4ZYSA

Crystal structure of an exotoxin 6 (sav0422) from staphylococcus aureus subsp. aureus mu50 at 2.25 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
195
Chain Sequence
TEVKQQSESELKHYYNKPVLERKNVTGYKYTEKGKDYIDVIVDNQYSQISLVGSDKDKFKDGDNSNIDVFILREGDSRQATNYSIGGVTKTNSQPFIDYIHTPILEIKKGKEEPQSSLYQIYKEDISLKELDYRLRERAIKQHGLYSNGLKQGQITITMKDGKSHTIDLSQKLEKERMGDSIDGRQIQKILVEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an exotoxin 6 (SAV0422) from Staphylococcus aureus subsp. aureus Mu50 at 2.25 A resolution
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Sugar binding protein
molecule keywords exotoxin 6
total genus 63
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zysA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zysA01
1EFID 1AW7A 5D3DA 1V1PA 1V1PB 1TS4A 2Z8LA 1I4GA 1RF2D 4RHSA 5ELDA 1FNWA 4L63B 1PRTF 1MD2D 1D5MC 4DXFA 2IJ0A 1CT1D 5I4DA 1BCPF 1HQRD 1PTOC 1CHPD 4RGNA 4RGMA 2NTTA 1SE3A 1I4QA 1BCPC 2G9HD 2J4XA 1QILA 1BXTA 1SEBD 3DWQA 1ET9A 1HXYD 1S5BD 1EEFD 5ELFA 1FNUA 4TSSA 1LTGD 1LT5D 1PZJD 4RGTA 5ELCA 3MFGA 1LTSD 5FK9C 1LTID 1SXTA 1KLGD 1LT3D 1SJHD 4DXGA 3EFXD 2QILA 3TSSA 1PRTB 1JWUD 3R2TA 3O13A 2XRSD 1SBBB 1TY0A 1LTAD 3BYYB 1CHQD 4UDUC 2NTSA 1LTBD 3DWAA 4C56C 1S5ED 1ET6A 1JCKB 1B44D 1JWMD 4K6LA 4NZLB 1D5ZC 1YN4A 2O2LD 1EU4A 1RD9D 3SEBA 1FGBD 1KTKA 1F77A 1I4XA 1UUPA 1PTOD 1HA5A 1UNSA 1YN5A 1I4HA 2AQ3B 1HTLD 4RCOA 1DYQA 2IPKD 1SE4A 1I4RA 1EU3A 1L0YB 1T5XD 1PTOF 2AQ1B 1S5FD 1PRTC 4O1NA 3CHBD 1TS2A 3BYTB 1GOZA 3BVGA 4RHRA 1JWSD 2AQ2B 3R8BA 1EEID 3W2DA 1PTOH 4RFBA 1M4VA 3EA6A 1B1ZA 4RGOS 1PZID 1EWCA 5ELEA 1L0XB 1SJED 1S5DD 1LT6D 2R61A 1JQYD 2CHBD 1XTCD 5D3IB 1PZKD 2SEBD 2XNAC 1LLRD 2QEJC 2XN9C 3DWPA 1FNVA 1SE2A 1LTTD 2ICIA 1BCPD 1JR0D 1CQVA 3URYA 4ZYSA 2RDHA 3V05A 1S5CD 1PTOB 2TSSA 1AN8A 1TS3A 3GP7A 1KLUD 1G8ZD 1LT4D 1RDPD 1DJRD 1LTRD 3KLSX 1PYWD 4BWGB 1ESFA 4L6TB 1ENFA 1FD7D 1TS5A 1D5XC 1PRTD 4RH6A 2RDGA 3MC0B 1YN3A 3OWEB 3R2IA 1STEA 1LO5D 1D6EC 1RCVD 5FKAC 3BVMA 4Z9CB 4OHJA 2WV6D 1CK1A 3BZDB 1TY2A 2XRQD 1V1OA 3BVZA 5TSSA 1BCPB 5ELBA 1XXGA 1I4PA
chains in the Genus database with same CATH superfamily
4BXXH 1EQRA 1YITA 4HJKA 3VFKA 5JHBA 5KEEA 2EELA 4DAMA 1FNWA 3ULLA 4BBRG 1L1OC 3CCRA 5FLXc 1V80A 4USAA 2KCCA 2PW7A 3A8IE 4TRDA 3H7SA 4Y52H 1UE7A 3K5MA 4ALPA 2G9HD 1QILA 2MO1A 2GVAA 3HRDD 1U4RA 2KHIA 4ZKBB 4J3OD 4E71A 4OO1G 2JSOA 2MUYA 2KEEA 4CKBA 2KANA 4N58A 1DD2A 2DYBA 1R4QB 3UIPB 3AMUA 5A35A 5FK9C 2CWPA 1VQ7A 4KJNA 4ZQ3A 1UZXB 1U4MA 1AZPA 1LT3D 5JJLA 2KFKA 2N1VA 3FEWX 3A9JB 3CIRB 2O5IC 3N1ZC 3AE2B 1FIQA 1V8CA 3A1QA 4WJ3M 3H8HA 2E3TA 5CBAE 3QC8B 1JALA 1ACCA 2O2VA 1H9MA 3SHQA 1AZQA 2UXBL 3S1RH 1CHQD 2BW2A 1WRIA 2MCNB 4TKOB 2XEWA 4MDKE 2O4XA 5M3FB 3ETRA 2N3SA 1SIFA 2X38A 3HM3A 4GU2A 4IG7B 2NVQB 5C4XH 4G7HC 1MG8A 4TQ1A 2NB0A 1QVGA 4W9JA 2QC8A 4K7UA 1F77A 1I4XA 2A4ZA 1YQ4B 2HCIA 4CDDC 2KX0A 1WE6A 3HP3A 4OZAA 1C79A 2DGYA 4HMIA 5EKIA 2R7DA 2CU1A 5J18A 3DUZA 4RWSC 3DHIC 1WD0A 4KX6B 3CU7A 2XWJB 1WTWA 2DZKA 1P0RA 3NWTA 3CHBD 1BUIC 5C4XG 1OFFA 2L0FA 5IGBA 4A3KG 2B8FA 3TBLD 4FDBA 3KWVA 4A20A 4IUMB 1X56A 3W2DA 1PQSA 1FO4A 3FPUB 3N30A 3JSVA 1D3ZA 4FJVB 2JEBI 4B0MA 4MSQB 4DR7Q 3NQTA 4N9TA 3ZKJC 3G48A 3LWUA 2ZM6Q 3B1LX 4DAYA 1EOTA 2CHBD 1ASZA 2EE1A 1IW7D 3J9CA 4MM3B 3TEWA 2SEBD 2XNAC 4L5TA 4DNTB 1E7PB 4AYBG 3PT2B 4LCDE 5K5PA 1LTTD 1KD1C 1X55A 1SE9A 2F0DA 2R92H 5E3FA 3ALBA 2HIXA 3FILB 5L95C 3E9IA 2J7QB 3HOZB 1L5PA 4P7IA 1UEAB 4ZRIA 5E7NA 1A3TA 4C3JB 4DF7A 3Q24A 2JX5A 5CV5A 1EY0A 2VY3A 3B6YA 3P42A 5IYBG 1EY9A 1TWFB 3PQIA 5CBEE 2ZCCA 4CYEA 3GTQB 1U5KA 5M3FG 4UY8C 1NTGA 2VH2A 3NVZA 5T8IA 1RTOA 4OVUA 1YHQA 1MSHA 1DM0B 4A3OA 1BBUA 1VZ8A 3W1YA 4DNIA 1XQQA 4LJZC 3R3MA 4BKSA 2PEAA 1I6VC 1BCPB 3AYHB 5ELBA 1KDBA 2B63G 1D2BA 1Q8KA 1WTQA 2C7NB 1AW7A 2EIFA 4FNFA 5D3DA 2RVLA 4WH4A 3K5NA 4W9KA 2AEHA 1RF2D 4IURA 1VQHA 4L63B 2L3ZA 2AKWB 3OJ4B 1T0QC 4MGKE 4GMVA 4DHJB 1HQRD 2A6ED 1KAAA 4DV4Q 1TKYA 2QHOA 4A3GH 5LHY1 4OX9L 3AEBB 2PW5A 4OELB 3CCEA 3L10B 1K0RA 4GNXA 4WJNA 4KKSA 1Y69U 1CFMA 1QNUA 3CD6A 1LT5D 2HE7A 4YTPB 4AS1A 4AQYQ 4X3SA 1Y1VB 4HEDA 2IY5B 3GTGH 1HTQA 1V9PA 2LRUA 4A3KB 3TBIB 1Q0WB 1S1QB 4DUYL 2LHEA 1SMXA 2CKHB 3SFDB 3GTOH 2SDFA 1SYDA 3Q6BA 4BVUC 1H4RA 2R7FA 2GRIA 3RCZA 1TVXA 3AE5B 2L5TA 2INDC 4IFDH 3CSFA 1G291 4FXGC 2QJLA 4EFOA 5CYUA 1V5OA 2Q8TA 5C0XG 2N49A 1FCCC 1U4AA 1YJ9A 2MGSA 2UYZB 3J81E 4KTAA 3RNUA 2ZJQA 2JY6A 3GO5A 3SR1A 1EQVA 3V6EB 4EE2A 3I4LA 3K59A 3D0FA 2BYEA 1QOAA 1NDDA 1ISNA 4LNFA 4R4QA 1K83H 1OEYJ 1PH2A 1PFNA 3DHQA 4Q5VA 3RNEC 1XPRA 5M5WB 2F4VQ 4JQWC 1L2NA 4ILWA 1NYQA 1G51A 2PTLA 5C5MA 3H0GG 4GGQA 1O7LA 3HOWH 2K28A 1HNZL 1RWSA 2EJFC 2OQKA 2D0OA 5IGDA 1IW7C 2PIAA 2O6VA 3V3XA 5DEHA 3VHTC 3G7LA 4BA1I 3G71A 1KQSA 1M1KC 2K5HA 2NUCA 4QB4A 2HQEA 4JI8Q 4TKNA 5C1ZA 1UE6A 3AQQA 1WJJA 3TQYA 3B2GA 3H09A 3DWMA 1V1QA 2J42A 4IJHA 4P6VF 3KF6A 4KMUC 1XWEA 1UE5A 2LVOA 2JA6G 3T4AC 3RI7C 2R6GA 3P7JA 2PQAB 2XSCA 4A3FH 2RPVA 3TRZA 2BPSA 3V05A 3VR4A 3CCSA 4X65L 2CR5A 3KYDD 1L0WA 4MELA 3CAMA 4M1UB 1N60A 2LI5A 2KAJA 1LTRD 1VF7A 2N0SB 4MSMB 1UF0A 4EX5A 4BAXA 1WJNA 2WB1E 1TXYA 2AYOB 2FCSA 4PS7A 3UI2A 3E5SA 2RDGA 3VTWA 1EQTA 3J7AF 1VMPA 4IPHA 3K7UC 4H7BA 2XTIA 3N32A 1R4PB 2D11A 1VR9A 3CQZB 3I4OA 2DX5B 3VXWA 3G4SA 1F52A 4LNIA 1V1OA 3Q2AC 3Q3JA 4A3MB 3AE9B 4YSYB 5M3MG 2PMZB 2ZXOA 4CJ1B 4DV1Q 4HJGE 2B39A 2VB3X 4RHSA 2UXBQ 4MTKA 4G7OC 4YTNB 5BR8L 4JYAL 3EC8A 1N32L 3RD2A 1IKLA 1PTOC 3K7AH 2CWAA 2PJHA 1AARA 2V4LA 4AJWA 3W3AA 2NZ1D 3DWQA 1G2TA 4GZYC 1EIYB 1W2BA 1HHVA 1JJCB 2CQOA 4NXML 4GLAC 1E6EB 5AUKA 2JUOA 1XF5L 4JPSA 4G7ZC 5DNFA 4QL5A 1P7FA 2HT1A 4DV3L 3BY4B 2JYOA 2DBYA 3DM1A 4CDFC 3S16H 2MP2A 2LD9A 2PZTA 5HY6A 2E5LQ 2F0MA 4PNYA 3FVQA 2OJRA 3KFUA 2NN6G 1TKGA 2QEXA 1XMQQ 1L6UA 3AEAB 2DYOA 2B29A 1K8MA 4C3HG 3DEPA 4ACFA 1E7VA 3BS1A 1B50A 1VQAA 2FHTA 4C7YA 1KRTA 2KOXA 1D5ZC 2RBMA 3ICEA 1L7YA 2F0WA 3QOLA 2O2LD 1XNRQ 5AJ3L 4DU9A 1JT8A 1XNQQ 3AE3B 5GADC 1KRHA 1ZP0B 4JI3Q 2WXNA 1HA5A 1UNSA 4V190 2H5XA 3W5OA 4DK3C 4B3RQ 4GLSC 1OO9B 3DQVA 3F2CA 2WFWA 4C3HH 1TT5B 2MBHA 1B70B 3NVWA 3CCVA 3QCAA 4N8X1 2N88A 4A8XC 3KBXA 2K50A 4IM2A 1MGSA 2KK8A 3FILA 1Q46A 3ZLZA 4A3CH 3F2UA 2UXDQ 5KIXA 1DOLA 2NN6I 1PUTA 5A2QL 3M7NA 2B2VA 2L83A 3HKSA 4KKIA 4LWCA 3H3VC 5LXHA 4EKUA 3CF6E 3I4MG 1WRDB 1EWCA 5FJ8G 3RLFA 3H9DA 3H15A 1F2YA 1SE8A 4GOCA 2KDFB 5HHDG 4ANVA 1LABA 2V0GA 2EY2A 4R4CA 1NNXA 3LB8C 2Y5PA 4A3CG 1OXTA 1FNVA 3I4NB 3E9HA 2B63H 1X3PA 2KENA 2KVRA 2L11A 5K36H 3LDZE 2L32A 1Y1VH 5D6JB 4ANUA 1YX5B 2FINB 3L17A 3BU2A 2KWVB 3MHSD 5E4XA 2QA4A 3NTKA 2OTLA 4IDIA 3KYHC 5BO4B 4HIDA 1PYWD 4DWFA 4JX1C 2C7HA 4MN3A 4XDXA 1GM5A 4OONA 2DNCA 2MJ8A 1ENFA 1TS5A 2K04A 2OTJA 1TBEA 2Z59B 2ZNVC 2WXOA 1I35A 3OWEB 4P16A 1CZGA 1NCVA 1UE1A 4DUZL 2M1MA 1F0ZA 4GOPC 2BT6A 4QUFA 1HZ9A 1RODA 2BH2A 4A3MH 2OWOA 4DV6Q 3PO0A 1NAPA 1YJNA 4BBNF 4KSKC 3V62A 1NR2A 1I4PA 1PH7A 3CCQA 4GN3B 1VQPA 1ASYA 1EM7A 4FF4A 2C35B 3UE1A 2UWQA 4XGAB 5BMHA 1SROA 3HRZC 2ZJDA 4WJ4A 2RHQB 4RMAA 2LEKA 1F2RC 4RGMA 3AEFB 1WX7A 4LJPB 3OMGA 2UU9L 3RZFA 2EKIA 1QVCA 2CJNA 1KH0A 1K28A 1EYGA 3WAPA 4YSXB 5J2RA 2K9XA 2A6HC 5C4ZA 4FJZA 4MGIE 4C4VB 1VQ9A 1HQMC 2WKDA 3SHLA 1XLPA 1KDAA 3BDOA 1QOBA 3S1MH 3PO2B 5IOCA 1PH3A 1I94L 4TUUA 2LJIA 5IYDH 3L7ZC 5ELCA 4R8IA 3T3NA 2KVMA 4KN7C 1DOKA 4K8JA 3PZ7A 1K3BC 4BKTA 3HOXH 3QB3A 2FFKB 4G50A 5MPOA 4BBRH 5LL6S 3P75A 4OO1I 1H9KA 3TSSA 3J7YW 1A63A 5GMVA 1WD1A 1X3FA 2LMCA 1ZKOA 1RTNA 3IFDA 4EQPA 2DLBA 2BE5D 1PHJA 3H0GH 2WDQB 3M62B 4KV6A 3T8MA 4ASWC 4UDUC 2KD0A 2KTFA 1HR0L 4HIOA 2BWFA 3WANA 4C56C 3RN2A 3PSIA 2NVYB 1ET6A 1SNQA 1MJCA 1JCKB 2NR2A 3WCQA 4RA8A 1G6PA 1BNZA 3J80c 3C8YA 4LF6Q 4KGRA 1QZEA 1WYGA 4KI0A 4NAWB 5C3XA 1SR3A 1O80A 1IL8A 2JE6I 4MJSB 4DV0L 1F9QA 2LHDA 2FBWB 1QJOA 2KDMA 1CKMA 4WAAA 3VA7A 5KGUA 1YVCA 1WXVA 2YTXA 1E22A 3SK5A 2IHFA 4X64Q 5LMNW 1OEYA 3AI5A 1OQQA 1RL2A 3CP0A 1S3SG 3LNNA 5CHVC 1RFKA 1C9FA 4X66Q 4WWOA 3UQBA 1EF5A 1VQJA 2R2OA 2FUG1 5IYCG 2BQQA 3L54A 1H8CA 4YCVA 3PF5A 3APCA 4FYDA 1N61A 3R7QA 2O5JC 2Z1CA 1BDOA 3C3LA 3S1QB 1IYFA 1FR3A 5JEAJ 1UBQA 1PTOH 5E1FA 1VQ6A 1K73C 4LF7Q 2HUGA 1JQ4A 4KD3A 3J7AV 1M94A 3NQIA 1YI2A 3APFA 3EFUA 2IX0A 3ZNHB 1A70A 3I63C 1STGA 4DR3L 1GUOA 4P73A 1OTCA 4M0WB 4XC2A 1STBA 4OVVA 2PO4A 5H8YE 3I7FA 3Q8BA 3E0EA 5HURA 1I3QB 3CMAA 2KC1A 4A3EG 1XMOQ 3I3TB 4JYAQ 4H0LC 2ZJRA 1NY4A 2JQOA 1D4BA 3KLSX 4LF8L 4MZ9A 2MHVA 3D4WA 2GMIC 3OW2A 3OWFA 4LFAQ 3PGEA 5I2XA 3SE0A 1VJKA 4KGSA 4TVAB 2EOTA 2IGGA 3DBRI 2WACA 3A54A 3AU7A 2E2HB 3Q8CA 4QQBX 4DV3Q 2ZW1A 2GN5A 1WXSA 3N1XC 1TKWB 1SMYC 2RCFA 4Z9CB 3IRBA 1DXMA 2AMCB 2RKSA 2XWBB 3CPFA 1UWMA 2BYFA 2NWGA 2IDYA 1L0VB 2LWPA 4HXDA 3BVZA 2AUKA 1S40A 3ABVB 4FXKC 2IX3A 1WIAA 2EYOA 2NPTA 2Q5WD 2QW7A 5IYBH 3QHTA 1Z2MA 2QDFA 3A4RA 4A3PA 4OVZA 1V5TA 4YL8A 1K8GA 2I0QA 3I4MB 2LMCB 4E74A 3GTQH 1HTOA 2M0AA 4MT5A 2PI2A 1AE3A 1SNPA 1HR0W 1S3OA 2X6GA 1GNUA 1V2YA 1Q1OA 3VUXA 3A9KA 3O65B 2DY7A 5EPLA 4K6DA 2XIWA 3FKIH 2N8NA 5D65A 1KJTA 3NVYA 5EBDA 1YHAA 1XLOA 2M8SA 2V3NA 1FYCA 1PFBA 2CFMA 2TMPA 3IG3A 1MSGA 2FXQA 1WTVA 1KLGD 1C3TA 4DXGA 1IBXB 2A19A 2LASA 3ZW3A 4MTNA 4HMJA 2IY1B 2NZHA 4G57A 2ICEC 4HCSA 5C6AA 3DMUA 3JYUA 1L4ZB 4XYQA 2WX1A 5EE1A 4IUUA 4L5RC 2UXDL 1YJ1A 5C23A 3S2HH 2F0SA 2RD0A 1GD7A 4KV2A 4ODGA 1EWYC 3VTUA 1C8CA 2N7JA 3ZNGC 2FIFA 2PW9A 4HN7A 2ZVNA 4LF9L 2C7MB 4QJFA 3MVVA 4ZKCB 1NUCA 5T1GA 3UE0A 3STBD 2JVCA 4ICUA 2YTYA 1M8AA 4HJ7A 1SYFA 2ACZB 4M8NA 1N33L 2AL3A 1C77A 2IO1B 4KLKA 1N34L 4OGQC 3HVDA 3C1EA 1WYWB 1QQRA 2DZJA 2MO0A 1KRSA 1TKEA 1CUKA 4HSVA 3DOWA 2NVQH 4MH8A 4BKGA 5LNK1 1VS0A 2E8GA 3ERQA 3K81C 4BY7B 1R4NI 1D7QA 1E8ZA 2J0MA 2K5DA 4JOIC 4C80A 1EUJA 3A0JA 3V61A 2MQJA 1C48A 1NEKB 5AFWA 4NJ7A 1CA5A 4PMCA 1WH3A 1JOQA 2K32A 3HKZB 2BTEA 4HKQA 2MRPA 4A3MG 4ZUJA 2VL6A 4QMGA 2EYMA 3UDIA 2B2UA 4IN3A 4QIWE 2WP9B 2CH4W 1BCPD 5EBCA 2Q2TA 2WDVB 3RNCC 1QZHA 2KX3A 1OTRB 1UAPA 4ZYSA 1RKNA 5I6WA 4FXDA 3NK9A 4R9WA 3NG0A 4L5QA 4RNAA 3IFTA 2LUMA 1IUEA 1Y8NB 3MXGA 5EPJA 4LF4Q 3CC2A 2BGFA 3NVVA 3VR8B 3I73A 3ZXVA 1BF4A 4BWGB 1FD6A 1SMYD 3CC7A 3TMEA 2GBJA 4GS3A 2F0JA 2I38A 3BZCA 4ZRKA 3EN2A 4IFDI 2E6XA 2WGSA 1PLFA 3RD4A 3VQIA 5FKAC 1WJUA 1K53A 1Q7YC 1Q10A 3NZ3A 3M85A 3J80E 2INPE 2WV6D 3FC4A 1CK1A 3BZDB 3M7GA 5TSSA 4PYUA 2D3GA 4DV7Q 4N9PA 5C3WA 4TQUS 1H9SB 1R9TB 2GI9A 4IM3A 3ZGZA 2IJ0A 5C4HA 3RLNA 1HR0Q 1ZXTA 4NP5A 4YCUA 3WOEA 4Y7NB 4P1CC 4KY7A 4EVOA 3WIMA 5E6PA 5C3JB 3QJZA 1SEBD 2KZRA 3NSWA 1B8AA 1K51A 3AEGB 2N55A 3I8ZA 4JC0A 4UAIA 1J7CA 5ELFA 2I5HA 1P7EA 4BY7G 3GTOB 4R8NA 4JV5L 2ON8A 4RGTA 2VUMB 3S16B 5IT9L 1WYDA 1J8IA 3MHBA 5DPTA 1LTID 2B2WA 4HJAA 4X64L 2B2YA 3GV3A 2BB5A 5IN7A 4YWMA 1WE7A 2OOBB 4FF1A 3I2ZA 3PV1A 5JH5C 4XE0A 3MXNA 5DLQE 4WAFA 5IYCH 5FOBB 1GJZA 2IY0B 2I46A 3OHXC 5M3MB 2JN4A 3ENEA 2LGDA 3HIZA 4W9DA 1LTLA 2K5QA 3KF8A 5CX3A 3R3OA 1JWMD 2UXCQ 2ZEQA 1SDFA 3U9OA 3ZJUA 1ZGUB 1C4QA 3VRAB 2N78A 1EY4A 3SEBA 2PPHA 2B8GA 4U68A 4DR3Q 1SN8A 1PTOD 2GA4B 1DZ1A 2MJ3A 4H2AA 2ENBA 1F9PA 4BKSD 1FVIA 3DWGC 1HE8A 4IOAA 1AFPA 1RYJA 2WXRA 3OG5A 3L16A 1SE4A 4PZ8A 1T0SC 1EU3A 2KN4A 4N8FA 3QIAA 3AE4B 2HTME 3DBSA 3RR5A 1IKMA 2VQFL 1I42A 2PNRC 3TS0A 1SIJA 2NVTH 3KJOA 2K5PA 2V4DA 2B3AA 4X62L 3S17B 1NENB 3HOUH 1MJDA 3MC9A 2KNBA 3FKIG 4B9KA 4DPGA 3MC8A 4A3IG 2WINB 4RGOS 2OQ0A 3HOZH 1V8QA 3FKYA 4A3DH 5GXGB 1EIHA 2ZJPA 2ZPNA 5EE3A 4KY6A 2K8BA 1LFDA 1JJGA 2F0VA 2LXAA 3T1HL 2B2WC 3T9LA 3OSOA 3KUDB 4NJ6A 1XO3A 4O42A 3T1YQ 4KDLB 1B53A 2E74C 2ZZPB 1GB4A 3TEZA 1TS3A 1KLUD 1A0IA 3K5OA 5FJ8H 3SGIA 1PH4A 1DJRD 4G3XB 4GB9A 3NS1A 1LXDA 3H91A 4ZRQA 5G3LF 4DR1L 2RF4A 2F0FA 4LNKA 3F1ZA 1E1TA 1D5XC 3S2DB 3R66C 4REZA 3RN5A 4A93G 1VZ7A 2MBQA 5M5WH 2KWCA 2YU9B 4EEWA 3M4YA 4R4IA 1D8LA 3UQAA 5EJWA 3Q3OC 4U673 1LQBA 1NR4A 2F3IA 3J81L 3U4VA 2H89B 2WU2B 4GDLA 1F9RA 1V1PB 1ICFB 1SNCA 2AWNA 1YJWA 3QAQA 1GB1A 1F9SA 2RA4A 3E3XA 1F2RI 4KZCA 4EOYA 1FMAD 4II3B 5CR3A 3PZDA 3FP9A 1BCPF 1CHPD 5IGCA 1RLFA 2AWTA 3L13A 2WB1B 3S1NH 3J81j 1YQ3B 4C3HB 2J4XA 3TDQA 1T0YA 5FO7B 4W9CA 5ELOA 2CH4A 2UUCQ 3MFGA 1TWHB 3H7PA 3IAYA 5KHQA 1U0LA 4A3BH 3E56A 3ZRFA 4DHZB 4G4KA 2GBNA 2K05A 3HS0C 5C44G 2MHJA 4ICVA 1W3SA 4X3UA 1G6JA 1JICA 2QILA 3HZXA 4JI0Q 1HNWL 1GG3A 1P98A 2PI2E 3JC66 2UUAQ 5EQ0A 2L05A 3RULA 1UD7A 1SFOB 1W6KA 4JBWA 3SK8A 1MKHA 1K9MC 1CTMA 1SBBB 3WAOA 2KLCA 1J8CA 2Z4HA 2K0PA 1D1IA 1I5FA 3VTVA 4AOFA 2K5VA 4IM0A 2E75C 1B9MA 4IJLA 1IZ6A 1D1KA 3SDZA 2HDMA 1WJ4A 1SNOA 1E0BA 3NBHA 1U4LA 2KACA 3M3JA 2MEKA 3W1SA 1IYUA 1ZYRC 3UF8A 3EIVA 1YX6B 1VZ6A 5FR3A 4DAPA 3IFWB 2JA6H 2GB1A 4HPLB 4BA2I 1IBKL 1G6ZA 4MGZE 4K8IA 4DR2L 1A2TA 1S5FD 2K52A 3VYTA 5ISRA 4GKJQ 2PCFB 3PUVA 2H4OA 3LXFA 5L83A 3CKIB 3N6RA 1TS2A 3NE5B 1I6HH 5EGTA 4MH0E 4B95A 1HZAA 3GTKH 1JWSD 4JBKA 3NS8A 4FP5D 1EEID 4BFRA 3VUWA 2LXJA 2DNFA 3WDNA 4IUPA 2R92B 4WRDA 1N63A 5ELEA 3U58A 1EWIA 4NKLA 1VQGA 1BT0A 2M9VA 3GTJB 1FRRA 4A4IA 1QF6A 5DAUA 3TS2A 4F1SA 3HM6X 1JJ2A 2K22A 4AH6A 4DV2Q 3OTOQ 5LMNL 4OIKA 2CU3A 1I7HA 3EJIA 3TREA 4YWGG 3CF5A 4WJOA 1SE2A 1WGHA 1GXDC 2L15A 3S1QH 5C44B 4JI7L 1LYLA 1HCZA 5T1IA 4HPPA 5BYRA 3G6JB 4P75A 3OOCA 2CVRA 3AMZA 4QCLA 3GTLB 5C2TB 1HNXQ 2J0KA 3TZUA 5JVH3 3GP7A 1VQFA 4JI1Q 3C46A 2GLSA 3M63B 4GDKB 4MGYE 2G45B 4GOPA 4JI2Q 1X3QA 3CC4A 1SRUA 5G5HA 1U9RA 2D07B 4JI5Q 1TT2A 3CMMB 3PHXB 4NW2A 4K1RB 5IODA 4AQYL 3S2DH 2NVXH 1P16A 3HOYG 4KHPQ 2RSNA 5E6NA 2VS1A 5G55A 4DQOC 3H6NA 3MJ5A 4APVA 4C1NK 1JW9D 5KNDA 2LRWA 1JOKA 1SYCA 2MFIA 3VDYA 4V0BA 1RRBA 1T6BX 1PH6A 3AE8B 2BYTA 2WXLA 3HOWB 5GAEC 3ZYYX 5J3BA 5BMIA 4O0AA 1I4GA 1CKNA 4DA2A 2ZTDA 2EXZA 5KRUA 4K7WA 4OXPA 2Q2IA 3NTIA 3A1QB 4GXBA 4UP8A 2W55A 3A9JA 1X3EA 2I5MX 4OL7A 3F2DA 4ZRZA 4PV1C 1IBLQ 2DENB 5I9PA 3E9SA 2KO3A 3UDXA 2JU6X 1L1OB 2F0QA 1PZJD 1ZEQX 2BE5C 5I2YA 2KQSA 1HFNA 5JAVA 4GOPB 4H13C 1LACA 4C3IH 2N9EB 4CKEA 3KVFB 3MTNB 2A8VA 5JZEB 1XPOA 3PF4A 1CKOA 3L0OA 3NXWA 1B9NA 2BA0A 1FM0D 1Y1WG 2EYJA 4NPSA 2AWOA 4KDIC 2K39A 2KEDA 2IHEA 1TQOA 1MI2A 1Y14B 2A68C 1F2MA 4A6QA 1VCIA 1C78A 4A3JB 2EYLA 2ZM6L 5NUCA 4DR5L 1WF9A 2JF5A 3ZDTA 4JPBW 2KHWB 1KABA 1SGHA 1V49A 1B44D 1XLNA 4A3IH 4K6LA 4AWJA 4HTHA 4CGYB 1QLBB 4FXCA 1YN4A 1VD2A 1YJIA 1I6HB 2GBRA 4L2YA 1NMFA 4K81A 1RHPA 4G11A 2W3SA 3PUWA 3KUZA 3AH7A 1I4RA 1L0YB 2PQEA 3AXCA 2AQ1B 4K5WA 2D62A 4X6AH 2BS3B 4CBVA 4X65Q 3J80L 1OQYA 4YHHQ 4IFDJ 2B2YC 4PS8A 1GOZA 2UUBL 1C7YA 2AX5A 3U4ZA 5HFYA 4JOIA 2IYDB 2V3SA 1TGZB 3SVMA 2HIVA 1OGWA 2YLMA 2E2IB 4WFN3 1R4MI 2M17A 2MPMA 1KFYB 2MJDA 2PYKA 2Z0EB 3HOXG 1MVKA 2F0HA 5BMGA 1N6ZA 1L0XB 1CKNB 2LKVA 1N5XA 3RZDB 4OWXB 4EQOA 4Y7NH 4B3SL 1JROA 3N3KB 2KWUB 2XN9C 2KJRA 4NXNQ 3TP8A 1PDQA 2B3GA 5DCNA 4C3IB 4HAEA 2JA8H 1JR0D 3PMFA 2NBFA 2BH8A 1GC6A 2IO2B 5AJ3Q 1LUZA 2RSOA 2KTRB 4GDLB 2BCOA 3PO3B 1S5CD 1P3QU 2VQEQ 4RAUC 4PQXA 3BK2A 4RMFA 3NOBA 1IP9A 1XPUA 4GKKL 3BK1A 1ILQA 1BKBA 1IXRA 3W1BA 3MJWA 2K3UA 1FD7D 1C9OA 2WIIB 3ZUNA 3UI3A 1GPXA 3ND8A 4RH6A 3OAWA 3DVGX 3SU8X 2CQAA 2RMMA 4HDOA 1D6EC 2JA8G 2FCQA 4LNNA 4URKA 2A1AA 1YNJC 2ZT9C 4K0KL 2MQHA 2YV5A 4LMQD 2M00A 4IFDG 4DHZE 1B3QA 4K7SA 4JI6Q 1DONA 1NSNS 1EUVB 2DAJA 2G9DA 4KKUA 2OHFA 4CHKA 3J81c 1BR9A 3ITPA 1XMQL 4KGTA 4IO9A 1K8RB 1YNTE 2KKCA 4RF0A 1MD2D 4FO2A 3OIPA 2WXJA 3TEXA 3APDA 4A75A 1ZE3D 4D2KA 1WCMB 2KQ7A 1BCPC 1HUMA 1U4PA 1Q5WB 2DUDA 5D2MB 1WZ3A 4E6IA 2EXDA 4TSSA 1XNQL 1LGRA 1TWGH 2EKEC 2L0TA 2L76A 4OWTB 2J7ZA 4OW0A 4XX5A 3PGZA 2EJGC 3UIOB 1X65A 2A68D 4MNOA 1MHXA 3U4EG 1HNZQ 4KSLC 4BS9A 4A3EH 3GTMH 4DR2Q 2V1CC 4B3TQ 2D3CA 1P8LA 2EY1A 2REXA 2L4NA 1A8VA 2C9WB 3I4NH 2F0LA 2PNHA 3OIQA 4A3LG 2K1FA 1PH8A 2LGXA 4XYOA 4LLGM 1WSPA 4NAWA 1WM2A 4NQLB 4DV6L 4NNJB 1S5ED 2ZVOA 4LJOB 2WLBA 4XIGS 2WAQB 3HOUB 2KJXA 5BN3A 2EYPA 4IUVA 3S14H 2QCZA 5A2QE 3IHPC 2L1AA 1MBYA 4KHVA 2FE8A 4DV2L 5IKCM 4K5XA 2L0CA 1YN5A 3T53B 4KKTA 5BYQA 4RCOA 1DYQA 2AHOB 3UDFA 1SNMA 3D4RA 1PH1A 1E9MA 2PE6B 3IXSA 4FA6A 3B2FA 1YNND 3OMCA 5LMUL 3ONAB 4EQNA 1NYRA 4LK1C 1HTPA 3VYRA 3OLMD 1I94Q 1PRTC 3VR3A 4XQQA 1XCTL 2LGSA 2EQSA 3DCGA 3NJTA 4JI1L 3ZIMA 4WWNA 4DNRB 1Q1EA 4DGZA 1RIPA 4P2CB 1A2UA 3M3YH 4JI2L 4ITKA 5FR6A 3BJUA 2JA8B 1XCQL 3KYCD 4EGVA 4IC7B 1MG4A 1IGDA 3DVNU 4HJ9A 2F52A 4JI5L 4DV5Q 1J5EQ 4DUZQ 1VF5C 4DR6Q 5J1ZA 2F0NA 3M9BA 2B2UC 4J6HA 3BWUD 2C9OA 3HOYH 5IP4D 1T0RC 4GN4B 2LXCA 1JQYD 1PFDA 4GIVA 3K0YA 2K5NA 4KD4A 3BIID 1PZKD 3A5ZB 3KUPA 3Q3NC 3SFEB 5H1SE 3TIXA 3RZDH 1BMLC 4CDCC 1CQVA 1Q3LA 4RG1A 1T3QA 3D8GA 3A8JE 2AL6A 1Y8OB 4AIMA 3ZJTA 4I7ZC 4NXMQ 2QSDA 4I6PA 2VUMH 3SDLC 1C4AA 3C19A 1FCLA 3JAML 2K5WA 4QGUA 2ALYB 1T5EA 2L00B 4CKCA 1E5WA 1YNJD 3EGRA 2B76B 5KHOA 1IBLL 4X57B 4KK7A 1QE6A 2Y5BB 1AWDA 4XDCA 4EZLA 4BOZB 3HFZB 1FXIA 1S72A 4YWLA 2BKFA 3KUCB 1RCVD 3I55A 2R7ZB 3N20C 1JMLA 1X3GA 4IUTA 2F0TA 3RMKC 1WI5A 2V1YA 3K7AB 3GD7A 3GB1A 1IBMQ 4OHJA 2VNUD 2ZW0A 3IBEA 2KVZA 2L9HA 2VXWA 4LF7L 4P74A 1F2LA 5JJZA 1SNDA 1XXGA 1PXUA 3S14B 2KHSA 1E8YA 3KDFA 4GSWA 3NZSA 1QUQB 1VCBA 1E0ZA 1YMHE 5C0XI 3I91A 4ZAIA 4F8MA 4DR5Q 4LFBQ 1FEHA 3X0WA 2RHSB 4LF5L 1RAXA 2NTTA 4XXEA 1EQQA 3CQZH 4CJ2C 3B08A 3T3OA 3SK4A 1BXTA 1BQQT 1J7AA 1CM9A 3D6CA 2WWZA 3W1GA 1TWAH 2JA9A 2WDTB 3NY5A 2LS01 1UWVA 5C4JH 2H88B 4LF8Q 1K0SA 2MSED 1SJHD 2KDIA 2D5GA 2CHWA 2Y5CA 5L37A 2BS2B 3MZ5A 1WFYA 3V2TA 3PTFC 1GUSA 2JXTA 5J39A 4AP4C 1Y8PB 3KBGA 3R2TA 4CJ0B 1JMCA 2WXQA 3O13A 2WXHA 3T56B 4K3BA 4J6IA 5DPRA 4YHHL 4GLXA 2WDRB 4B3MQ 2DJGC 3RZWC 1J6QA 2F0PA 1TIFA 2BS4B 3NBHB 3BYYB 1Y1WB 4XYCA 1II3A 2NS5A 5CORA 5HG2A 1ENAA 2HHHL 1WI0A 3DBLB 2JA7B 3BDLA 2NYZD 1MFWA 3PLUA 4HEA1 2J0TD 2A5UA 2N9PC 2HQLA 4HSPA 5C4JB 3K9OB 2KYWA 2EMTA 1WTOA 1TZOA 1FGBD 4MEMA 3A33B 3ZRCA 3QK0A 2EPBA 2KDBA 2OF1A 3W1SC 5EKKA 3G6EA 3PRPB 4WWMA 2LSSA 3PRMB 4WURA 4YXDB 2IL8A 4AJYB 3H0GB 1T5XD 1Z5SB 4MHEA 3AU5A 3HUIA 2MBBB 3PRZA 1JB7A 2W3RA 3RNAC 3MA2B 1IYJB 1E1OA 5J17A 2MJEA 4RHRA 3EVQA 2F0IA 2JXMB 3R8BA 2CKZB 2PMVA 1KNEA 1GO3E 3QJYA 3HOXB 2HDEA 1CZWA 1YQBA 3DVGY 3MTSA 2HD3A 1KAWA 1V43A 2WP8J 4BXXG 2D2CC 1QKZA 3PS6A 4II2B 2JA5H 1JRUA 3Q3MC 4H02A 4K0KQ 2FIDA 2PE9A 3CPWA 3QX1A 2DAFA 2Y0SG 4QF4A 2O6VD 2ZTCA 3QR8A 2G4DB 1N36L 3AB9A 2ICIA 3K57A 2BOSA 1R4NB 1QVFA 4XWWA 4L8JA 3M95A 1ZYRD 4LF9Q 2IO3B 1ZOYB 2Y0SB 3K80C 3JAME 3J7ZC 5IGGA 4HCNB 1DGSA 1FXTB 2VW9A 3FKIB 2D9UA 1G8ZD 5IYDG 2SNMA 3GTGB 4N6EB 1EYAA 4JWSC 3TL5A 1Z6HA 2F3WA 4TV3A 2MWSB 4UP9A 4J15A 1VQKA 1OXVA 2N9LA 3MAQA 4TQ0A 1N34Q 4XQJA 1VMCA 2CJOA 4TMAB 4IUNA 4PS3A 1UWXA 1QZGA 2F0OA 4K14A 2BWES 3I3CA 4K2KA 4YY3Q 5DPWA 2LUEA 3Q8DA 4A3GB 2JA6B 1NI3A 1YOVB 4KVGB 2K03A 2O6VB 3MHZA 1MJEA 5C4XB 2ZNVB 2FMMA 4B9XA 2AUJD 3X23A 1EFID 5JEAG 4DR7L 4AYBE 1E2ZA 1EYCA 1YD8U 3S1RB 3EQLC 2E2HH 1FL0A 2X69A 5CMDA 2A5HA 3K5LA 3NPPA 3HOZG 5GAGC 2E2DC 5HGQA 1V6EA 4F88A 3NP8A 4HROA 4ZYNA 4CDEC 1DOYA 3VR5A 5M5XB 1JWBD 4N9F4 3HOYB 1M90C 5CV7A 2QCPX 1WCMG 2LXKA 1S5BD 5CGKA 1VQOA 2R93H 2WAQE 2PLPA 2K75A 2BA1A 1TTNA 1W6JA 4B9WA 1PFSA 2B2VC 1GAQB 3KK7A 4LF4L 5AZFA 4FF3A 2DZMA 3M4QA 2XBBC 4P1BC 3TCAA 4KJOA 1NJIC 3VH3B 2VZAA 5IT9E 1QOFA 4DFAA 1VQMA 1KF6B 3DHHC 4QUCA 1GUNA 1JOOA 5LMUQ 4RM9A 1QNKA 1TWHH 4AUQC 1N33Q 1ESRA 5IAAC 3ZTCA 4IPCA 3S2AA 2KTRA 4QIWB 3VVWB 2XRSD 4XDDA 4DKAC 2KMMA 2SAKA 3IVFA 2JA5B 1KXLA 2JWZA 2WS3B 1Y8RC 4DR4L 3ULJA 4NQKE 1DOXA 4L5SA 3GDEA 1AP0A 4C2MB 1FJGQ 4A3EB 4B08A 3GTMB 4HVBA 5EDSA 4UHVA 1H9SA 3QG1A 4WORA 1J5EL 1E90A 2ZXPA 2Z0DB 1STHA 5FLXL 3ND9A 2WXKA 4R3DA 2ASBA 1E7ZA 4S3SA 2EYHA 4GNXB 2K6QA 3IT6B 3MXNB 1HTLD 2ZCBA 3VAWA 4OX9Q 1EF1A 3PSEB 2Z6KC 2PVOD 2XK5A 1PTOF 2I5LX 1Q81C 1X9NA 3ER0A 4OEMB 4O1NA 5E6JA 3TMPB 4CQNA 2XK5B 1F2ZA 1JRPA 2V4IB 4A76A 3ML9A 2B2TA 3LJ3A 2Q2UA 5D14A 1L6VA 1RJTA 4PMWA 4RM8A 3U7ZA 3VUYA 3ZO5B 5IP7G 2ZTEA 3Q0AA 4NB3A 4LTUA 2KT7A 3EA6A 5CV8A 1PZID 1YNXA 3OJ3A 1SJED 3T13A 5C44H 2DWQA 1J0GA 2QIEB 2N7DA 1VLBA 4ME5A 4JBJA 4BZAA 3L9AX 1SF0A 4W9EA 5C0XH 2LGYA 2YTVA 2A6EC 2WYQA 1HZ6A 3PIOA 4F87A 2GVBA 4DAVA 2BBCA 3AB5A 3HOVG 3URYA 1E2VA 4I7AA 3ML8A 3E0JA 2YEPF 3ECIA 2RDHA 3TP5A 2JA7G 3QWNA 1NI2A 3CSTA 5CHWA 3RNGC 2JPHA 4W9HA 3PV0A 3STBC 2Q8RE 2ATWA 1ZXHA 4W9LA 5IT9c 1KDCA 3I72A 3DBHB 3GOEA 2I1JA 2N7EA 4C3JG 4ME3A 2RGFA 1YN3A 1WX8A 3V96A 4BY1G 5IIFA 3FMCA 1PV4A 2IX1A 5I9OA 1EZ8A 2E76C 1GC7A 1WM3A 5IY0A 1STAA 2JYEA 1VQNA 2L55A 3BVMA 1K8AC 1CSPA 2KMCA 5C0XJ 2E2IH 3FPPA 2YEPB 1PMRA 1WWTA 2J0JA 3I9V1 1TY2A 2XRQD 3NZUA 2L1BA 4F7XA 2HJ1A 3EECA 1CJEA 1X1MA 2JRHA 1F1HA 1TS4A 5M5YH 4HWIB 1AH9A 1WFQA 3T51B 2R7ZH 3Q6SA 1PA6A 4IW0A 3L3OC 4B0EA 3ZNID 1WGDA 3RZOH 4GNXC 2IGHA 2KCTA 3EBEA 3PO2G 2WXIA 3M4OB 4P71A 4XT3B 4A3FG 2JA5G 3VYSA 1HA6A 3Q23A 1SFOH 2BDNA 4L1BA 4US8A 2VH1A 1CSQA 5C3EH 3N1YC 2G4SA 1FNUA 4OWWB 1FPYA 3B0AA 1LTGD 3CRKC 4JI4L 3AFQA 4A93B 2VRRB 1FFUA 3SR6A 1EY6A 3D31A 1DCZA 4DR1Q 2R3ZA 2OXPA 2HD5B 4FF2A 3HOWG 1WR1A 4K2LA 3I70A 2V3PA 3WWVA 1R4MB 3NRZA 4EUTA 1V97A 2DJFC 3PUXA 2LFIA 5ELNA 3P4QB 1IGCA 2O2VB 3BZKA 3AM9A 3PZ8A 1N9WA 3K8AA 3EHVA 1LTAD 3S1NB 1SYGA 1V9JA 2K01A 5FLMG 1LTBD 3FRPB 5HGTA 5D7GA 3DWAA 5IO9A 2JJQA 4DV4L 5FLXE 1ICWA 3OW7A 1P1AA 1UELA 3HK0A 1HEZE 3KJPA 5JXVA 4WJPA 3QQ8B 1EU4A 4BBNC 3RUZA 3C2PA 1N32Q 3K58A 2LZ6A 3HGBA 3GQBA 4JW0A 2HJ8A 2IPKD 3T1HQ 4A3JH 1WMHB 1NVID 1TU2B 3LX0A 1PYSB 3JAMi 1VQLA 3GE8C 2EY6A 1WX9A 3K6OA 4ZCKA 3QA8A 3UINB 4PZ6A 1WGGA 2AQ2B 3I90A 2R93G 2KQ3A 2JQRB 2E5LL 2K8CA 3N9YC 2C5CA 1EY5A 1M4VA 5F2DA 2BKRB 3GS2A 4P72A 2Y0SE 3D6WA 1EY7A 2DN8A 1CA6A 1UH6A 3QOJA 1YIJA 2WU5B 4RKBA 3CCUA 3P4SB 4CO7A 1I50B 2I2YA 2F03A 2BYVE 2IT1A 1Y1WH 1J7BA 4M0WA 1JC7A 1MHHE 1ZKHA 2PVGC 1VQDA 4YT0B 3ZJVA 3P63A 1HRJA 3ZXRA 3HHMA 4PZ7A 2R2QA 1ONLA 2F4VL 1H9JA 2DHZA 2WXPA 4HCPB 5DM63 4ZHOA 4BY7H 2A69D 1RDPD 2MP2B 2KLGA 4W9GA 2K33A 2RR9A 1X32A 3HKZE 4ZK9B 1WMHA 4L6TB 1YNNC 4DK1A 2NVTB 3RT3B 4FHKA 1O7YA 1E7UA 1WCMH 5CV9A 4ANXA 4POFA 2HDLA 4LAAA 1B2TA 2BDOA 1FRDA 1SAPA 1LO5D 4QY7A 3EUB2 2N9XA 3HVZA 3U2SC 3P1MA 3RMHA 4C3IG 2JT4B 1WTPA 4PT5A 1Z9FA 3AFPA 1WZ0A 2MBOA 4XWTA 4EQ5A 4BBSH 1PGAA 2JEAI 4L23A 1E3PA 3GTKB 2ASQA 4US9A 3KW5B 1E24A 1HUNA 2J53A 1XT9B 1VQ8A 1Z47A 2Z8LA 3IKJA 1PH9A 5KYLA 2Q8IB 3RUIB 1PRTF 1XEEA 4DXFA 2CW0D 4O2DA 3OTOL 1DGJA 1CT1D 3CCJA 2LVPA 2F0GA 1PFMA 4NDXA 2ZPYA 1WTRA 1C1YB 1SE3A 1I4QA 2LY7A 4ID6A 5K36G 4J8QA 4JI7Q 5BYSA 4C1NI 2KMAA 3L08A 2A73B 2B2TC 5H92C 1X54A 2KQ4X 3QIJA 4ZUIA 2EYFA 4ABNA 1BOSA 3KLWA 4AQ7A 5G2NA 4GLVB 1LTSD 2VZKB 3AEEB 5I6YA 3TP6A 1SXTA 3HOVH 3NHHA 3AE1B 3AECB 1GJXA 3SD5A 3IL8A 4A93H 3Q8FA 3AULA 4DK6C 1F9JA 1WR6E 2K6DB 2R93B 2NZOA 3NEMA 3I4MH 4DV1L 4JI8L 4M01A 2OJWA 2F4IA 2QF7A 5GQOA 4E3CA 3TEYA 4LW1A 2M4NA 5BR8Q 1T9HA 4PMBA 4BY1H 2DZIA 3GZNI 5IP7H 5AZGA 2KBNA 1OXSC 1R9TH 4NZLB 3M3YB 2L12A 2HCCA 2WHIA 1VQ5A 3W9CB 1KLVA 4YCWA 4A3BB 1UGMA 1EZ6A 2EVBA 5KYIA 3QARA 2Z9HA 1TJEA 4PG3A 5LMNQ 5M3FH 1I4HA 3A8KE 2UU9Q 2NBWB 5IA7A 2WNMA 2WKCA 3JW0X 1Q86C 1EYDA 3H7PB 2PKOA 2FAZA 3D3RA 2G3QB 4HPMB 1VQEA 2UU7A 4DDGD 1QG7A 3AU4A 1K8OA 4LFCL 2IGDA 1HZCA 1XJVA 4BOSC 3BYTB 2C5LC 1XLQA 3M4PA 1WGKA 1I3QH 4WJQA 2QDLA 2LGIA 1J19A 1CZPA 1VQCA 2L8JA 4KHZA 3L2PA 3BG3A 4S0RA 2SOBA 2K7VA 4DK5A 4A3GG 5EE0A 4JK1C 2EMSA 1XNRL 2OCEA 3X3MA 2NMQA 2QKIC 2FJ2A 1GKHA 2A69C 2Z6BA 4R4OA 1LLRD 2BB6A 3ZJYC 2SNSA 2M0XA 1BUVT 1E2WA 2D10A 2FCNA 3CWIA 3JVZX 4YSZB 3DEOA 2A6HD 3P20A 3VDZA 2W54A 3A4SC 1TWGB 4LUVA 4WWPA 4YWKA 1C4PA 4HK2A 2TSSA 3RYTA 2OEDA 3E6ZX 2UUCL 3MEHA 1LT4D 4JBMA 2CHXA 2WXGA 1TWCH 3DHGC 2LJ5A 4ULLA 4C00A 2Z6KA 2E2JH 4PK1A 3MXUA 3PUZA 4HIMA 4JI0L 4DN4M 1HNWQ 4GN5A 3Q22A 3FHWA 1NE3A 5C3EG 2UUAL 4JI4Q 1A3UA 1QUQA 1KHIA 2PZUA 1EL0A 4JE3B 3TUOA 3S15B 3A9KB 5CHFA 1SB3C 4FULA 2PQAA 2CW0C 4ZHPA 5M5YB 3DBLI 2RSUA 5CV6A 4KIKB 4KY5A 2JXXA 3IAM1 3DM3A 1IPGA 1A5RA 1LM8B 2EY5A 2KC2A 2IZVB 3Q8EA 5IGEA 1UGJA 1Q82C 2WXFA 1Q8IA 3SK6A 3ULPA 1BVSA 1EWHA 1OXXK 1VDZA 4LUZA 5FO8B 1LM0A 5I4DA 5FLMH 4JI3L 3H3VH 4NXNL 3AV8A 4QAYA 4B3RL 1OQRA 3CW2C 1HFGA 3PIPA 1FFVA 3KOJA 4ZRJA 1IBKQ 1PGBA 1EEFD 1E8XA 4I65A 1Q90A 4HJ5A 1XMOL 2I1KA 5LLIA 3FAHA 4GKJL 1PDXA 1IHZA 4MACA 4GKKQ 4KKJA 2GBMA 4ARCA 4W9FA 5LL6X 3AE7B 2A74C 4DK0A 3D32A 3PHWB 4I6LB 3S17H 3EFXD 2PPBC 4IWOA 3PO3H 5BN4A 2VUMG 2JZZA 4DXAB 1TWAB 5M3MH 2FCMA 1B9RA 3AEVA 3P4RB 2MA9B 3HG9A 5IWAQ 4G0NB 1BBWA 5M5XH 5TR5A 3BDCA 1TY0A 2UUBQ 3J7A5 5DM73 4J1MA 2DNEA 1E8WA 3NWSA 2KCNA 1B4OA 1HJPA 1VQBA 2P5ZX 3PIP3 2W82A 3W5VB 4DDID 3AE6B 2JZPA 1PYBA 3A55A 4GN1A 2OEOA 1QCBD 2F0KA 4AYBB 1VRAB 1YIWA 2V9HA 3QWZB 3GV6A 4C7ZA 5C3EB 1HNXL 1KNAA 3Q14C 3TJPA 3P2BA 3KLRA 4IUQA 1YJJA 1EIFA 2JK8A 1DOIA 3RFZB 3MEFA 3RZOB 1TWCB 1P9DU 1UEBA 1ENCA 3Q69A 4JVZA 5E4WC 5IP9H 2D3BA 1EY8A 3AEDB 4EZKA 1HZBA 2ZXRA 4HIKA 2FUHB 3NTHA 2F3VA 4KHPL 3FDTA 1KIXA 1IYVA 3U7DA 3T16A 4IZ8A 4KZ0A 1WY8A 1S4ZA 4EZJA 3TP7A 4HCEA 3PLVA 3V6CB 3H1UA 3RNFC 2D0PA 1A6XA 2BF8B 2NCNA 2X8XX 2OT2A 4X3KA 2ID0A 1V81A 1WXMA 4IOCA 1S5DD 4X3TA 3KQ4A 2B63B 2EDGA 2XVSA 4NY0A 4K5VA 1ZPSA 1B3AA 3PUYA 1EO6A 3UGBB 1ILPA 3ONSA 4NAMA 4MM3A 4K3CA 3VRBB 5JHAA 4JI6L 2M2LA 3A5UA 4BBSG 3UDGA 2EZVA 4FJYA 1GUGA 1L4DB 4WIPA 2M56B 3V60A 2L52A 1CQFA 1TR5A 1ML0D 3A56A 4LDTB 1PTOB 3JSVB 4KIKA 2D5DA 4R4TA 1KM7A 1H95A 2NN6H 4I6NB 2G5DA 1TYGB 3LYYA 3A74A 3CCMA 1N8RC 1RM6C 3DLLA 2QDBA 5JJKA 4HJ8A 2MX2A 1CI3M 3MFYA 1DOMA 4IWQA 4JLCA 1STEA 5CC4A 1JWAD 2INNE 1G2SA 5IE8A 2CHZA 2C60A 2G1EA 3A7AB 5JOBA 1VDVA 3U9SA 2MW5A 2NBVB 2YVCA 4Q2JA 4ZRPA 3W5UB 4HLEA 3KF8B 5IOIA 3U50C 3U8ZA 4B3TL 1AYFA 1SSNA 1UUPA 3NELA 2DYMA 3KF6B 4DAYB 5G3LD 1ZDVA 5EAYA 1Y1VG 4LF6L 1YEZA 5J22A 2NVXB 5HKHA 1SSOA 4N59A 3CRLC 5CV4A 2PZWA 5IGFA 3U52E 3ZQ4A 2YU9H 2NVYH 4M8AA 4DV0Q 1WXAA 3WOFA 1MPEA 3H94A 2IO0B 1TWFH 3IAS1 4OIJA 1GVPA 1QOGA 4IOIE 3VR9B 2KJ6A 1XX8A 3NBIA 4HKZE 1ET9A 1HXYD 1LV9A 4X66L 1XYIA 1JB3A 2QMTA 5DPSA 1ZXIA 1K50A 4XZ4A 4Q0FA 3GTLH 3F8TA 3J80i 1SYEA 3IT4B 5HI1A 2Y3AA 3CMEA 1Z7TA 3KLSA 1KL9A 2IW3A 2R7ZG 2K14A 1V86A 4M8MA 1ZDXA 2Z0SA 3OYYA 1WGYA 2DY8A 1G91A 2GBKA 2K8HA 3PO2H 3S1MB 4JCVE 4JGHB 2F0EA 4LFCQ 2F1MA 1N62A 3GTJH 4FHJA 1WTXA 4ZOHC 1IBML 3P4PB 2NTSA 4LK0M 4ARIA 2KOLA 1YHBA 4JL9A 3I57A 4B3SQ 3K9PB 1Q12A 4FBJB 2VB2X 2KFKB 3S24A 2JZ3B 4DV5L 5COYA 1OXUA 5EPKA 1WJ6A 3CXCA 1KTKA 4LUOA 2FNJB 2QGQA 5C5LA 1XTDA 3C0RB 4IWPA 5JVG3 4LF5Q 2VQEL 5JEAH 3I56A 3S2HB 2INCC 3DBHI 4XT1B 3AN1A 4ANWA 4RKLA 3DPDA 2D3AA 4LFAL 2IWHA 1PVOA 2K25A 3TN2A 4JV5Q 2KN5A 3KDFB 4LDTD 3JAMc 1KC8C 4IKGA 2KHJA 3BVGA 5E6OA 1SLJA 4A3FB 3CCLA 2HTHA 2JSVX 1WTHA 3R93A 1YZ6A 3NENA 2J52A 1B1ZA 4A3JG 1I50H 4WQMA 1C76A 2NPTB 1PGXA 2MBEA 2KFJA 1LT6D 3RNBC 2R61A 3VH4B 3ZTDA 4F7ZA 4ZDVA 4BY1B 4NPNA 4OO1H 5FO9B 1MIUA 1X6OA 2QEJC 2WQYB 1GUTA 2Q2HA 3TZDA 2MLBA 5G5GA 2ES2A 3I5JC 2WB1G 3R7RA 4H44C 3DBRB 3RLOA 5AEKB 4LFBL 3MP9A 4IPDA 2LVQA 3ZNZB 1AE2A 3VR2A 3HEJA 1E10A 3HOVB 2LFNA 2JWUA 4MIUA 1XD3B 1ESFA 1Q1BA 4DBGA 3SXHA 4GDKA 2ONQA 1PRTD 2CCZA 3ERSX 1C0AA 3KH0A 1UBIA 3R2IA 3PVLA 5AUIA 1WOCA 4FADA 1K83B 1K52A 4X62Q 3HOUG 2MNAA 3I4NG 4A3LH 3NHEB 2WXMA 2RCNA 4XTCS 3GE3C 4FN2A 2N9KA 3RN9C 3N52A 4YTMB 3PO3G 5IP9G 5KNCA 4MJSA 2CS4A 1STYA 1GUWA 2Z4IA 3NUCA 5CTRC 2K6AA 1V1PA 2K1BA 1STNA 5IWAL 5ELDA 4BBSB 2KECA 4HR7B 4IPGA 1D5MC 3F2BA 4A3IB 2M19A 1NMGA 1NBFC 3WALA 1A62A 4RGNA 5M9OA 2KA7A 4RF1A 1N36Q 2H1EA 1PH5A 4A3KH 5EKLA 3T1YL 1FXAA 4B6WA 2BVCA 2FMCA 3DVNV 1SYBA 1QB5D 4ZLTF 1ZW7A 4R1JA 5JPMC 2RPQA 3B9JA 4M02A 2RDFA 4IALA 3QO2A 2JP1A 3LGJA 4WJWA 1C4CA 1MI0A 2KJHB 5KNBA 3GTPB 1IL2A 4HRSA 4F8CB 4A55A 2KCMA 2YYZA 2JA7H 1HZ5A 4NMZA 2PMZE 3U30A 2X6LA 2KUMA 1PRTB 1JWUD 1GHKA 4NJCA 1L2FA 3VYUA 4YY3L 4DR6L 2JRIB 3TEHB 1EFWA 1HH2P 2RQXA 4A3DG 1NBWA 2R92G 4M00A 1QOHA 1JE4A 1Y56A 1EOVA 1VQIA 1K3RA 4CHTB 4BBRB 4S17A 1O7IA 4A3DB 1JE5A 4POGA 4JWUC 1A3VA 4HDQA 3NUHB 1RD9D 3ZVVA 1MHWC 2IBIB 4PYZA 1FGUA 2AQ3B 3S9WA 4UP7A 1ROEA 2NVUI 4UPAA 1N5WA 4A90A 1WVLA 2KDEB 2I07B 1TIID 3PCOB 3BINA 2F0UA 4DUYQ 1KOTA 4JIOU 4FVMA 1WGRA 2KWDA 3RPFC 3L0WB 4C4VA 4RCNA 1GUAB 3Q3FA 4KN4C 1JORA 3MXPA 1QWYA 4C3JH 1O7ZA 4RFBA 2EJMA 3H6MA 2UXCL 3H3VI 2XGTA 2GOWA 3X3NA 3Q8AA 4DV7L 4OZCA 1A15A 1BBXC 3J81i 4DR4Q 2D2QA 2WX0A 1WXQA 3EFCA 2WAQG 2MP1A 2W9NA 1R7SA 1XTCD 2MH7A 4IQZA 1BO0A 1FJGL 5D3IB 5JPNC 4A9AA 4DHJD 3DWPA 5GROA 1CMXB 3P1HA 1QT9A 3PIO3 3GTPH 3ZDMC 1VQ4A 3LWEA 1J9OA 3DXJC 5LXIB 5JJIA 4WQOB 4LNOA 1EIGA 1L1OA 4YIJA 1AN8A 2VQFQ 3PREA 1RFAA 1AEXA 3C1FA 4OZBA 1GHJA 3VR6A 4LNQA 4A3BG 3A7LA 3D4DA 3VA5A 1ZUD2 1H9RA 3DDCB 3L4PA 3WAMA 5BN5A 3S15H 1IBXA 2L7RA 5AZHA 1YBYA 4W9IA 2N1WA 3MC0B 1HPCA 2N4FA 1O78A 2JYTA 5GAHC 3KWLA 4XQNA 3M4OH 1B7YB 4B3ML 1TZ1A 3PPAA 4FLHA 2E2JB 2NBUA 2VZKD 5EE9A 2KXJA 5D94A 3WA0A 3OPOA 3GZNB 2K4KA 2RDBC 3EROA 2HHHQ 3MWYW 3K0XA 4C2MH 3HKZG 4JG2A
chains in the Genus database with same CATH topology
5KEEA 2EELA 1FNWA 4USAA 2KCCA 2PW7A 3A8IE 4TRDA 3K5MA 2G9HD 1QILA 3HRDD 1U4RA 4ZKBB 4J3OD 4OO1G 2JSOA 2MUYA 2KEEA 4CKBA 4N58A 1DD2A 1R4QB 3AMUA 5A35A 5FK9C 4KJNA 4ZQ3A 1U4MA 1AZPA 1LT3D 3FEWX 3CIRB 2O5IC 3AE2B 1FIQA 1V8CA 3H8HA 2E3TA 5CBAE 1JALA 1ACCA 1H9MA 1AZQA 1CHQD 2BW2A 1WRIA 4TKOB 2O4XA 5M3FB 3ETRA 2X38A 2NVQB 4G7HC 4TQ1A 2NB0A 1F77A 1I4XA 1YQ4B 2HCIA 3HP3A 1C79A 4HMIA 5EKIA 3DUZA 4RWSC 1WD0A 4KX6B 3CU7A 2XWJB 1WTWA 3NWTA 3CHBD 1BUIC 1OFFA 5IGBA 2B8FA 3KWVA 1FO4A 3W2DA 3FPUB 2JEBI 4B0MA 3NQTA 4N9TA 3LWUA 4DAYA 1EOTA 2CHBD 3J9CA 2EE1A 1IW7D 4MM3B 3TEWA 2SEBD 2XNAC 4DNTB 1E7PB 5K5PA 1LTTD 2F0DA 5E3FA 3FILB 3HOZB 1L5PA 1UEAB 1A3TA 4C3JB 4DF7A 3Q24A 2JX5A 5CV5A 1EY0A 3P42A 1EY9A 1TWFB 5CBEE 3GTQB 5T8IA 3NVZA 1RTOA 1MSHA 1DM0B 1VZ8A 4LJZC 1I6VC 1BCPB 5ELBA 1KDBA 1D2BA 1WTQA 1AW7A 4FNFA 5D3DA 2RVLA 4WH4A 3K5NA 1RF2D 4IURA 4L63B 1HQRD 2A6ED 1KAAA 1TKYA 5LHY1 3AEBB 2PW5A 4KKSA 1Y69U 1CFMA 1QNUA 1LT5D 4YTPB 4AS1A 4X3SA 1Y1VB 4HEDA 4A3KB 3TBIB 2LHEA 3SFDB 2SDFA 1SYDA 2GRIA 1TVXA 3AE5B 2L5TA 4IFDH 1G291 4FXGC 2QJLA 5CYUA 2Q8TA 5C0XG 1FCCC 2MGSA 3J81E 4KTAA 3GO5A 3SR1A 1EQVA 4EE2A 3I4LA 3K59A 1QOAA 1PFNA 3DHQA 4Q5VA 5M5WB 4ILWA 1NYQA 2PTLA 5C5MA 1O7LA 2K28A 1RWSA 2EJFC 5IGDA 3V3XA 1IW7C 2PIAA 5DEHA 3G7LA 4BA1I 2NUCA 4QB4A 2HQEA 3B2GA 3H09A 3DWMA 2J42A 4P6VF 4KMUC 1XWEA 3T4AC 2R6GA 3P7JA 2XSCA 2RPVA 3V05A 3VR4A 4US8A 4M1UB 1N60A 2N0SB 2KAJA 1LTRD 1VF7A 3UI2A 3E5SA 2RDGA 1EQTA 3J7AF 1VMPA 4H7BA 1R4PB 3CQZB 1V1OA 4A3MB 3AE9B 4YSYB 2PMZB 2ZXOA 4CJ1B 4HJGE 2B39A 2VB3X 4RHSA 4G7OC 4YTNB 1IKLA 1PTOC 3W3AA 2NZ1D 3DWQA 1G2TA 4GZYC 1HHVA 1E6EB 5AUKA 1XF5L 4JPSA 4G7ZC 5DNFA 1P7FA 2JYOA 2DBYA 3DM1A 2PZTA 2F0MA 4PNYA 3FVQA 2NN6G 1TKGA 1L6UA 3AEAB 2DYOA 4C3HG 1K8MA 3DEPA 3BS1A 1B50A 2FHTA 4C7YA 1D5ZC 2RBMA 2F0WA 3QOLA 2O2LD 4DU9A 3AE3B 1KRHA 1ZP0B 2WXNA 1HA5A 1UNSA 4V190 4GLSC 1OO9B 3NVWA 2N88A 4A8XC 3KBXA 1MGSA 3FILA 3F2UA 5KIXA 1DOLA 2NN6I 1PUTA 5A2QL 3M7NA 2B2VA 2L83A 4KKIA 3H3VC 1EWCA 3RLFA 5HHDG 1F2YA 2V0GA 1LABA 2EY2A 3LB8C 2Y5PA 1OXTA 1FNVA 3I4NB 1X3PA 2L11A 5K36H 2L32A 2FINB 5E4XA 3NTKA 4IDIA 1PYWD 4JX1C 4MN3A 4XDXA 2DNCA 2MJ8A 1ENFA 1TS5A 2K04A 2WXOA 3OWEB 4P16A 1CZGA 1NCVA 1F0ZA 2BT6A 4QUFA 1RODA 3PO0A 1NAPA 1NR2A 1I4PA 1EM7A 4FF4A 5BMHA 3HRZC 2LEKA 1F2RC 4RGMA 3AEFB 3OMGA 2EKIA 4YSXB 2CJNA 1KH0A 2K9XA 2A6HC 5C4ZA 1HQMC 2WKDA 3SHLA 1XLPA 1KDAA 3BDOA 1QOBA 3PO2B 5IOCA 3T3NA 2LJIA 4R8IA 5ELCA 3L7ZC 2KVMA 4KN7C 1DOKA 4K8JA 3PZ7A 3QB3A 2FFKB 5MPOA 5LL6S 3P75A 4OO1I 1H9KA 3TSSA 3J7YW 1WD1A 2LMCA 1ZKOA 1RTNA 3IFDA 4EQPA 2DLBA 2BE5D 2WDQB 4KV6A 4UDUC 4C56C 2NVYB 1SNQA 1ET6A 1JCKB 3WCQA 4RA8A 1BNZA 3C8YA 4KGRA 1WYGA 4KI0A 4NAWB 5C3XA 1O80A 1IL8A 2JE6I 1F9QA 2LHDA 2FBWB 1QJOA 2KDMA 3VA7A 5KGUA 3SK5A 1OQQA 3LNNA 1C9FA 1RFKA 2FUG1 4FYDA 1N61A 2O5JC 2Z1CA 1BDOA 3C3LA 3S1QB 1FR3A 5JEAJ 1PTOH 5E1FA 2HUGA 1JQ4A 4KD3A 3J7AV 3NQIA 2IX0A 1A70A 1STGA 1GUOA 1STBA 2PO4A 5H8YE 3Q8BA 5HURA 1I3QB 4H0LC 1D4BA 3KLSX 2MHVA 3D4WA 3OWFA 5I2XA 3SE0A 1VJKA 4KGSA 2EOTA 2IGGA 2WACA 3A54A 3AU7A 2E2HB 3Q8CA 2ZW1A 1TKWB 1SMYC 4Z9CB 1DXMA 2RKSA 2XWBB 2IDYA 1UWMA 2NWGA 1L0VB 3BVZA 2AUKA 3ABVB 4FXKC 2IX3A 2EYOA 2Q5WD 4OVZA 3I4MB 2LMCB 2M0AA 4MT5A 1SNPA 2X6GA 2DY7A 5EPLA 4K6DA 2XIWA 5D65A 3NVYA 5EBDA 1XLOA 2V3NA 1FYCA 1PFBA 2TMPA 1MSGA 1WTVA 1KLGD 4DXGA 4HMJA 4G57A 2ICEC 4HCSA 5C6AA 3DMUA 1L4ZB 4XYQA 5EE1A 4IUUA 2F0SA 4ODGA 1EWYC 1C8CA 2N7JA 2PW9A 4HN7A 3MVVA 4ZKCB 1NUCA 5T1GA 1M8AA 1SYFA 2ACZB 1C77A 4OGQC 3HVDA 3C1EA 1QQRA 1TKEA 4HSVA 4MH8A 5LNK1 3ERQA 4BY7B 2K5DA 4C80A 1C48A 1NEKB 5AFWA 1CA5A 4PMCA 1JOQA 2K32A 3HKZB 2BTEA 4HKQA 4ZUJA 4QMGA 2EYMA 2B2UA 4IN3A 2WP9B 1BCPD 5EBCA 2WDVB 1UAPA 4ZYSA 1RKNA 5I6WA 4FXDA 3NK9A 4R9WA 4RNAA 3IFTA 2LUMA 1IUEA 1Y8NB 3MXGA 5EPJA 3NVVA 3VR8B 3I73A 1FD6A 1BF4A 4BWGB 1SMYD 3TMEA 2F0JA 2I38A 4IFDI 2E6XA 1PLFA 3RD4A 3VQIA 5FKAC 1K53A 1Q10A 3NZ3A 3M85A 3J80E 2INPE 2WV6D 3FC4A 1CK1A 3BZDB 3M7GA 5TSSA 4N9PA 5C3WA 4TQUS 1R9TB 1H9SB 2GI9A 3ZGZA 2IJ0A 5C4HA 1ZXTA 4NP5A 3WOEA 4Y7NB 4KY7A 4EVOA 5C3JB 1SEBD 3NSWA 1K51A 3AEGB 2N55A 3I8ZA 4UAIA 1J7CA 5ELFA 1P7EA 3GTOB 4R8NA 2ON8A 4RGTA 2VUMB 3S16B 5IT9L 1J8IA 3MHBA 1LTID 2B2WA 2B2YA 3GV3A 2BB5A 4FF1A 4XE0A 3MXNA 4WAFA 5FOBB 2I46A 3OHXC 5M3MB 2K5QA 3KF8A 3R3OA 1JWMD 1SDFA 3U9OA 3ZJUA 1C4QA 3VRAB 1EY4A 3SEBA 2B8GA 4U68A 1PTOD 2GA4B 1DZ1A 2MJ3A 4H2AA 2ENBA 1F9PA 3DWGC 1AFPA 2WXRA 1RYJA 1SE4A 1EU3A 2KN4A 3QIAA 3AE4B 2HTME 1IKMA 2PNRC 1SIJA 2K5PA 2V4DA 3S17B 1NENB 2WINB 4RGOS 1V8QA 5GXGB 1EIHA 5EE3A 4KY6A 2F0VA 2B2WC 3OSOA 1XO3A 4O42A 1B53A 2E74C 1GB4A 3TEZA 1TS3A 1KLUD 1IBXB 3K5OA 4ZRQA 1DJRD 3NS1A 3H91A 5G3LF 2F0FA 1D5XC 3S2DB 4REZA 1VZ7A 2YU9B 3M4YA 5EJWA 4U673 1NR4A 3J81L 2H89B 2WU2B 1F9RA 1V1PB 1SNCA 2AWNA 1GB1A 1F9SA 2RA4A 1F2RI 1FMAD 5CR3A 1BCPF 1CHPD 5IGCA 2WB1B 1YQ3B 4C3HB 2J4XA 3TDQA 5FO7B 3MFGA 1TWHB 3IAYA 3E56A 4G4KA 2K05A 3HS0C 4X3UA 1JICA 2QILA 3HZXA 5EQ0A 1SFOB 1W6KA 4JBWA 3SK8A 1CTMA 1SBBB 2Z4HA 2K0PA 1D1IA 2E75C 1B9MA 1D1KA 3SDZA 2HDMA 1SNOA 1E0BA 3NBHA 1U4LA 2KACA 3W1SA 2MEKA 1IYUA 1ZYRC 1VZ6A 5FR3A 4DAPA 2GB1A 4BA2I 1G6ZA 4K8IA 1A2TA 1S5FD 5ISRA 3VYTA 2PCFB 3PUVA 2H4OA 3LXFA 3CKIB 3N6RA 1TS2A 3NE5B 5EGTA 1JWSD 4FP5D 1EEID 3WDNA 4IUPA 2R92B 4WRDA 1N63A 5ELEA 1FRRA 4NKLA 2M9VA 3GTJB 1QF6A 5DAUA 2K22A 2CU3A 4OIKA 1I7HA 3EJIA 4YWGG 1SE2A 1GXDC 5C44B 1HCZA 5T1IA 5BYRA 3G6JB 3OOCA 2CVRA 3AMZA 4QCLA 3GTLB 5C2TB 3TZUA 5JVH3 3GP7A 4GDKB 3C46A 1X3QA 5G5HA 1U9RA 1TT2A 4NW2A 5IODA 2RSNA 4DQOC 3MJ5A 4C1NK 1JW9D 5KNDA 3AE8B 1JOKA 1SYCA 4V0BA 2BYTA 1T6BX 2WXLA 3HOWB 3ZYYX 5BMIA 1I4GA 4DA2A 2EXZA 5KRUA 3NTIA 2W55A 4OL7A 4ZRZA 4PV1C 5I9PA 3E9SA 2JU6X 2F0QA 1PZJD 1ZEQX 2BE5C 5I2YA 1HFNA 5JAVA 4H13C 1LACA 4CKEA 3NXWA 1B9NA 2BA0A 1FM0D 2EYJA 2AWOA 2KEDA 1TQOA 1MI2A 2A68C 4A6QA 1F2MA 1VCIA 1C78A 4A3JB 2EYLA 5NUCA 1KABA 1B44D 1XLNA 4K6LA 4HTHA 4CGYB 1QLBB 4FXCA 1YN4A 1YJIA 1I6HB 4L2YA 1RHPA 2W3SA 3PUWA 3AH7A 1I4RA 1L0YB 2PQEA 2AQ1B 4K5WA 2D62A 2BS3B 4CBVA 3J80L 4IFDJ 2B2YC 1GOZA 2AX5A 5HFYA 3SVMA 2E2IB 4WFN3 2MPMA 1KFYB 2MJDA 2PYKA 5BMGA 1MVKA 2F0HA 1L0XB 2LKVA 1N5XA 3RZDB 4EQOA 1JROA 2XN9C 3TP8A 1PDQA 4C3IB 4HAEA 1JR0D 3PMFA 2NBFA 2RSOA 4GDLB 2BCOA 3PO3B 1S5CD 4RAUC 4PQXA 3BK2A 3BK1A 1ILQA 2K3UA 1FD7D 2WIIB 3UI3A 1GPXA 3ND8A 4RH6A 2CQAA 2RMMA 1D6EC 1YNJC 2ZT9C 4LMQD 2M00A 4IFDG 1DONA 1NSNS 2OHFA 2G9DA 4KKUA 1BR9A 3ITPA 4KGTA 1YNTE 4RF0A 1MD2D 4FO2A 3OIPA 2WXJA 3TEXA 1ZE3D 4D2KA 1WCMB 1BCPC 1HUMA 1U4PA 4E6IA 4TSSA 4OW0A 2J7ZA 2EJGC 2A68D 1MHXA 3U4EG 4BS9A 2EY1A 2L4NA 2F0LA 3OIQA 4LLGM 4XYOA 1WSPA 1S5ED 2WLBA 4XIGS 2WAQB 3HOUB 2KJXA 5BN3A 2EYPA 4IUVA 5A2QE 2L1AA 1MBYA 4KHVA 2FE8A 4K5XA 2L0CA 1YN5A 3T53B 4KKTA 5BYQA 4RCOA 1DYQA 3IXSA 1SNMA 3D4RA 1E9MA 3B2FA 1YNND 3OMCA 3ONAB 4EQNA 1NYRA 4LK1C 1HTPA 3VYRA 1PRTC 3VR3A 4XQQA 1XCTL 4DNRB 1Q1EA 4DGZA 4P2CB 1A2UA 4ITKA 2JA8B 1XCQL 4EGVA 1IGDA 1VF5C 5J1ZA 2F0NA 2B2UC 4J6HA 3BWUD 2C9OA 1JQYD 1PFDA 3K0YA 4KD4A 3BIID 1PZKD 3KUPA 3SFEB 1BMLC 1CQVA 1Q3LA 1T3QA 3D8GA 3A8JE 3ZJTA 1Y8OB 4I7ZC 2QSDA 1FCLA 1C4AA 3JAML 2K5WA 1T5EA 4CKCA 3EGRA 1YNJD 2B76B 4KK7A 1QE6A 4XDCA 1AWDA 1FXIA 1RCVD 2R7ZB 1JMLA 4IUTA 2F0TA 3K7AB 3GD7A 3GB1A 2ZW0A 4OHJA 2VNUD 2L9HA 2VXWA 1F2LA 5JJZA 1SNDA 1XXGA 1PXUA 3S14B 2KHSA 1E0ZA 1YMHE 5C0XI 3I91A 4ZAIA 4F8MA 1FEHA 2NTTA 4XXEA 3T3OA 4CJ2C 3SK4A 1BXTA 1BQQT 1J7AA 1CM9A 3D6CA 2LS01 2H88B 1SJHD 2D5GA 2Y5CA 2BS2B 3MZ5A 3V2TA 1GUSA 2JXTA 5J39A 1Y8PB 3KBGA 3R2TA 4CJ0B 2WXQA 2WXHA 3O13A 3T56B 2WDRB 2F0PA 2BS4B 3BYYB 1Y1WB 1II3A 5CORA 5HG2A 1ENAA 2JA7B 3BDLA 2NYZD 4HEA1 2J0TD 4HSPA 5C4JB 1WTOA 1TZOA 1FGBD 2EPBA 2OF1A 5EKKA 4WWMA 4WURA 4YXDB 2IL8A 3H0GB 1T5XD 4MHEA 3HUIA 2W3RA 3MA2B 2MJEA 4RHRA 3EVQA 2F0IA 2JXMB 3R8BA 2PMVA 1KNEA 3HOXB 3QJYA 2HDEA 1CZWA 3MTSA 1V43A 2WP8J 1QKZA 2D2CC 4QF4A 3K57A 3AB9A 2ICIA 2BOSA 4XWWA 4L8JA 1ZYRD 1ZOYB 2Y0SB 3JAME 5IGGA 3FKIB 2D9UA 1G8ZD 3GTGB 2SNMA 4N6EB 1EYAA 4JWSC 1Z6HA 2F3WA 1OXVA 2N9LA 3MAQA 4TQ0A 4XQJA 1VMCA 2CJOA 4TMAB 4IUNA 1UWXA 2F0OA 4K14A 3I3CA 4K2KA 4A3GB 2JA6B 1NI3A 2K03A 3MHZA 5C4XB 2FMMA 4B9XA 2AUJD 1EFID 5JEAG 1E2ZA 1EYCA 3S1RB 3EQLC 2X69A 5CMDA 2A5HA 3K5LA 3NPPA 2E2DC 4F88A 3NP8A 4HROA 1DOYA 3VR5A 5M5XB 1JWBD 3HOYB 1VR9A 5CV7A 2QCPX 5CGKA 1S5BD 2PLPA 2BA1A 1W6JA 4B9WA 1GAQB 2B2VC 3KK7A 4FF3A 4KJOA 5IT9E 1QOFA 4DFAA 1KF6B 4QUCA 1GUNA 1JOOA 1QNKA 1ESRA 4QIWB 2XRSD 4XDDA 2KMMA 2SAKA 2JA5B 2WS3B 1DOXA 1AP0A 4C2MB 4A3EB 4B08A 3GTMB 1H9SA 3QG1A 4WORA 2ZXPA 1STHA 5FLXL 3ND9A 2WXKA 4R3DA 4S3SA 2EYHA 3IT6B 1HTLD 2PVOD 1PTOF 5E6JA 4O1NA 4CQNA 1F2ZA 1JRPA 2V4IB 2B2TA 5D14A 1L6VA 1RJTA 4PMWA 3U7ZA 4LTUA 3Q0AA 3EA6A 5CV8A 1PZID 1SJED 3T13A 2DWQA 2QIEB 1VLBA 4ME5A 3L9AX 1SF0A 5C0XH 2A6EC 1HZ6A 2BBCA 4F87A 4DAVA 3AB5A 3URYA 1E2VA 3E0JA 2YEPF 2RDHA 3TP5A 3QWNA 3PV0A 2Q8RE 1ZXHA 1KDCA 3I72A 4C3JG 1YN3A 3V96A 5IIFA 3FMCA 2IX1A 5I9OA 1EZ8A 2E76C 1STAA 2JYEA 2L55A 3BVMA 5C0XJ 3FPPA 2YEPB 1PMRA 1WWTA 3I9V1 1TY2A 2XRQD 2L1BA 4F7XA 1CJEA 1TS4A 3T51B 4B0EA 3Q6SA 3L3OC 2IGHA 2WXIA 3M4OB 4XT3B 3VYSA 1HA6A 3Q23A 2BDNA 4L1BA 1FNUA 1LTGD 3CRKC 4A93B 1FFUA 3SR6A 1EY6A 3D31A 1DCZA 2R3ZA 2OXPA 4FF2A 4K2LA 3I70A 2V3PA 3NRZA 1V97A 3PUXA 2LFIA 3P4QB 1IGCA 3PZ8A 3AM9A 1LTAD 3S1NB 1SYGA 2K01A 5D7GA 1LTBD 3FRPB 5HGTA 3DWAA 5FLXE 1ICWA 3OW7A 1HEZE 5JXVA 1EU4A 3RUZA 3C2PA 3K58A 3HGBA 3GQBA 2IPKD 1NVID 1TU2B 3LX0A 2EY6A 3K6OA 2AQ2B 3I90A 2KQ3A 2JQRB 3N9YC 2C5CA 1EY5A 1M4VA 5F2DA 3GS2A 3D6WA 1EY7A 2DN8A 1CA6A 3QOJA 2WU5B 4RKBA 3P4SB 1I50B 2I2YA 2F03A 2IT1A 1J7BA 4M0WA 1JC7A 1MHHE 4YT0B 2PVGC 3ZJVA 3P63A 1HRJA 4ZHOA 1ONLA 1H9JA 2WXPA 5DM63 2A69D 1RDPD 2K33A 1X32A 4ZK9B 4L6TB 1YNNC 4DK1A 2NVTB 1O7YA 5CV9A 2HDLA 4LAAA 1B2TA 2BDOA 1FRDA 1SAPA 1LO5D 3EUB2 3HVZA 3U2SC 3P1MA 3RMHA 4C3IG 1WTPA 4PT5A 4XWTA 1PGAA 4L23A 2JEAI 3GTKB 4US9A 2J53A 1HUNA 1Z47A 2Z8LA 3IKJA 5KYLA 2Q8IB 1PRTF 1XEEA 4DXFA 2CW0D 1DGJA 1CT1D 2F0GA 1PFMA 4NDXA 1WTRA 1SE3A 1I4QA 2LY7A 4ID6A 5K36G 4J8QA 5BYSA 4C1NI 2A73B 2B2TC 5H92C 2KQ4X 4ZUIA 2EYFA 4ABNA 1BOSA 4AQ7A 1LTSD 2VZKB 3AEEB 5I6YA 3TP6A 1SXTA 3AE1B 3NHHA 3AECB 1GJXA 3IL8A 3Q8FA 2R93B 2F4IA 2QF7A 3TEYA 4PMBA 1OXSC 4NZLB 3M3YB 2L12A 2HCCA 3W9CB 4A3BB 1EZ6A 2EVBA 5KYIA 1TJEA 1I4HA 3A8KE 2WNMA 2WKCA 1EYDA 2PKOA 3D3RA 1QG7A 1K8OA 2IGDA 3BYTB 1XLQA 1WGKA 2LGIA 1CZPA 4KHZA 3BG3A 2SOBA 2K7VA 5EE0A 4JK1C 3X3MA 2NMQA 2QKIC 2FJ2A 2A69C 1LLRD 2BB6A 2SNSA 3CWIA 1BUVT 1E2WA 4YSZB 3DEOA 2A6HD 3P20A 2W54A 1TWGB 1C4PA 2TSSA 2OEDA 3E6ZX 3MEHA 1LT4D 2WXGA 4ULLA 3MXUA 3PUZA 4DN4M 3Q22A 1A3UA 4JE3B 2PZUA 1EL0A 3TUOA 3S15B 1SB3C 2CW0C 4ZHPA 5CV6A 4KY5A 3IAM1 2EY5A 3Q8EA 5IGEA 1UGJA 2WXFA 1Q8IA 3SK6A 1EWHA 1OXXK 1VDZA 5FO8B 5I4DA 3AV8A 1OQRA 1HFGA 1FFVA 1PGBA 1EEFD 4I65A 1Q90A 3FAHA 1PDXA 1IHZA 4MACA 4KKJA 4ARCA 5LL6X 3AE7B 2A74C 4DK0A 3EFXD 2PPBC 5BN4A 1TWAB 1B9RA 3P4RB 3HG9A 3BDCA 1TY0A 5DM73 4J1MA 2DNEA 3NWSA 2KCNA 1B4OA 3PIP3 3W5VB 2W82A 3AE6B 2JZPA 3A55A 2OEOA 1QCBD 2F0KA 4AYBB 1VRAB 3GV6A 4C7ZA 5C3EB 1KNAA 3KLRA 4IUQA 1YJJA 1DOIA 3RFZB 3RZOB 1TWCB 1ENCA 3Q69A 5E4WC 1EY8A 3AEDB 2ZXRA 3NTHA 2F3VA 3FDTA 1IYVA 3T16A 4IZ8A 1S4ZA 3TP7A 4HCEA 1A6XA 2OT2A 4X3KA 2ID0A 1S5DD 4X3TA 3KQ4A 2B63B 2EDGA 2XVSA 4K5VA 1ZPSA 1B3AA 3PUYA 1ILPA 4NAMA 3VRBB 2M2LA 2EZVA 1GUGA 1L4DB 4WIPA 2M56B 2L52A 1CQFA 1TR5A 1ML0D 3A56A 1PTOB 2D5DA 2NN6H 1TYGB 3LYYA 1RM6C 2QDBA 1CI3M 3MFYA 1DOMA 1STEA 5CC4A 1JWAD 2INNE 1G2SA 2G1EA 3A7AB 5JOBA 1VDVA 3U9SA 4ZRPA 3W5UB 4Q2JA 1AYFA 1SSNA 1UUPA 2DYMA 5G3LD 1ZDVA 2NVXB 5J22A 1SSOA 4N59A 3CRLC 5CV4A 2PZWA 5IGFA 3U52E 3ZQ4A 4M8AA 3WOFA 1MPEA 3H94A 3VR9B 3IAS1 4OIJA 4IOIE 1QOGA 1XX8A 3NBIA 4HKZE 1ET9A 1HXYD 1LV9A 2QMTA 1XYIA 1JB3A 1ZXIA 1K50A 4Q0FA 1SYEA 3IT4B 5HI1A 2Y3AA 4OZAA 1Z7TA 3KLSA 2IW3A 1ZDXA 2DY8A 1G91A 3S1MB 2F0EA 2F1MA 1N62A 1WTXA 4ZOHC 3P4PB 2NTSA 4LK0M 4ARIA 2KOLA 3I57A 1Q12A 2VB2X 5COYA 5EPKA 1OXUA 1KTKA 5C5LA 5JVG3 5JEAH 3S2HB 4XT1B 3AN1A 4RKLA 2IWHA 3TN2A 4IKGA 3BVGA 4A3FB 2JSVX 3R93A 2J52A 1B1ZA 4WQMA 1C76A 1PGXA 1LT6D 2R61A 4BY1B 4OO1H 5FO9B 2WQYB 2QEJC 1GUTA 3TZDA 5G5GA 4H44C 3MP9A 3VR2A 3HEJA 1E10A 3HOVB 2LFNA 2JWUA 4MIUA 1ESFA 1Q1BA 3SXHA 2ONQA 1PRTD 3R2IA 5AUIA 1K83B 1K52A 2WXMA 4XTCS 2N9KA 3N52A 4YTMB 5KNCA 1STYA 1GUWA 2Z4IA 3NUCA 2K6AA 1V1PA 2K1BA 1STNA 5ELDA 4BBSB 2KECA 4HR7B 2M19A 1D5MC 4A3IB 4RGNA 5M9OA 2KA7A 4RF1A 2H1EA 5EKLA 1FXAA 2FMCA 1SYBA 1QB5D 4ZLTF 3B9JA 5JPMC 2RDFA 4IALA 3QO2A 2JP1A 4WJWA 1C4CA 1MI0A 5KNBA 3GTPB 4HRSA 4A55A 2YYZA 1HZ5A 4NMZA 2X6LA 2KUMA 1PRTB 1JWUD 1GHKA 4NJCA 3VYUA 2RQXA 1QOHA 1JE4A 1Y56A 4CHTB 4BBRB 4A3DB 4JWUC 1A3VA 3NUHB 1RD9D 2AQ3B 3S9WA 1ROEA 1N5WA