEWA 3LMSA 4OC0A 1NJRA 5HIHA 5CB3A 1XRYA 4OC3A 1JQGA 1IGBA 3PFOA 1IY7A 3NH5A 3VFQA 1F57A 3PB7X 4OMEA 3GB0A 1CPXA 1LANA 2PJ8A 2PJ9A 1TKFA 2OR4A 4EFDA 2C6PA 2O4HA 4A37A 3H8FA 3SJEA 4AXVA 3B35A 1BAVA 5K8PA 3N5FA 3B3VA 1Z8LA 2PJ5A 2PIYA 4ETKA 2PJ0A 3D7FA 4ZYQA 3VH9A 3NH8A 8CPAA 2HC9A 3DGVA 1YD9A 4UMLA 4TU0A 2RFHA 4P4FA 3KHZA 1TXZA 1EE3P 3D4UA 3IFEA 4NGRA 5DS0A 5D8NA 1Y7EA 1PCAA 3B2YA 2NYQA 3HLPA 2Q43A 3S9LA 3HUVA 2BCOA 4ABLA 2PJAA 4IQYA 4FUUA 4JGKA 3JZTA 3TX8A 2O53A 3ISXA 3VARA 5F09A 3EJFA 5FSYA 3EWOA 2PVWA 1HEEA 3D67A 4GVVA 1CBXA 2C1CA 4TWEA 2EWBA 4YWYA 4ZX9A 2ZEMA 5J1QA 3GPOA 5DUSA 2ZEHA 5K8OA 3SJGA 5K8MA 4JZ0A 2PJ2A 2Q4ZA 3IEHA 2C6GA 4NGTA 2CIJA 2PCUA 2QJ8A 4P4BA 4MHPA 2XEJA 2ZOFA 1CP7A 4P45A 4PXCA 3KI9A 3PB4X 2FG1A 4KYBA 2IMOA 3L2NA 5LRGA 4K3NA 4OIWA 5IB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A38 A;  4R76 A;  4P4I A;  3GQE A;  4J5R A;  3EWQ A;  4IK2 A;  1QQ9 A;  4CPA A;  4KSI A;  3NA6 A;  2PRQ A;  2BO9 A;  2ZEE A;  1R3N A;  4X8I A;  1CX8 A;  4PPZ A;  2NSM A;  4OC5 A;  3MRU A;  5CPA A;  3K9T A;  4MRI A;  3B3S A;  1VGY A;  2WZN A;  4J5Q A;  3EW5 A;  2HB6 A;  4MXU A;  4FBE A;  1LCP A;  3LWU A;  1VHO A;  3CT9 A;  3KZW A;  3QNV A;  2F7V A;  5LYF A;  3RZA A;  2PJ3 A;  4MHN A;  1LAM A;  5JGF A;  2C6C A;  4DUK A;  3FX6 A;  2AFM A;  5CB5 A;  4JLL A;  1BLL E;  2JBJ A;  2CTB A;  3WC6 A;  3GQO A;  1Z2L A;  2AFO A;  5CBM A;  1CPS A;  4MMO A;  2FVG A;  3K2K A;  4B6Z A;  4UEZ A;  3BHX A;  2ZEG A;  3SIH A;  2ZOG A;  1GYT A;  5E3B A;  1RTQ A;  1F2O A;  4MHZ A;  2PJB A;  3FVL A;  4X3R A;  3GPQ A;  3KGQ A;  4A39 A;  1VIX A;  4GUA A;  3WT4 A;  5JH9 A;  4IAV A;  3DLJ A;  2AFZ A;  4ABK A;  2G9D A;  4UIA A;  2QYV A;  4PQA A;  3KR4 A;  3PFE A;  4MCS A;  3PB8 X;  1AYE A;  3WC7 A;  4UEF A;  2XD7 A;  3SJX A;  3PEI A;  3NFZ A;  2PJ4 A;  4H2K A;  1SPV A;  2FAV A;  1ARL A;  2DEA A;  2V8G A;  3S9N A;  4OC1 A;  5LRJ A;  1OBR A;  3PB9 X;  3IWW A;  1NSA A;  3JRU A;  1YLO A;  2BFQ A;  3I1U A;  3PBE A;  5LYI A;  1Z5R A;  2GLJ A;  3FEE A;  3ISZ A;  3SII A;  2XEF A;  3D68 A;  4K0C A;  4W9Y A;  4BD9 A;  2ZEP A;  2PJ1 A;  1LFW A;  1TKJ A;  4MCR A;  2DX6 A;  3FMC A;  5ELY A;  3D66 A;  2X47 A;  3KAS A;  3PRT A;  5I4M A;  4OP4 A;  3Q6Z A;  4P6Y A;  4NJQ A;  3SJF A;  1TY8 A;  4R6T A;  4OC2 A;  4WJB A;  2XEI A;  3FF3 A;  3MN8 A;  5AIL A;  1LOK A;  1ZR3 A;  1CG2 A;  2POK A;  5THW A;  3SIG A;  3GLJ A;  4GM5 A;  4O23 A;  3RBU A;  1ZG9 A;  2ABZ A;  4IHM A;  4P10 A;  2EK9 A;  4R8F A;  1FNO A;  3B3W A;  4NGM A;  2PE3 A;  4UF4 A;  2BOA A;  2I3C A;  1ELM P;  1Q7L A;  4P44 A;  1FT7 A;  1PYT B;  5FSU A;  3FJU A;  4NJR A;  5LYL A;  4F8Z A;  1YW4 A;  4JCA A;  4DYO A;  2OOT A;  4JYW A;  1LAP A;  2ACF A;  1YME A;  4UIB A;  2VL1 A;  3WAB A;  4P4D A;  2BFR A;  5HXD A;  5CMS A;  1Y0R A;  3S9M A;  4JVV A;  2ZEO A;  3B3C A;  3IIB A;  3CDX A;  2F8H A;  2PIZ A;  2FXK A;  5HOL A;  3SI0 A;  4LQG A;  2XEG A;  3CPA A;  5FSZ A;  5HVF A;  3D7D A;  5LRK A;  4G1P A;  3WC5 A;  4UEE A;  1ZG8 A;  2Q51 A;  3Q71 A;  2JBK A;  3RAM A;  1VHU A;  2ZEL A;  3KL9 A;  4Z65 A;  1R43 A;  2IJZ A;  1TKH A;  4NGQ A;  3EKE A;  5HVH A;  5JM6 A;  4MCP A;  3IID A;  1XFO A;  3EJG A;  3SIJ A;  1YSJ A;  7CPA A;  1ZLI A;  2EEE A;  4FWU A;  3V2B A;  4EME A;  1AMP A;  4ESS A;  4ZY0 A;  1Y0Y A;  1TXR A;  2PVV A;  3BI1 A;  3KQX A;  1ELL P;  4NGS A;  1KWM A;  4DJL A;  1UWY A;  3ETI A;  3GPG A;  1QMU A;  1BPM A;  4OKO A;  2V8H A;  1ZG7 A;  3EWP A;  4MCQ A;  2PJ6 A;  4ETJ A;  4R7M A;  4ZX8 A;  4F9V A;  3FH4 A;  4F9U A;  1TF8 A;  2J9A A;  2V8V A;  2ZEF A;  1ZLH A;  4ZI6 A;  2AFX A;  4EWT A;  4TNU A;  2AFU A;  2ZEN A;  2L8R A;  4PXE A;  1H8L A;  5FSV A;  2GLF A;  1CP6 A;  3NH4 A;  5D29 A;  1TF9 A;  4NGN A;  3D7G A;  4P4E A;  4ZY2 A;  3D7H A;  1VHE A;  4NGP A;  1BPN A;  5HVG A;  3GUX A;  2CF4 A;  4PXB A;  2RB7 A;  1XMB A;  4Q7A A;  2AFS A;  3KHX A;  3IIF A;  3KR5 A;  4J4Z A;  2AFW A;  1XJO A;  3IJ3 A;  4OC4 A;  3V45 A;  3CPX A;  4RUH A;  4J5S A;  2V8D A;  2ZED A;  4MHY A;  2AFC A;  2V77 A;  4NFR A;  3H8G A;  2CTC A;  5K8N A;  1HDU A;  2VRI A;  3V7Z A;  2QVP A;  1DTD A;  1M4L A;  4X2T A;  2IQ6 A;  3IC1 A;  3FED A;  1HDQ A;  3VAT A;  1XBU A;  2EK8 A;  3BXM A;  4OID A;  4P4J A;  3TC8 A;  2LGR A;  4FAI A;  3B7I A;  3V38 A;  4D86 A;  4ONW A;  5LYD A;  4PXD A;  1F2P A;  3PBB A;  6CPA A;  2GRE A;  3T8W A;  3IO1 A;  1ARM A;  1ZR5 A;  4GVW A;  1HJZ A;  3EWR A;  3B3T A;  4A94 A;  4WWV A;  3H8E A;  4YU9 A;  2WYR A;  3PB6 X;  4ZY1 A;  1YW6 A;  3SI2 A;  3BI0 A;  5FSX A;  2GU2 A;  2PJ7 A;  3SI1 A;  1DE4 C;  3KQZ A;  2PJC A;  3FEC A;  2ANP A;  2JEW A;  3LMS A;  4OC0 A;  1NJR A;  5HIH A;  5CB3 A;  1XRY A;  4OC3 A;  1JQG A;  1IGB A;  3PFO A;  1IY7 A;  3NH5 A;  3VFQ A;  1F57 A;  3PB7 X;  4OME A;  3GB0 A;  1CPX A;  1LAN A;  2PJ8 A;  2PJ9 A;  1TKF A;  2OR4 A;  4EFD A;  2C6P A;  2O4H A;  4A37 A;  3H8F A;  3SJE A;  4AXV A;  3B35 A;  1BAV A;  5K8P A;  3N5F A;  3B3V A;  1Z8L A;  2PJ5 A;  2PIY A;  4ETK A;  2PJ0 A;  3D7F A;  4ZYQ A;  3VH9 A;  3NH8 A;  8CPA A;  2HC9 A;  3DGV A;  1YD9 A;  4UML A;  4TU0 A;  2RFH A;  4P4F A;  3KHZ A;  1TXZ A;  1EE3 P;  3D4U A;  3IFE A;  4NGR A;  5DS0 A;  5D8N A;  1Y7E A;  1PCA A;  3B2Y A;  2NYQ A;  3HLP A;  2Q43 A;  3S9L A;  3HUV A;  2BCO A;  4ABL A;  2PJA A;  4IQY A;  4FUU A;  4JGK A;  3JZT A;  3TX8 A;  2O53 A;  3ISX A;  3VAR A;  5F09 A;  3EJF A;  5FSY A;  3EWO A;  2PVW A;  1HEE A;  3D67 A;  4GVV A;  1CBX A;  2C1C A;  4TWE A;  2EWB A;  4YWY A;  4ZX9 A;  2ZEM A;  5J1Q A;  3GPO A;  5DUS A;  2ZEH A;  5K8O A;  3SJG A;  5K8M A;  4JZ0 A;  2PJ2 A;  2Q4Z A;  3IEH A;  2C6G A;  4NGT A;  2CIJ A;  2PCU A;  2QJ8 A;  4P4B A;  4MHP A;  2XEJ A;  2ZOF A;  1CP7 A;  4P45 A;  4PXC A;  3KI9 A;  3PB4 X;  2FG1 A;  4KYB A;  2IMO A;  3L2N A;  5LRG A;  4K3N A;  4OIW A;  5IB9 A; 
#chains in the Genus database with same CATH topology
 4R9M A;  1IB1 E;  4A38 A;  3TO7 A;  3QAH A;  4R76 A;  3S6F A;  4H6Z A;  2EVN A;  4P4I A;  1J4J A;  3GQE A;  4J5R A;  1CJW A;  3G3S A;  3EWQ A;  4IK2 A;  1QQ9 A;  4CPA A;  4MHD A;  1B87 A;  3T9Y A;  4A31 A;  4KSI A;  2I00 A;  2ZXV A;  3NA6 A;  4QC6 A;  4DNC A;  2FXF A;  3IGR A;  3FIX A;  2PRQ A;  2BO9 A;  2ZEE A;  1R3N A;  3JTK A;  1CX8 A;  4PPZ A;  4X8I A;  2NSM A;  3I3G A;  3MRU A;  3NE7 A;  3K9T A;  2YNC A;  4MRI A;  4OC5 A;  4UCP A;  5CPA A;  3TO9 A;  3DR6 A;  3B3S A;  4H6U A;  2Q7S A;  4UWI A;  1VGY A;  2PSW A;  4J5Q A;  3EW5 A;  2HB6 A;  2WZN A;  4MXU A;  1LCP A;  2BL1 A;  3LWU A;  1VHO A;  3CT9 A;  4A32 A;  3FYN A;  3TOA A;  2WPX A;  3KZW A;  4AVA A;  3QNV A;  4XPD B;  1YVO A;  2F7V A;  3R1K A;  5LYF A;  3RZA A;  2PJ3 A;  4MBU A;  5HH1 A;  3TTH A;  1YQE A;  4MHN A;  1LAM A;  5JGF A;  2C6C A;  3VWD A;  5ISV A;  4C2X A;  3QAY A;  4II9 A;  2Z10 A;  1KUV A;  4DUK A;  3FX6 A;  4UFV A;  2AFM A;  2A4N A;  4RS2 A;  1KUY A;  5CB5 A;  4JLL A;  4GXH A;  1BLL E;  2JBJ A;  2PRB A;  2CTB A;  3WC6 A;  3GQO A;  4NXY A;  4Y49 B;  1XMT A;  2B3U A;  3ZJ0 A;  1Z2L A;  2AFO A;  5CBM A;  1CPS A;  4MMO A;  2FVG A;  2WPW A;  3K2K A;  1Y9K A;  4B6Z A;  4UEZ A;  3BHX A;  3BJ7 A;  2ZEG A;  2KQV A;  3IWE A;  3SIH A;  2IL4 A;  2ZOG A;  1GYT A;  4UCM A;  5E3B A;  1Q2D A;  1F2O A;  1RTQ A;  2ARH A;  1P0H A;  4MHZ A;  5IX3 A;  2PJB A;  3FVL A;  4YRH A;  4UA3 A;  4X3R A;  3GPQ A;  3GIU A;  3KGQ A;  3P2F A;  4A39 A;  2GFQ A;  2JEV A;  4IF5 A;  1K4J A;  2P6G A;  1VIX A;  1OZP A;  4GUA A;  2X7B A;  4E2A A;  4PK2 A;  4QVT A;  3WR7 A;  1YRE A;  4BBH A;  1AUG A;  2Z3P A;  5A28 A;  3WT4 A;  2WUU A;  4IAV A;  5JH9 A;  3TE4 A;  5H84 A;  3DLJ A;  2AFZ A;  2OZH A;  2VXK A;  3EO4 A;  2EUI A;  4ABK A;  2G9D A;  3H4Q A;  4UIA A;  2R1I A;  4JWP A;  2QYV A;  4R3K A;  1NSL A;  2YGW A;  4PQA A;  3KR4 A;  1X12 A;  2FS5 A;  2BEI A;  3PFE A;  2WCT A;  4MCS A;  2Q7B A;  4CGM A;  4HKF A;  2AJ6 A;  5F47 A;  3PB8 X;  4UFW A;  1AYE A;  2GAN A;  3WC7 A;  4UEF A;  2XD7 A;  3SJX A;  3PEI A;  3NFZ A;  2JDD A;  4L89 A;  2PJ4 A;  4H2K A;  2D4P A;  1SPV A;  2B4B A;  2FAV A;  1ARL A;  1X10 A;  2DEA A;  2V8G A;  2CNM A;  3BJ8 A;  3S9N A;  4MFP A;  4OC1 A;  5LRJ A;  1OBR A;  3PB9 X;  2H5M A;  1Q2Y A;  3IWW A;  1RXT A;  1NSA A;  3JRU A;  1YLO A;  2BFQ A;  4KOY A;  3I1U A;  5F49 A;  3PBE A;  5HMN A;  1U6M A;  3V8I A;  5LYI A;  1FY7 A;  4ZGY B;  4UCN A;  4M6I A;  5AG7 A;  1Z5R A;  2GLJ A;  2YND A;  4B5P B;  3FEE A;  3ISZ A;  3SII A;  2XEF A;  3D68 A;  4K0C A;  3IU1 A;  4W9Y A;  1ZO0 A;  4LX9 A;  4MI4 A;  2Q0Y A;  1P4N A;  4XNH B;  2ZEP A;  4BD9 A;  1S3Z A;  2PJ1 A;  5AG4 A;  2YNC C;  3CXP A;  3FNC A;  1LFW A;  1TKJ A;  4HNY B;  4KLW A;  4K30 A;  4MCR A;  4CYO A;  2DX6 A;  3FXT A;  3FMC A;  5ELY A;  3D66 A;  2X47 A;  1UFH A;  3NE8 A;  1ON0 A;  3KAS A;  3LAC A;  3PRT A;  5I4M A;  4OP4 A;  1GHE A;  2ZPA A;  3Q6Z A;  4P6Y A;  2Q4Y A;  4NJQ A;  1TY8 A;  4R6T A;  4OC2 A;  3SJF A;  5J8F A;  4WJB A;  2XEI A;  3CXQ A;  2WSA A;  3FF3 A;  3MN8 A;  5AIL A;  1B6B A;  5AG6 A;  1LOK A;  4XPL A;  1ZR3 A;  1CG2 A;  1S7K A;  2POK A;  1M4G A;  3SIG A;  1YX0 A;  5THW A;  3GLJ A;  4GM5 A;  4CS0 B;  5EBV A;  4CYQ A;  5DWM A;  1IIC A;  4NF1 A;  3GKR A;  4O23 A;  1ZG9 A;  3RBU A;  1YVK A;  2ABZ A;  2QML A;  4IHM A;  4P10 A;  3S6K A;  4B14 A;  2EK9 A;  1M1D A;  1N71 A;  4R8F A;  1FNO A;  1YGH A;  1IOI A;  1YK3 A;  3B3W A;  4NGM A;  2PE3 A;  2GIV A;  4CGN A;  4CGO A;  2QEC A;  4UF4 A;  2BOA A;  3C26 A;  4LQ6 A;  2RNK A;  2J8M A;  2JZE A;  2I3C A;  1ELM P;  1Q7L A;  3F0A A;  1L0C A;  4F0X A;  2FL4 A;  1FT7 A;  3QB8 A;  4P44 A;  1S7F A;  1PYT B;  5FSU A;  1PUA A;  3DNS A;  3FJU A;  4NJR A;  4JD6 A;  5LYL A;  2JZD A;  4F8Z A;  4BMH A;  1YW4 A;  4JCA A;  3D2P A;  3T90 A;  4DYO A;  4A30 A;  2Z3O A;  5JPH A;  4E8O A;  2VQY A;  4JYW A;  2OOT A;  1LAP A;  2B5G B;  4KOU A;  4AG7 A;  2CY2 A;  4KLV A;  2ACF A;  2W2G A;  1QST A;  2ATR A;  4KOV A;  1Q2C A;  1YME A;  2Z0Z A;  4UIB A;  1I1D A;  1WK4 A;  4H89 A;  2VL1 A;  4MFL A;  4MJ8 A;  2OU2 A;  3WAB A;  4C68 A;  4R3L A;  4X5K A;  4B5O A;  1BOB A;  4P4D A;  2BFR A;  4GS4 A;  5CMS A;  5HXD A;  4R57 A;  1XE4 A;  1Y0R A;  2O28 A;  5FVJ A;  3S9M A;  2BUE A;  3PGP A;  1BO4 A;  4KUB A;  4JVV A;  2ZEO A;  3B3C A;  3IIB A;  3CDX A;  3OWC A;  1XOV A;  1Z8X A;  2F8H A;  3F5B A;  2PIZ A;  4ZBG A;  4CAW A;  4EVY A;  2FXK A;  5HOL A;  4UFX A;  3SI0 A;  4B11 A;  1M44 A;  4LQG A;  4M6G A;  2XEG A;  3CPA A;  4B10 A;  4MY0 A;  5FSZ A;  1NE9 A;  5HVF A;  3D7D A;  4I49 A;  3VWE A;  2REF A;  2Z3K A;  5LRK A;  4G1P A;  2G3A A;  3WC5 A;  4UEE A;  4MFQ A;  1ZG8 A;  4QB9 A;  4KOX A;  4NCZ A;  4B12 A;  4UBR A;  3K9U A;  2Q51 A;  2Q44 A;  4FD7 A;  3Q71 A;  2FCK A;  2JBK A;  3F8K A;  2Q04 A;  4HNX B;  4XPK A;  3A9L A;  3JVN A;  3RAM A;  3W91 A;  3IU2 A;  4FD6 A;  1VHU A;  2ZEL A;  3KL9 A;  4CRZ B;  4Z65 A;  3TFY A;  4AVB A;  1R43 A;  4NSQ A;  2ZW7 A;  2IJZ A;  2Z11 A;  1TKH A;  4NGQ A;  2AE6 A;  3EKE A;  5HVH A;  5JM6 A;  4MCP A;  3IID A;  1XFO A;  3EJG A;  4RI1 A;  3SIJ A;  5EC4 A;  2ZW6 A;  1YSJ A;  4PV6 A;  7CPA A;  1ZLI A;  2EEE A;  3FRM A;  4FWU A;  3V2B A;  4KSA A;  4EME A;  1AMP A;  4ESS A;  3ZZI A;  4ZY0 A;  1Y0Y A;  4QUS A;  4M85 A;  5KTA A;  1TXR A;  2PVV A;  3BI1 A;  3KQX A;  1Z4E A;  1ELL P;  2BSW A;  4YFJ A;  4NGS A;  1KWM A;  4CAV A;  4DJL A;  1KUX A;  1UWY A;  4FD4 A;  5KTD A;  1IOF A;  3ETI A;  3GPG A;  1MJB A;  3E0K A;  4A2Z A;  1QMU A;  1BPM A;  1MJA A;  3GY9 A;  2JDC A;  4OKO A;  2V8H A;  4MFK A;  2K5T A;  1ZG7 A;  3EWP A;  4YGO A;  2JLM A;  4MCQ A;  5IV0 A;  4FD5 A;  2PJ6 A;  4ETJ A;  2ZW4 A;  4R7M A;  4ZX8 A;  4F9V A;  1MK4 A;  3G8W A;  3FH4 A;  5AGE A;  4F9U A;  1TF8 A;  2J9A A;  2V8V A;  2ZEF A;  5AG5 A;  1ZLH A;  4ZI6 A;  1QSO A;  1R57 A;  2AFX A;  1QSN A;  4EWT A;  4TNU A;  5G1Z A;  4C7I A;  4CYN A;  2AFU A;  1S60 A;  4J3G A;  3CZX A;  4OAE A;  2ZEN A;  2L8R A;  2P0W A;  4PXE A;  1H8L A;  5G20 A;  5FSV A;  2GLF A;  2R8V A;  1I12 A;  1CP6 A;  4MY3 A;  2FE7 A;  1NMT A;  4KUA A;  3NH4 A;  3CXS A;  5D29 A;  1TF9 A;  3H5Z A;  4NGN A;  3S6G A;  4ONU A;  2R7H A;  3D7G A;  2KCW A;  4P4E A;  4ZY2 A;  3D7H A;  1VHE A;  1XF8 A;  4KS9 A;  4LUA A;  4NGP A;  1BPN A;  5HVG A;  3GUX A;  2CF4 A;  4U5Y A;  4PXB A;  2RB7 A;  3PZJ A;  4R87 A;  1S7N A;  1JWQ A;  3RYO A;  1XMB A;  3EXN A;  4PSW A;  4Q7A A;  2OZG A;  4U9Z A;  2AFS A;  4JXR A;  5BWA B;  4Y49 C;  3R96 A;  1KZF A;  3IIF A;  1LRZ A;  2R98 A;  3KHX A;  3KR5 A;  3JUW A;  4J4Z A;  3R9E A;  4AVC A;  2AFW A;  3RNZ A;  2DPT A;  4PSX A;  1XJO A;  3IJ3 A;  4OC4 A;  1QSM A;  5G21 A;  5I0C A;  4KOT A;  4MFJ A;  4KVO E;  2Z3M A;  3V45 A;  3CPX A;  2P6F A;  4RUH A;  5J8C A;  4J5S A;  1VHS A;  2CNT A;  3IWG A;  3PP9 A;  4HPS A;  5GCN A;  1WWZ A;  2EO8 A;  2V8D A;  2CXA A;  2ZED A;  4IUS A;  4XPD C;  4MHY A;  2AFC A;  2V77 A;  4NFR A;  3H8G A;  3SHP A;  1IYK A;  2CTC A;  2DXQ A;  5K8N A;  1HDU A;  2VRI A;  3V7Z A;  1I21 A;  2QVP A;  1DTD A;  1M4L A;  4C2Y A;  4X2T A;  2IQ6 A;  3IC1 A;  3FED A;  3FBU A;  3SXO A;  2VI7 A;  1HDQ A;  3VAT A;  5C88 A;  1XBU A;  2EK8 A;  3BXM A;  4OID A;  4P4J A;  3TC8 A;  2LGR A;  4FAI A;  1QSR A;  3B7I A;  3V38 A;  4D86 A;  4ONW A;  5LYD A;  4PXD A;  1F2P A;  3PBB A;  1V0C A;  1YLE A;  6CPA A;  2B58 A;  2GRE A;  3T8W A;  3IO1 A;  1ARM A;  4FBE A;  1ZR5 A;  4GVW A;  1A2Z A;  1CM0 A;  4Q38 A;  3TCV A;  4KOS A;  2G0B A;  1HJZ A;  3EWR A;  3B3T A;  2B5G A;  2PR1 A;  4WWV A;  4A94 A;  5A27 A;  1YR0 A;  5IB0 A;  1TIQ A;  3LOD A;  2VZZ A;  3H8E A;  2RC4 A;  4YU9 A;  4AB7 A;  5CNP A;  2PC1 A;  2WYR A;  3PB6 X;  3R95 A;  4ZY1 A;  2I79 A;  1YW6 A;  4OAD A;  3BI0 A;  3B8G A;  2OH1 A;  3SI2 A;  5FSX A;  1Y9W A;  2GU2 A;  3D3S A;  1MJ9 A;  2PJ7 A;  3SI1 A;  1DE4 C;  3KQZ A;  2PJC A;  5JQ4 A;  2ANP A;  2JEW A;  2ODF A;  3FEC A;  3LMS A;  4KOR A;  4OC0 A;  1PU9 A;  1NJR A;  5HIH A;  5CB3 A;  4ORF A;  5G22 A;  3R9F A;  1XRY A;  4U9Y A;  2CNS A;  4OC3 A;  2HV2 A;  1JQG A;  1IGB A;  2HQY A;  2PQ8 A;  3PFO A;  4JJX A;  2NMT A;  1IY7 A;  3NH5 A;  3VFQ A;  1F57 A;  2B4D A;  3PB7 X;  4OME A;  3GB0 A;  2Q4V A;  1CPX A;  1LAN A;  2PJ8 A;  2PJ9 A;  1TKF A;  2OR4 A;  4EFD A;  4QBJ A;  4KVX A;  2C6P A;  2O4H A;  2YNE A;  4A37 A;  1XEB A;  5KTC A;  3I9S A;  3H8F A;  2B3V A;  2P6E A;  2REE A;  3SJE A;  4PK3 A;  3B35 A;  4AXV A;  2Y0M A;  1BAV A;  4C2Z A;  4AG9 A;  4F0Y A;  2DPS A;  4A33 A;  2B4D B;  3DR8 A;  5K8P A;  1IID A;  4JXQ A;  4CGL A;  2J8N A;  3N5F A;  3B3V A;  4CAE A;  2G3T A;  3D2M A;  1Z8L A;  2PJ5 A;  2OB0 A;  3P2H A;  3S6H A;  2PIY A;  4ETK A;  5E96 A;  5F48 A;  2PJ0 A;  3D7F A;  4ZYQ A;  3VH9 A;  3R9G A;  3EC4 A;  3BLN A;  3NH8 A;  8CPA A;  2HC9 A;  3DGV A;  2Z3L A;  1YD9 A;  1Z8T A;  4UML A;  4TU0 A;  2FSR A;  2RFH A;  4P4F A;  3N7Z A;  2VEZ A;  3KHZ A;  4XNH C;  1TXZ A;  1EE3 P;  3D4U A;  3IFE A;  1SQH A;  1Z4R A;  4NGR A;  5DS0 A;  3SXN A;  4CAF A;  5D8N A;  1S7L A;  1Y7E A;  4CRY B;  1PCA A;  4MFZ A;  3B2Y A;  3GYA A;  3DDD A;  5C82 A;  2PR8 A;  4M3S A;  2ZW5 A;  2NYQ A;  3HLP A;  2JZF A;  4B5P A;  2Q43 A;  2VZY A;  3S9L A;  1VKC A;  2Z3N A;  3HUV A;  2BCO A;  4UWJ A;  4ABL A;  2PJA A;  3FB3 A;  4IQY A;  4FUU A;  2D4O A;  1IU8 A;  4F6A A;  1RO5 A;  4JGK A;  3JZT A;  5EMI A;  4KVM E;  3TX8 A;  2O53 A;  3ISX A;  4NEX A;  3VAR A;  5F09 A;  4OLL A;  4JLY A;  3EJF A;  1S5K A;  5FSY A;  4C7H A;  3TT2 A;  2J8R A;  3RO0 A;  3W6X A;  2C27 A;  1M4D A;  2VBQ A;  4HNW B;  5F46 A;  3TO6 A;  1Z8W A;  3EWO A;  2PVW A;  2DF5 A;  3D8P A;  4M6H A;  1HEE A;  3D67 A;  4GVV A;  4KOW A;  2GE3 A;  1CBX A;  2C1C A;  4TWE A;  1M4I A;  2EWB A;  1Y7R A;  2FIW A;  4YWY A;  2FIA A;  3DSB A;  4E0A A;  4ZX9 A;  2EBJ A;  2ZEM A;  3GPO A;  5DUS A;  2ZEH A;  4KZT A;  2F5I A;  5J1Q A;  4Q36 A;  5H86 A;  5K8O A;  3SJG A;  5K8M A;  4JZ0 A;  2PJ2 A;  2Q4Z A;  3UY5 A;  3TOB A;  1XIX A;  2QIR A;  3IEH A;  2C6G A;  4KSF A;  4NGT A;  4RN7 A;  2CIJ A;  2OZU A;  2PCU A;  3KKW A;  2QJ8 A;  4CAX A;  1Z9U A;  4MHP A;  4P4B A;  3W6S A;  2PDO A;  2XEJ A;  3LD2 A;  2HUZ A;  2ZOF A;  3MGD A;  4L8A A;  1CP7 A;  4P45 A;  4A95 A;  4BIN A;  4PXC A;  3EY5 A;  1IYL A;  3KI9 A;  3PB4 X;  5DWN A;  2FG1 A;  4KYB A;  3EFA A;  2FT0 A;  2IMO A;  3L2N A;  5LRG A;  4CGP A;  4CYP A;  4K3N A;  4OIW A;  5IB9 A;  4B13 A; 
#chains in the Genus database with same CATH homology
 4A38 A;  4R76 A;  4P4I A;  3GQE A;  4J5R A;  3EWQ A;  4IK2 A;  1QQ9 A;  4CPA A;  4KSI A;  3NA6 A;  2PRQ A;  2BO9 A;  2ZEE A;  1R3N A;  4X8I A;  1CX8 A;  4PPZ A;  2NSM A;  4OC5 A;  3MRU A;  5CPA A;  3K9T A;  4MRI A;  3B3S A;  1VGY A;  2WZN A;  4J5Q A;  3EW5 A;  2HB6 A;  4MXU A;  4FBE A;  1LCP A;  3LWU A;  1VHO A;  3CT9 A;  3KZW A;  3QNV A;  2F7V A;  5LYF A;  3RZA A;  2PJ3 A;  4MHN A;  1LAM A;  5JGF A;  2C6C A;  4DUK A;  3FX6 A;  2AFM A;  5CB5 A;  4JLL A;  1BLL E;  2JBJ A;  2CTB A;  3WC6 A;  3GQO A;  1Z2L A;  2AFO A;  5CBM A;  1CPS A;  4MMO A;  2FVG A;  3K2K A;  4B6Z A;  4UEZ A;  3BHX A;  2ZEG A;  3SIH A;  2ZOG A;  1GYT A;  5E3B A;  1RTQ A;  1F2O A;  4MHZ A;  2PJB A;  3FVL A;  4X3R A;  3GPQ A;  3KGQ A;  4A39 A;  1VIX A;  4GUA A;  3WT4 A;  5JH9 A;  4IAV A;  3DLJ A;  2AFZ A;  4ABK A;  2G9D A;  4UIA A;  2QYV A;  4PQA A;  3KR4 A;  3PFE A;  4MCS A;  3PB8 X;  1AYE A;  3WC7 A;  4UEF A;  2XD7 A;  3SJX A;  3PEI A;  3NFZ A;  2PJ4 A;  4H2K A;  1SPV A;  2FAV A;  1ARL A;  2DEA A;  2V8G A;  3S9N A;  4OC1 A;  5LRJ A;  1OBR A;  3PB9 X;  3IWW A;  1NSA A;  3JRU A;  1YLO A;  2BFQ A;  3I1U A;  3PBE A;  5LYI A;  1Z5R A;  2GLJ A;  3FEE A;  3ISZ A;  3SII A;  2XEF A;  3D68 A;  4K0C A;  4W9Y A;  4BD9 A;  2ZEP A;  2PJ1 A;  1LFW A;  1TKJ A;  4MCR A;  2DX6 A;  3FMC A;  5ELY A;  3D66 A;  2X47 A;  3KAS A;  3PRT A;  5I4M A;  4OP4 A;  3Q6Z A;  4P6Y A;  4NJQ A;  3SJF A;  1TY8 A;  4R6T A;  4OC2 A;  4WJB A;  2XEI A;  3FF3 A;  3MN8 A;  5AIL A;  1LOK A;  1ZR3 A;  1CG2 A;  2POK A;  5THW A;  3SIG A;  3GLJ A;  4GM5 A;  4O23 A;  3RBU A;  1ZG9 A;  2ABZ A;  4IHM A;  4P10 A;  2EK9 A;  4R8F A;  1FNO A;  3B3W A;  4NGM A;  2PE3 A;  4UF4 A;  2BOA A;  2I3C A;  1ELM P;  1Q7L A;  4P44 A;  1FT7 A;  1PYT B;  5FSU A;  3FJU A;  4NJR A;  5LYL A;  4F8Z A;  1YW4 A;  4JCA A;  4DYO A;  2OOT A;  4JYW A;  1LAP A;  2ACF A;  1YME A;  4UIB A;  2VL1 A;  3WAB A;  4P4D A;  2BFR A;  5HXD A;  5CMS A;  1Y0R A;  3S9M A;  4JVV A;  2ZEO A;  3B3C A;  3IIB A;  3CDX A;  2F8H A;  2PIZ A;  2FXK A;  5HOL A;  3SI0 A;  4LQG A;  2XEG A;  3CPA A;  5FSZ A;  5HVF A;  3D7D A;  5LRK A;  4G1P A;  3WC5 A;  4UEE A;  1ZG8 A;  2Q51 A;  3Q71 A;  2JBK A;  3RAM A;  1VHU A;  2ZEL A;  3KL9 A;  4Z65 A;  1R43 A;  2IJZ A;  1TKH A;  4NGQ A;  3EKE A;  5HVH A;  5JM6 A;  4MCP A;  3IID A;  1XFO A;  3EJG A;  3SIJ A;  1YSJ A;  7CPA A;  1ZLI A;  2EEE A;  4FWU A;  3V2B A;  4EME A;  1AMP A;  4ESS A;  4ZY0 A;  1Y0Y A;  1TXR A;  2PVV A;  3BI1 A;  3KQX A;  1ELL P;  4NGS A;  1KWM A;  4DJL A;  1UWY A;  3ETI A;  3GPG A;  1QMU A;  1BPM A;  4OKO A;  2V8H A;  1ZG7 A;  3EWP A;  4MCQ A;  2PJ6 A;  4ETJ A;  4R7M A;  4ZX8 A;  4F9V A;  3FH4 A;  4F9U A;  1TF8 A;  2J9A A;  2V8V A;  2ZEF A;  1ZLH A;  4ZI6 A;  2AFX A;  4EWT A;  4TNU A;  2AFU A;  2ZEN A;  2L8R A;  4PXE A;  1H8L A;  5FSV A;  2GLF A;  1CP6 A;  3NH4 A;  5D29 A;  1TF9 A;  4NGN A;  3D7G A;  4P4E A;  4ZY2 A;  3D7H A;  1VHE A;  4NGP A;  1BPN A;  5HVG A;  3GUX A;  2CF4 A;  4PXB A;  2RB7 A;  1XMB A;  4Q7A A;  2AFS A;  3KHX A;  3IIF A;  3KR5 A;  4J4Z A;  2AFW A;  1XJO A;  3IJ3 A;  4OC4 A;  3V45 A;  3CPX A;  4RUH A;  4J5S A;  2V8D A;  2ZED A;  4MHY A;  2AFC A;  2V77 A;  4NFR A;  3H8G A;  2CTC A;  5K8N A;  1HDU A;  2VRI A;  3V7Z A;  2QVP A;  1DTD A;  1M4L A;  4X2T A;  2IQ6 A;  3IC1 A;  3FED A;  1HDQ A;  3VAT A;  1XBU A;  2EK8 A;  3BXM A;  4OID A;  4P4J A;  3TC8 A;  2LGR A;  4FAI A;  3B7I A;  3V38 A;  4D86 A;  4ONW A;  5LYD A;  4PXD A;  1F2P A;  3PBB A;  6CPA A;  2GRE A;  3T8W A;  3IO1 A;  1ARM A;  1ZR5 A;  4GVW A;  1HJZ A;  3EWR A;  3B3T A;  4A94 A;  4WWV A;  3H8E A;  4YU9 A;  2WYR A;  3PB6 X;  4ZY1 A;  1YW6 A;  3SI2 A;  3BI0 A;  5FSX A;  2GU2 A;  2PJ7 A;  3SI1 A;  1DE4 C;  3KQZ A;  2PJC A;  3FEC A;  2ANP A;  2JEW A;  3LMS A;  4OC0 A;  1NJR A;  5HIH A;  5CB3 A;  1XRY A;  4OC3 A;  1JQG A;  1IGB A;  3PFO A;  1IY7 A;  3NH5 A;  3VFQ A;  1F57 A;  3PB7 X;  4OME A;  3GB0 A;  1CPX A;  1LAN A;  2PJ8 A;  2PJ9 A;  1TKF A;  2OR4 A;  4EFD A;  2C6P A;  2O4H A;  4A37 A;  3H8F A;  3SJE A;  4AXV A;  3B35 A;  1BAV A;  5K8P A;  3N5F A;  3B3V A;  1Z8L A;  2PJ5 A;  2PIY A;  4ETK A;  2PJ0 A;  3D7F A;  4ZYQ A;  3VH9 A;  3NH8 A;  8CPA A;  2HC9 A;  3DGV A;  1YD9 A;  4UML A;  4TU0 A;  2RFH A;  4P4F A;  3KHZ A;  1TXZ A;  1EE3 P;  3D4U A;  3IFE A;  4NGR A;  5DS0 A;  5D8N A;  1Y7E A;  1PCA A;  3B2Y A;  2NYQ A;  3HLP A;  2Q43 A;  3S9L A;  3HUV A;  2BCO A;  4ABL A;  2PJA A;  4IQY A;  4FUU A;  4JGK A;  3JZT A;  3TX8 A;  2O53 A;  3ISX A;  3VAR A;  5F09 A;  3EJF A;  5FSY A;  3EWO A;  2PVW A;  1HEE A;  3D67 A;  4GVV A;  1CBX A;  2C1C A;  4TWE A;  2EWB A;  4YWY A;  4ZX9 A;  2ZEM A;  5J1Q A;  3GPO A;  5DUS A;  2ZEH A;  5K8O A;  3SJG A;  5K8M A;  4JZ0 A;  2PJ2 A;  2Q4Z A;  3IEH A;  2C6G A;  4NGT A;  2CIJ A;  2PCU A;  2QJ8 A;  4P4B A;  4MHP A;  2XEJ A;  2ZOF A;  1CP7 A;  4P45 A;  4PXC A;  3KI9 A;  3PB4 X;  2FG1 A;  4KYB A;  2IMO A;  3L2N A;  5LRG A;  4K3N A;  4OIW A;  5IB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...