4ZYSA

Crystal structure of an exotoxin 6 (sav0422) from staphylococcus aureus subsp. aureus mu50 at 2.25 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
195
Chain Sequence
b'TEVKQQSESELKHYYNKPVLERKNVTGYKYTEKGKDYIDVIVDNQYSQISLVGSDKDKFKDGDNSNIDVFILREGDSRQATNYSIGGVTKTNSQPFIDYIHTPILEIKKGKEEPQSSLYQIYKEDISLKELDYRLRERAIKQHGLYSNGLKQGQITITMKDGKSHTIDLSQKLEKERMGDSIDGRQIQKILVEMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords exotoxin 6
publication title Crystal structure of an exotoxin 6 (SAV0422) from Staphylococcus aureus subsp. aureus Mu50 at 2.25 A resolution
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Sugar binding protein
total genus 63
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zysA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zysA01
1RD9D 1EEID 1SJED 4L6TB 4RGMA 5ELCA 1LTRD 4RCOA 1RF2D 1YN3A 1SJHD 1TY2A 1HTLD 1HQRD 3R2IA 1V1PB 3BVZA 5TSSA 1PTOD 1PTOC 1HXYD 4K6LA 1MD2D 4O1NA 1FGBD 4RGTA 2XNAC 3CHBD 1D5ZC 1FD7D 1S5CD 1FNVA 3R8BA 1S5ED 1PTOH 1D5MC 4DXFA 1BCPF 1I4PA 5FKAC 3SEBA 1LT6D 1STEA 5ELFA 5ELDA 2XRSD 4ZYSA 1LTID 3MC0B 3BYYB 2QEJC 2Z8LA 2SEBD 1EU3A 5I4DA 1UNSA 1CT1D 1LO5D 1DYQA 1PRTD 4Z9CB 1PRTC 2O2LD 3KLSX 1B44D 3BVGA 1JWUD 1L0XB 1LTTD 2XRQD 2R61A 2CHBD 5D3IB 2NTSA 3OWEB 3URYA 3BZDB 1XTCD 2RDGA 1GOZA 2AQ2B 1B1ZA 1LT3D 4RHSA 1PZKD 3BVMA 1QILA 2WV6D 5FK9C 1LT4D 1BCPC 4RFBA 1KLUD 1PZID 2IJ0A 1SBBB 1KTKA 5ELEA 2J4XA 1YN5A 1AW7A 3EFXD 1DJRD 2G9HD 1LT5D 1AN8A 1XXGA 4DXGA 1PTOF 1RDPD 1JWSD 4RHRA 1V1PA 1EU4A 1I4XA 1KLGD 1EFID 1PTOB 3BYTB 1T5XD 1F77A 1SE3A 1S5DD 4NZLB 1EWCA 1ET9A 3O13A 1L0YB 1JWMD 1LTGD 3MFGA 1V1OA 4UDUC 1HA5A 2IPKD 1I4RA 1LTAD 1M4VA 1TS4A 1G8ZD 1LLRD 3DWPA 1CHQD 1FNUA 1JQYD 1FNWA 3TSSA 1ENFA 1S5BD 4BWGB 1PYWD 3GP7A 2TSSA 1D5XC 2ICIA 1PRTF 1JR0D 4C56C 1LTBD 1SE2A 1PRTB 1BCPD 1TS3A 3DWQA 4RGNA 1TS5A 1SE4A 1I4GA 4RGOS 1YN4A 1CQVA 1I4QA 1RCVD 4RH6A 1JCKB 1PZJD 1ESFA 1SXTA 2QILA 1D6EC 1TY0A 2RDHA 1LTSD 5D3DA 1SEBD 2NTTA 2AQ1B 1I4HA 1CHPD 3DWAA 1BXTA 1S5FD 3R2TA 4OHJA 1CK1A 4TSSA 2AQ3B 4L63B 5ELBA 1BCPB 2XN9C 3EA6A 1UUPA 3V05A 1EEFD 3W2DA 1ET6A 1TS2A
chains in the Genus database with same CATH superfamily
4DK3C 1QWYA 1YHBA 4L6TB 3IXSA 2O5JC 4KVGB 2KVMA 1Y1VB 1B3AA 4A3GG 2KJ6A 2PMVA 4B9XA 3V61A 1YQBA 2R7ZG 5E6JA 1J6QA 3KF8B 4B3TL 3TMPB 4DV5L 4MZ9A 2F4VL 2LUEA 5BYSA 1B8AA 2FMCA 4RWSC 1WZ0A 3JSVB 4R4TA 1TKWB 4KI0A 3MXPA 5C1ZA 2HT1A 4P16A 2YV5A 4AS1A 3TL5A 1FNVA 5LMNQ 1CUKA 3AV8A 3TRZA 1A8VA 4YCWA 2R2QA 3APFA 2CVRA 2BB5A 5ELFA 5ELDA 2JRHA 1Q0WB 3HKSA 3LXFA 4KHZA 4IOIE 2ZZPB 2ZTDA 1VQNA 5T8IA 3GTGH 4AQ7A 2XIWA 2NZOA 4LF6Q 2A6EC 3SR1A 4LF8Q 4RM8A 5LMNL 1UE1A 2MX2A 2RD0A 1TWCH 4KJOA 3RLFA 4PQXA 1XLQA 3L3OC 1BQQT 2JA6G 5HHDG 4X3TA 4EGVA 1T3QA 1V86A 3GZNI 3I72A 2D2QA 5FO9B 4BZAA 2LJ5A 2QHOA 4LF8L 1LTTD 4LF6L 1HEZE 4JYAQ 3HOYB 1LXDA 1GKHA 4GN1A 3BZKA 4ZKBB 1KDBA 3NG0A 4LWCA 1YQ4B 4NQLB 4XT1B 4RHSA 3I8ZA 4PT5A 3ZRCA 4NDXA 4C3IG 4BKSA 4IUPA 4JYAL 3N1YC 2L0CA 4XYCA 1AYFA 3RNUA 1LT4D 2KWDA 4LJPB 3UIPB 1ASYA 4DK5A 2JA6H 3BINA 1AW7A 1WTOA 1O80A 2OQKA 1OFFA 1I3QB 1AN8A 2K05A 3PCOB 4IM3A 4EFOA 1JWSD 1K51A 1IL8A 1EFID 3KF6B 3CRLC 4BBSB 3QOJA 1G6PA 1GVPA 1BBUA 1TXYA 5CORA 1F2MA 4ID6A 1K83H 2JA7B 5EPKA 1ZE3D 2X69A 1X3PA 3MP9A 1Q8IA 1XJVA 3PO0A 2DLBA 4C3IH 4XTCS 2FUG1 1YNJD 2PW9A 1RKNA 1I50B 3EGRA 3A7LA 2ZT9C 4BWGB 5JHAA 1FXAA 4OL7A 3CF6E 1XYIA 3QWNA 4J1MA 3AH7A 3AEFB 2K39A 3NY5A 4EKUA 2NZ1D 1BCPD 4O42A 3NELA 3I4OA 2ASQA 1L0WA 3SVMA 3E5SA 5KHQA 1SE8A 4A3BH 1KHIA 1O7ZA 3AE5B 5EE9A 2KHIA 4DAVA 1A3TA 1TR5A 3N1ZC 2EY1A 3S9WA 1YJ9A 1IBXB 3S1RH 4AJYB 2CJNA 3S2HB 2P5ZX 4DHJD 1CK1A 1M8AA 2GBMA 2WXGA 2L3ZA 4GIVA 3KLWA 3S14B 2I07B 2GB1A 4WWMA 4A3MB 2LEKA 3KUCB 1KAWA 2EDGA 1Z7TA 4JIOU 2A5UA 2B63B 2KWCA 2B2VC 2KN4A 4KHPL 4US9A 2I2YA 4K8JA 1YJWA 1BUVT 4ANVA 1TU2B 5EKKA 1FVIA 1QVCA 5I6YA 2UXBQ 3BZCA 3P4PB 2PIAA 5C5MA 4HDQA 1KNEA 4WJWA 4GN5A 4CBVA 5FO8B 3CMAA 3H7PB 4H7BA 4CDEC 4BOZB 2EJGC 4HJ9A 4YSYB 1PTOC 4MIUA 4BA1I 2CH4W 3CQZB 5DM73 2I1JA 4M02A 3Q3FA 2UXBL 1SROA 1ILQA 3MA2B 1NI3A 4DR1Q 1WGDA 2NMQA 3L10B 3IHPC 3VH4B 1WXMA 3VUYA 4TQ0A 2WACA 3GS2A 4Q5VA 4GNXB 1LGRA 3OMGA 4WJ4A 1Z47A 3T4AC 1LTID 3WOFA 2E2DC 4DR1L 1JB3A 3HS0C 2RSUA 2KLCA 3DM1A 1CT1D 1GUSA 3HEJA 1PRTC 3OIPA 1OXVA 3I4LA 3I73A 4EQPA 2W9NA 2LI5A 1WCMH 3WAOA 4EQ5A 2EKIA 4IN3A 3TMEA 1RWSA 3HOZG 1HNWQ 5KHOA 3V60A 4BY1H 2KQSA 1JJGA 3Q3MC 4BFRA 4LK0M 2EJMA 3DCGA 2KTRB 4ZCKA 1BDOA 2EYMA 4NQKE 1XTCD 2KBNA 3RULA 1OQYA 1QQRA 5H8YE 1PH6A 1VQKA 4GDKB 1ZDXA 5AZFA 3DQVA 3IFWB 2K5PA 1HNWL 4FLHA 1SYEA 3KBGA 2K8HA 4YL8A 1XX8A 3QIAA 4WRDA 5D94A 5K36G 2D10A 4EQNA 1HZ6A 1YN5A 2BWES 1HZBA 3OJ3A 4P7IA 1LABA 3DEOA 5E6PA 3VR9B 1LFDA 4JQWC 5CHFA 1XCQL 2KHWB 4DUZQ 4WQMA 4FNFA 1I50H 3HOZH 4XQJA 4A8XC 1B2TA 3QJZA 2L0FA 5A35A 4A3JB 4OO1G 1S5DD 2Q2TA 1K8OA 4CO7A 5E1FA 2CR5A 1SLJA 2E3TA 4DUZL 3D6CA 4RM9A 1SNMA 2C60A 1CFMA 1L7YA 4YWMA 1XLPA 4B08A 2IX0A 4RNAA 1TTNA 3ZW3A 5K36H 1IYVA 4WIPA 3KDFA 4NP5A 1PLFA 2MBOA 4FN2A 2L9HA 4M8MA 5FJ8G 3VR3A 5IGBA 1SMYC 2AL3A 4CDFC 1QNUA 2K6AA 3QWZB 1DONA 1WFQA 4RGOS 1YNND 4P6VF 1BVSA 1IYJB 3D8GA 4JI4Q 3AEVA 3S14H 4W9KA 4RA8A 2KJXA 2E2IH 1VZ8A 1ESFA 3UI3A 3C19A 3RR5A 2PZTA 4JWSC 3GTQH 3NUHB 1GB4A 3A9KA 3TQYA 2NTTA 1X1MA 5ELNA 4KX6B 1XLOA 1UD7A 3Q14C 2M9VA 3AEBB 1PXUA 2QIEB 3W1GA 3ZNZB 2B2TC 4JI4L 4OHJA 1M90C 2K5NA 4LF4Q 1G291 3H8HA 2FUHB 3FILA 3VUWA 2JJQA 1N8RC 1ESRA 2DNEA 2XN9C 5FJ8H 3K58A 4LFBQ 2CJOA 3JVZX 2M0XA 3EN2A 4B0MA 4K0KQ 2KCMA 1M94A 2PZWA 2LVPA 4QIWE 3Q8AA 4FF2A 4LF4L 1WXSA 1ZPSA 2LGIA 4X57B 5ELOA 2BA1A 1O7IA 3F1ZA 4RGMA 3ETRA 1TWGB 3VH3B 1YN3A 3R3OA 1TY2A 4LFBL 3DHGC 4K0KL 1CKNB 3RN2A 4B0EA 1FIQA 1QKZA 2OQ0A 4M0WA 4A3KG 2VB3X 2ZVNA 5LXHA 3UQBA 5IT9c 4PYZA 1KD1C 5IP4D 2ZCBA 4OX9Q 3IAS1 2O2VA 5EE0A 4CKBA 2FCSA 3VVWB 1JQ4A 1VQ8A 1KABA 3J80E 1VQDA 2LSSA 3FP9A 1CQFA 4GOPB 4LNNA 1VQFA 4AUQC 3TBLD 4DAYA 3KVFB 3W3AA 2VL6A 5C0XG 4C1NK 5C44B 1AZQA 2WYQA 3P1MA 5GXGB 1IKLA 4OX9L 2JSOA 4IOAA 4QAYA 4YCVA 4G11A 3PO3B 1C4PA 3B2GA 4JI7Q 2Z8LA 5I4DA 4MELA 4FHJA 4B95A 2E75C 3NTKA 2FFKB 2K1FA 5M3FG 1A15A 2K25A 1SNQA 2VQFQ 3C2PA 5AUIA 1JWUD 1E7PB 4FULA 2IL8A 4NAMA 2BB6A 1PHJA 4JI7L 3HOVB 4HJ7A 3RZOH 3WCQA 4NNJB 1C9FA 1LYLA 1HQMC 4DR3Q 2AMCB 5C6AA 4LF9Q 4FF3A 3HOUH 4IFDI 2N4FA 3DHQA 2O5IC 1SAPA 3U4ZA 2VQFL 1WXQA 2AQ2B 5AFWA 5IGFA 3S1NB 3JC66 2RDBC 2R93B 2XGTA 4R9WA 2GBKA 1WFYA 3MC9A 2RPQA 3LYYA 2MBBB 1BCPC 4LF9L 3IL8A 3CC7A 1PZID 4GLXA 2GA4B 1KTKA 2HQEA 4BKSD 2SOBA 3RLOA 1PTOF 1XMOQ 1FRDA 2Z9HA 3G7LA 3BYTB 3J9CA 2HCCA 2ES2A 1TKEA 2PKOA 1E0ZA 2J7ZA 3RMKC 2B2WC 2EELA 2M8SA 3RCZA 3V62A 1T5XD 3NS1A 2WAQE 1JWBD 3H9DA 3PPAA 4A20A 4K3BA 2F0EA 1V97A 2NPTB 4DR2Q 3CSFA 1XMOL 1FGUA 1CKOA 4NB3A 1E3PA 3I9V1 1UE6A 3NK9A 1KAAA 4DNRB 3TP8A 2LASA 3Q3NC 4XGAB 2Q2UA 1WTPA 2NVQB 2MHVA 2LY7A 4N6EB 1PRTF 1LTBD 1SE2A 4IUVA 5BN3A 3W9CB 1X3GA 3J80L 2K6DB 4ZUIA 1K53A 4B3SQ 3D32A 1K0SA 2JY6A 2MP2B 3VYUA 4K6DA 4RCNA 3NHEB 4ZRJA 1DOMA 2DY8A 2KQ3A 1J5EQ 1HTQA 1DGSA 3I4MG 3I3CA 2L32A 4Y52H 2KC2A 2OEOA 3DWAA 5EBDA 1HRJA 3KW5B 4B3SL 2KMCA 5T1IA 4LDTB 2W54A 1PDQA 3EBEA 4ZAIA 5ELBA 2EPBA 4LUVA 3DVNU 1KDAA 4A75A 2F0OA 3OAWA 1OXSC 3K5MA 3IFDA 3WA0A 2V3PA 5J2RA 2Z4IA 2LRWA 1W6KA 2VB2X 3FKIB 3W2DA 1XPRA 1LM0A 3PSIA 1EEID 3M7GA 4LMQD 3ML9A 5ELCA 4BVUC 2CU3A 1NMFA 4POFA 3L0WB 1WJ6A 3AE1B 1NUCA 3NWSA 4IUUA 3AXCA 2D5DA 4ICUA 3S16H 5M5XH 3QG1A 1EY8A 3NUCA 4LNKA 3GTPH 3PO3H 4O1NA 3F8TA 2GVBA 2AYOB 4BY7B 1KL9A 5JEAH 1S5CD 2L1BA 1WIAA 4IALA 5IODA 2VW9A 2F0WA 3OW2A 1T0RC 1ZXIA 1S72A 2M17A 1T6BX 2EYPA 3F2UA 3GD7A 1STBA 2HDLA 1A62A 2RA4A 5EAYA 2XRSD 3G71A 1ZUD2 4ZYSA 2MJDA 2WNMA 3HOVH 1JC7A 2ID0A 1IW7C 1P98A 1YNXA 3C8YA 4XDCA 4PMWA 5IP7H 3JAME 1ZDVA 3AU7A 1K9MC 1SNOA 4C2MB 5CV4A 1V49A 2O6VD 2BGFA 1C79A 1JW9D 2V3SA 1WXAA 3WAMA 4QIWB 4S3SA 1TZ1A 3DBHB 1KFYB 2MBQA 2OTLA 1STAA 1D1IA 2KWVB 1SSNA 4N9TA 5CV9A 3RN5A 3M4QA 4IO9A 4MM3B 3PRPB 4YXDB 1DOXA 1PFBA 2Y0SG 2BDNA 1QOHA 3HZXA 2Q8TA 4OXPA 4P72A 3ZJYC 1WTVA 4DGZA 1KRHA 2D3AA 2PE9A 1A3UA 2INPE 2FCQA 4K1RB 2J4XA 2M00A 1YNNC 2HD3A 4DXGA 3APDA 2B2TA 1KH0A 4MT5A 1I4XA 1K8MA 1A3VA 4DV3Q 4HIDA 4HKQA 2N9LA 1UELA 4RMAA 2DZKA 2ZCCA 3I91A 1KRTA 2F0DA 4DXAB 1XPOA 4I65A 5C4HA 1Y8PB 3K59A 5M5WH 1V1OA 3TN2A 1T9HA 4ICVA 2KOXA 1GUTA 4TQUS 4KKSA 3V6CB 1EYAA 2F0JA 3P2BA 2EMSA 3PO2G 4A3EG 4NAWB 4HIMA 5KRUA 3H3VI 1TWHB 1X3EA 3JYUA 1A2TA 1V9JA 1QCBD 4ALPA 1D5XC 3U7DA 2HQLA 4YTMB 2KHJA 3SDZA 1ISNA 4LFCQ 3GE8C 4HCPB 4OVZA 1GO3E 3AU5A 4MEMA 4WWPA 3H3VH 4CHKA 2K01A 5IGCA 1BNZA 3A8KE 2N0SB 3AE9B 5AZGA 1F2RC 4KMUC 3CMMB 1KLVA 2L5TA 1FXTB 2QILA 1D6EC 2CQAA 5C4JB 3M9BA 3K5NA 1PH4A 4LFCL 1JORA 3OWFA 4KY6A 2FCMA 2CS4A 3FKIH 4A3EH 3PO2H 2UU7A 3JAML 3KYDD 2D3BA 2B2YA 3L16A 2PMZE 2AUKA 3AE8B 4NJ6A 2ZJDA 3U58A 2B3GA 4QF4A 1LTLA 3PV1A 4O2DA 4BBRG 1N34Q 2H4OA 2RBMA 4HKZE 1P0RA 3VUXA 5ISRA 1EQVA 4CQNA 3IT6B 3KLSA 3BDCA 3VR5A 2CKHB 4NY0A 4GOCA 3H91A 4JVZA 1NI2A 4GDLA 5CV7A 4ITKA 1N34L 2MEKA 2GLSA 4ABNA 3RUZA 3A56A 2KVZA 1E9MA 3J7AF 4HIOA 3S1QB 1I6HB 3N30A 2JF5A 4J8QA 5IOIA 5C3XA 4R4CA 5BR8Q 2ZJRA 5TSSA 1AE2A 3SDLC 3GTMB 1YX6B 5DPRA 5HI1A 1RODA 1C78A 5I2XA 2Q2IA 1SE9A 2DY7A 1Y1WB 2NCNA 3DBHI 3ZKJC 2B2UA 2F0HA 1TYGB 2K8CA 1D5MC 1J7CA 2KZRA 3MFYA 1VMCA 4P71A 2IDYA 5BR8L 2VNUD 2ZW0A 2MQJA 3NE5B 3U50C 2K0PA 3DBLB 2WP9B 1WI0A 1WJNA 2K7VA 4OIKA 2BYTA 4ZRKA 2BKFA 1QUQA 1HJPA 3EQLC 1K28A 2E8GA 2Z4HA 5IWAL 2JE6I 2MFIA 2A4ZA 2MO1A 2WXPA 2L12A 1WE6A 2D0PA 3RZDH 4IUQA 4C3HH 5JVH3 2CU1A 2B29A 5DNFA 3AEDB 2R61A 3AI5A 2F0LA 3A5UA 3W5UB 3V3XA 4M8NA 1XNQQ 4L2YA 2A6HD 3B6YA 3FMCA 3I4NG 3TP6A 5FR6A 1VQ9A 1E24A 1HR0Q 3SHLA 5JPMC 1KDCA 1YBYA 1BF4A 4N8FA 4WQOB 4W9EA 4HPPA 4FF1A 1F2LA 4PK1A 4N8X1 5ELEA 1XNQL 3RN9C 2KCCA 4NXNQ 1AZPA 3NPPA 5L83A 2KCTA 1VS0A 1HR0L 2HD5B 1I42A 5JPNC 2CW0C 3LNNA 2N8NA 2BS2B 3W1SC 2DX5B 2IZVB 3EIVA 1WTRA 2DNFA 2G45B 2EY2A 1SE3A 1YVCA 5CGKA 4HMIA 4XC2A 1N61A 4NXNL 4K2LA 3E0EA 1L0YB 3I4NH 4GKKQ 1WRIA 2N3SA 3J7ZC 3CMEA 3GTGB 2FBWB 1PDXA 3TEYA 1SDFA 1ZP0B 1IPGA 3LGJA 2D5GA 3DBSA 2IO2B 3NZ3A 2BH8A 4FVMA 5C4JH 3CCMA 3QB3A 2JX5A 3A4SC 4FO2A 4JGHB 4GKKL 4C56C 1IBMQ 1EF5A 1SN8A 1WOCA 3OYYA 4IKGA 4LUOA 1TWAH 2F3IA 3J80i 5I9PA 2E6XA 3MZ5A 2MH7A 2WXKA 1MIUA 1X6OA 5KNCA 3TDQA 2F52A 2LUMA 2FHTA 3PUVA 4RH6A 2JA8G 3NSWA 1H4RA 3VRAB 5D6JB 2K5VA 4V0BA 1IBML 2HE7A 1DOYA 1K0RA 2J0TD 4IUMB 4II3B 2RCNA 2NVTH 2JA6B 1LV9A 3PV0A 4G3XB 4N58A 3A54A 3M85A 2AQ3B 3CCQA 5G55A 1WMHA 3AFPA 2BQQA 3Q69A 1KC8C 1S40A 3E3XA 3T51B 4LNFA 1FL0A 1VQIA 3GDEA 3K8AA 4DNIA 1PA6A 2G9DA 1K83B 2LXKA 1SB3C 2JT4B 2JA8H 2BYEA 2KHSA 5C3EH 2LRUA 3ZNGC 4RF1A 3ZGZA 1YZ6A 4GN3B 4OEMB 5CBEE 4X64L 1UWXA 2YU9H 1OTRB 3DBLI 1LTRD 2EY5A 4RCOA 3T1YQ 4C3IB 2I0QA 1GG3A 4EZKA 1WGGA 1MHXA 5FLMG 2HDEA 4KZCA 4PS7A 3WANA 3AE7B 4A3CH 2QKIC 3C3LA 2ZPNA 4BS9A 2A68D 3T1YL 4MH0E 2XNAC 1EWIA 3CHBD 3EROA 4M1UB 3DHHC 3L54A 2MUYA 5H1SE 3UGBB 5IYDH 1WI5A 4OW0A 3I7FA 1I4PA 3IT4B 2KNBA 2L8JA 2LGDA 3QIJA 4BKGA 1N9WA 4G57A 2JYOA 3AE2B 4JPSA 2PMZB 1U4PA 1TJEA 3S1RB 2IW3A 3P1HA 1AH9A 2PZUA 3ONSA 3M3YH 4A76A 2PJHA 3APCA 5BYRA 2C5CA 1VQ7A 3FAHA 3STBC 2CWAA 5NUCA 2FNJB 2RR9A 3A9JA 2ALYB 3U9OA 2R92G 3U7ZA 2PVOD 1WSPA 5IOCA 1SYFA 1FMAD 1YEZA 1NR2A 4W9DA 3MHSD 2V1YA 3GV6A 4R1JA 3N32A 2LXAA 4UY8C 1F2YA 1K73C 2KDEB 1Q81C 4L5TA 5HKHA 1YD8U 3NVVA 3PUXA 5FK9C 1TIID 2OCEA 2DWQA 3SHQA 1YMHE 4DAMA 4BBNC 4KKTA 1WZ3A 4A3GH 1N32Q 2BE5D 4X6AH 1MJDA 2RPVA 2XBBC 1V5TA 4L1BA 2GN5A 4JOIC 2R7ZH 4IURA 3QQ8B 4WAFA 4XX5A 2A5HA 1AWDA 4P1CC 2PYKA 2XWJB 4C4VA 1W2BA 1IUEA 1EWYC 5IIFA 3CCJA 1JALA 3TIXA 2JPHA 1EWCA 1PFDA 1ZYRC 3KJOA 5LMUQ 1N32L 4LLGM 1JE4A 2OT2A 3RZWC 4GLAC 5CV6A 5G3LF 3NZSA 1XWEA 2WDRB 5DM63 1C4AA 2FAZA 1MSHA 3S24A 3K9PB 4FXCA 5LMUL 4LDTD 1WCMB 1WVLA 3S1MH 4GNXC 1HCZA 1SGHA 2O6VB 4E3CA 3BDOA 1NYQA 3DWQA 3NS8A 1UGJA 2DZMA 1VDZA 4BY1B 1WH3A 4P1BC 1RCVD 1STGA 3AN1A 4MDKE 2LFNA 2ZTCA 4K5XA 3CF5A 2GMIC 2QDBA 3JAMi 2OJWA 4GGQA 4TQ1A 1XF5L 3B0AA 1SR3A 1CHPD 2UWQA 4V190 1U4MA 3HGBA 4DR5Q 4JI2Q 1S1QB 2IHFA 1WRDB 5IGDA 2I5LX 1WGKA 3VR6A 1FCLA 1VQLA 4KDIC 3HOZB 1QF6A 2F0SA 3CCSA 1ZXHA 5JAVA 1KF6B 4IPGA 2VZKD 3R66C 4YY3Q 1GC6A 1T0SC 3CCRA 2NBWB 3CC4A 2W3SA 2V1CC 1VZ7A 4L23A 2IY1B 3MXGA 4DR5L 3DWGC 3H94A 4A3FG 2WXQA 2M19A 1ZXTA 3E9HA 1CZWA 2GRIA 4KKIA 3MTSA 4YY3L 1EIHA 3UINB 5GAHC 2F3VA 3P4QB 4AP4C 2WP8J 1SFOH 2RCFA 5EBCA 3UI2A 1JRUA 2CHXA 3ZTDA 4DR7Q 5IYBG 5HG2A 3AU4A 3VTVA 1JJ2A 4CJ0B 3DXJC 3BK1A 3NHHA 1EIFA 3OG5A 1U4RA 3GTKH 2E2IB 1Y1VG 2L7RA 2L4NA 3GTQB 3CAMA 3W1SA 2LGSA 2WKCA 1FPYA 3GTOH 2G3QB 4PG3A 3KDFB 1V1QA 5M9OA 1JOOA 1E8WA 4OVVA 2SNMA 4ZDVA 1T0YA 2BTEA 4FDBA 4G7HC 1UNSA 2D2CC 1ONLA 2EMTA 2KKCA 2OXPA 3RI7C 4RAUC 4LAAA 3NVYA 4KZ0A 3R7RA 2HHHQ 3M4PA 5CC4A 3A9KB 1VCBA 3QX1A 1FR3A 5K5PA 1X9NA 3BZDB 1WTXA 4CHTB 3W5OA 4F7ZA 4ARCA 2QGQA 4B3MQ 2HHHL 2OEDA 3FILB 1WYWB 1HPCA 2PPBC 3T3NA 4N59A 4LF7Q 4R3DA 1NSNS 2K14A 2QA4A 4ZHPA 1NVID 4L5RC 1SNPA 2G9HD 2ZJQA 4B3ML 2M0AA 4F88A 3FKYA 3AEEB 4HXDA 1FJGQ 2H1EA 3KJPA 4YTNB 2KO3A 1SYBA 2MO0A 2X6LA 3NWTA 4L5QA 4WFN3 3C1FA 1QJOA 2D11A 2YTXA 2MA9B 4W9CA 4ZOHC 1EFWA 4HCSA 4M0WB 3O13A 3Q8EA 3MFGA 1EQRA 1FJGL 3ER0A 2QJLA 1MSGA 2MJEA 4DV1Q 2O2VB 3FEWX 4F1SA 4FADA 1H8CA 2Z6KA 1ENFA 1WYGA 3DUZA 4K7UA 1N5XA 3I5JC 3WALA 3HVZA 4MNOA 5E6OA 1UEBA 4YWLA 1U4AA 2GBRA 2PO4A 4BBSG 4DAYB 4EUTA 4FJVB 3K5LA 5E7NA 5JJIA 2WX1A 1VDVA 4ANXA 3RZOB 4C80A 4ASWC 3SXHA 1QNKA 4DV1L 4B6WA 3HOUB 2WU5B 4I6PA 2KFKA 4DU9A 2ONQA 1EY0A 1F1HA 2K04A 4IZ8A 4XXEA 3X3MA 1H95A 1LTSD 1SEBD 1MHHE 1JE5A 3GOEA 3NOBA 1V8QA 1K8GA 3J81j 4LUZA 5M3FB 3IBEA 1D2BA 1DD2A 2SNSA 2CFMA 2ZXOA 4RKLA 1N33Q 2GOWA 2KMMA 4FXDA 4TKNA 1R4QB 4ME5A 5GADC 3BK2A 1C4QA 2VXWA 4DV0Q 2EVBA 3HOWG 4OO1I 3GV3A 1N60A 1Q10A 2Q5WD 2FINB 3AE6B 4REZA 3CRKC 3T3OA 1FRRA 1C7YA 3BU2A 1CI3M 1N33L 1SJED 1FCCC 5C3WA 3M62B 4W9HA 2IX3A 4ZRZA 1KOTA 4MN3A 4OO1H 3SR6A 2JWZA 3KK7A 4DV0L 4B9WA 1E1OA 4ZRIA 3F2DA 2EXZA 1TGZB 1VQBA 2I38A 2RHQB 1XPUA 3VXWA 1D4BA 3NVZA 3ZNHB 2ZXPA 4MSQB 4BXXG 1B50A 2R2OA 4DV6Q 2MSED 3QA8A 5COYA 3HOWH 1P7FA 5E3FA 3VYSA 2EYJA 4JOIA 1STEA 4EQOA 4YHHQ 1WX7A 4MJSA 2KA7A 5GROA 2AWTA 4DV6L 1WXVA 4L5SA 2SEBD 3M95A 4EX5A 4C3JG 3TREA 4H13C 2C9WB 5AJ3Q 3NBHB 2LGXA 4YHHL 1I35A 1W6JA 5LL6X 3OMCA 2WDVB 4B9KA 3VTWA 1JMLA 2XEWA 3D4RA 2HJ8A 2RHSB 4HMJA 1EYDA 5D3IB 2KVRA 3LB8C 3MTNB 3ULLA 2F4IA 2LJIA 3PRZA 4JWUC 5JXVA 1SF0A 2RVLA 4FF4A 1UE7A 2CHWA 3ND9A 4G7OC 1C1YB 5IAAC 1PH2A 4P74A 5M3MG 1PZKD 3R3MA 3H3VC 3I4MB 1FFVA 1Q3LA 2K1BA 1RJTA 3J81c 1RRBA 1E2WA 3S16B 5M5XB 1VLBA 2JA9A 4KKUA 3AMZA 3GTPB 2KC1A 4FA6A 2BDOA 2F0MA 3EFXD 1DJRD 2R7DA 1F52A 5E4XA 4E74A 2YVCA 4A3KH 1SRUA 1HUMA 1KRSA 1SSOA 3T1HQ 1Y8RC 3OOCA 1ICWA 1BKBA 5C0XI 3BY4B 5A2QL 4KY5A 5IT9E 3F2CA 2KTRA 3S17H 1B9NA 5GMVA 4XYOA 1HTOA 5MPOA 3CD6A 1NAPA 3SK8A 3PGZA 2E2HH 3ULJA 3Q2AC 5C0XH 1YNJC 2DN8A 3P7JA 1FNUA 4OWWB 4CKCA 2VZAA 2H5XA 3A7AB 1TKYA 1RYJA 5J3BA 1N36Q 3VTUA 4GU2A 2LGYA 4C1NI 4KIKA 4A3JG 2ICIA 3S15H 1OGWA 3Q8FA 2WXMA 4DR3L 4WJ3M 3SK6A 2JU6X 3OPOA 5DEHA 5M3FH 3KLRA 1YN4A 2J7QB 1WTQA 1KJTA 2BOSA 2WXRA 1WGHA 1N36L 3ULPA 2IBIB 4ILWA 4KGRA 4APVA 2EJFC 5D3DA 4CJ1B 5FLXc 2Z0SA 1OXTA 3QOLA 1IBKQ 2F0UA 3RMHA 1QZGA 2N9KA 2JZZA 2B39A 2KDFB 1ZKHA 4ZHOA 2MJ3A 3A1QA 1EY5A 5IA7A 1PMRA 1L6UA 2FIFA 1TKGA 2B2VA 2ZPYA 2FMMA 2PE6B 3D31A 1IBKL 4H0LC 1GUNA 3ZXVA 4A3LG 1GUWA 3HG9A 3EA6A 1WGYA 4FHKA 1N5WA 4MACA 5FR3A 5G3LD 2WXNA 3SK4A 4DR2L 5DCNA 4TRDA 1TS2A 2INDC 4K7SA 4A90A 4BA2I 3MXNA 5M5WB 1RFAA 2YEPB 1K3RA 1B3QA 4XDXA 4MTKA 3GTLB 4XYQA 4C00A 3A4RA 1Y8NB 3N1XC 1HE8A 2NN6G 5I6WA 3X23A 2XSCA 5C0XJ 4IDIA 5JVG3 1UBIA 4ZK9B 1HTPA 5E6NA 4MGKE 1GB1A 3GQBA 1MD2D 1D3ZA 2Z59B 3ZUNA 3RNBC 4YIJA 3I56A 1VQ6A 4A3LH 2QDLA 4R4IA 1E2VA 1ACCA 1OEYA 3A74A 1PTOH 1VR9A 4HWIB 2F3WA 4DXFA 1YHAA 3NQTA 3NENA 4QCLA 4KKJA 4HK2A 1TZOA 3N6RA 5LHY1 3Q24A 2K5HA 1J5EL 1VJKA 4EEWA 1J0GA 5IT9L 5FO7B 5EE1A 2F0FA 3IFTA 1BO0A 3PO2B 4A3EB 2PQAA 3B2FA 2N49A 1EU3A 4A9AA 1ILPA 3H0GG 3OTOQ 4DR6Q 2LVQA 3LJ3A 5C3JB 4A93G 2ZNVB 4HSVA 3HM3A 2HTHA 3I4MH 1E1TA 1L4DB 3FC4A 4K5WA 2AUJD 4OELB 1F2ZA 4A4IA 5C44G 1G2TA 3DLLA 1GC7A 1DM0B 1PGBA 2MHJA 5IN7A 4DR6L 2DENB 4NW2A 3J7YW 4JBMA 2FCNA 1J8CA 3VA5A 2VZKB 1WJJA 2E2JB 2LS01 2PLPA 1DOLA 4YCUA 1K3BC 1A0IA 2DJGC 3D4WA 2F03A 1E6EB 2JYEA 4P73A 1XNRQ 4KD4A 1D1KA 1W3SA 5EE3A 4K2KA 4A93H 1VCIA 4Q2JA 4BBRB 1EF1A 3MEHA 3ZNID 1MJEA 1EY4A 4KTAA 3KYCD 4GDLB 4DK1A 3GTJB 4J15A 4DUYQ 4NMZA 3ONAB 3H6NA 2FJ2A 3T53B 5F2DA 3QJYA 5LXIB 3UIOB 3C1EA 4J3OD 1V81A 1C9OA 3EECA 4JI3Q 2NUCA 2A69D 1MFWA 1PUTA 2IO1B 4NZLB 2F0GA 1YITA 3D4DA 4ZKCB 4LNIA 1LTAD 4DUYL 1TS4A 3NBIA 3AMUA 3B9JA 1CHQD 4X3KA 2ZM6Q 1AP0A 3HIZA 3UDGA 1IGDA 4XDDA 1GM5A 2I1KA 4K3CA 3GP7A 5HURA 1OEYJ 5HFYA 4JI5Q 3RZDB 4HR7B 1JR0D 3SFDB 4C3HB 1TS3A 2CH4A 4YWKA 1O7YA 1ROEA 2ZM6L 4HJGE 5J18A 2IGGA 2PW7A 2NVXH 1JCKB 3CCVA 3PF5A 4IJHA 2J52A 1QUQB 3MJWA 3TEZA 3X0WA 4GLSC 3QC8B 1STHA 2RDHA 3PSEB 1EYGA 2BKRB 3VA7A 4A3DG 2HJ1A 3HFZB 1H9SA 3AM9A 1U9RA 3UE0A 4ZRPA 2PPHA 3Q3OC 2A73B 3ABVB 3GTLH 3PS6A 4DV3L 3VHTC 1HFGA 1SYGA 5J39A 3L7ZC 1MI0A 4RG1A 1L1OC 3GO5A 3SE0A 1QZEA 3SK5A 2CKZB 1BBXC 1EEFD 2JQOA 3RUIB 2OTJA 3FHWA 3BDLA 4UP7A 3I4NB 3QARA 2W55A 4WJOA 1VMPA 3K7UC 1B53A 4HJ8A 2F0IA 2WXLA 4A55A 3TS2A 1UZXB 2C7HA 2EYLA 2G4SA 4ACFA 4LJOB 1RTNA 3T56B 5G5HA 2JEBI 4CKEA 4K7WA 1TWAB 4AYBG 2EYFA 1BCPF 5C5LA 4B3RQ 4JC0A 3CPWA 1LT6D 3UDIA 2KEEA 3A33B 4AIMA 1PYSB 3TJPA 2RSNA 1EUVB 2F0NA 4TMAB 2JQRB 3TUOA 3BWUD 1WE7A 2A6ED 2QEJC 1C48A 1J8IA 3VYTA 4BY7G 2NVTB 4B3RL 4HRSA 2E2JH 5KGUA 2K03A 2IGHA 2KEDA 3KLSX 2INNE 2YTYA 2N88A 2WB1G 2F0TA 2MJ8A 2QMTA 1VF5C 4AJWA 1PH7A 2WXFA 3KUDB 3ZVVA 2MPMA 1L0XB 2JXXA 3ZLZA 1VQCA 3TCAA 3DEPA 4BBRH 1UBQA 2JA8B 2ENBA 5C3EB 1YJIA 1IZ6A 3GTJH 2BW2A 5AEKB 2YU9B 1EYCA 1HZCA 1NE3A 3LWUA 4GKJQ 1WMHB 3BVMA 4P75A 2F0PA 1EZ6A 2PVGC 3ERQA 1Y8OB 2GBJA 2B2WA 4XWTA 1SYCA 3I70A 5KIXA 3U4EG 4POGA 1DZ1A 4HPMB 4XE0A 4DA2A 5D2MB 1V1PA 4GKJL 1P3QU 3RNEC 1EOTA 3TEWA 4YWGG 4LW1A 4DFAA 3AULA 2NYZD 3PQIA 1DOKA 3I3TB 1UH6A 2NZHA 2RDFA 1KIXA 1X3QA 2AKWB 3VQIA 4MM3A 4W9IA 4N9PA 4A6QA 2J42A 3N20C 1R7SA 1M4VA 3L9AX 3M3YB 1B7YB 1UWVA 2QC8A 1G8ZD 4DAPA 1Q1BA 3KOJA 1VQGA 4GS3A 1HNZQ 3AQQA 2WWZA 1FNWA 2JA5G 3I57A 1S5BD 2FIDA 2NB0A 4DQOC 4JLCA 4HROA 2MGSA 1NNXA 2VRRB 4RGNA 1SE4A 1WGRA 1I4GA 2KX0A 1K52A 2IHEA 4C7ZA 2KK8A 5IYCG 5GQOA 4NXMQ 1PYBA 3FPUB 3PRMB 3N52A 1VQMA 3QAQA 5G2NA 3KWVA 4MH8A 2HDMA 1PH9A 4IM0A 5C4XG 3A9JB 5AZHA 1JB7A 2JWUA 3H15A 1C76A 4NAWA 1GJZA 3PHXB 4FXGC 1V8CA 2L55A 2I5HA 2BVCA 2J0KA 4A3GB 2WQYB 3EJIA 4JCVE 2KQ7A 4NXML 1FM0D 3H7SA 1ENCA 1F9RA 2R7ZB 3HK0A 2A8VA 3NTIA 3T9LA 4JX1C 2M1MA 2IX1A 2MLBA 4JE3B 2WXIA 2WFWA 1PGXA 3O65B 1HHVA 1X32A 4JI1Q 1RD9D 2JP1A 5IYCH 1DOIA 1L4ZB 2A19A 3AYHB 1PH5A 2YLMA 3CSTA 2VUMG 2C35B 2LFIA 1YQ3B 3NJTA 2EQSA 1EIYB 1Z6HA 1WJUA 2XVSA 4URKA 2EY6A 3R2IA 4W9LA 2WLBA 4H2AA 1PH8A 3IG3A 2VQEQ 2WAQG 4C4VB 1VF7A 1PTOD 5LMNW 4JI1L 2K33A 5J1ZA 1HXYD 1XTDA 3S1MB 2JUOA 4GB9A 4LNOA 1GHJA 3W5VB 3MHBA 4RGTA 1YX5B 1ICFB 3R7QA 3ERSX 4HPLB 2SAKA 2C7MB 3L17A 1BMLC 4GZYC 2VQEL 3RPFC 2PCFB 4XQNA 2G4DB 2DAJA 4HN7A 1QOAA 2ZW1A 2VUMH 2N9PC 3H1UA 2LMCA 3P42A 1NCVA 2R6GA 1R4MI 2B8GA 2A1AA 1STYA 3PMFA 3V96A 3DVGY 1YHQA 1PRTD 1Y1WG 3T8MA 3QHTA 2D3CA 4ARIA 2C5LC 1IGCA 1EY6A 3K57A 2J0JA 1YOVB 5G5GA 3KH0A 5I9OA 2XRQD 2A69C 2WXOA 2NS5A 2AWNA 3URYA 3ZJVA 5KYLA 3R93A 1C3TA 3BS1A 2JVCA 1OO9B 1TWFH 1KXLA 1LQBA 1B1ZA 1H9MA 5BMIA 1EOVA 1Q86C 1MJCA 1RLFA 4EE2A 4YSZB 3TS0A 3NTHA 3A8IE 1MHWC 3MHZA 4DNTB 1SFOB 2GI9A 3RNCC 4DV7Q 1HZ9A 1WJ4A 1CSPA 1Y56A 5FLMH 2Q2HA 3VAWA 4RHRA 2XK5A 4DBGA 2PNHA 1KLGD 3TP5A 1R9TH 3B08A 2F1MA 3HRZC 5BMHA 2DAFA 3HOXG 2KACA 3GTKB 1N6ZA 4G7ZC 2KYWA 3DPDA 2D9UA 4DV7L 5JH5C 4HJKA 1L1OA 1LTGD 3GTOB 5M5YB 4IWOA 4LTUA 1Y14B 1I4RA 1EM7A 1G2SA 4RKBA 2G1EA 3VR4A 3AECB 1GUAB 3K6OA 1Y69U 1IKMA 4OIJA 3PUZA 1JQYD 4K14A 1RTOA 1S3OA 4UHVA 2N7DA 4CDDC 4IWQA 4LK1C 2F4VQ 1E7ZA 2VH1A 1SMYD 4NPNA 4JK1C 4Y7NH 3VYRA 5C4ZA 3HOXH 1F2RI 1JWAD 2PNRC 2B3AA 3ZJUA 4PZ8A 1PVOA 4XIGS 1WX8A 2C7NB 2R92H 2LZ6A 1SXTA 3M4OB 2REXA 4KN4C 5DPTA 3S2AA 4PNYA 3WDNA 3P63A 4J6IA 2MWSB 2AQ1B 3UDXA 3I63C 2CHZA 1WYDA 1S5FD 3ML8A 2DGYA 3MEFA 1Q82C 3MWYW 4JL9A 4R4OA 3HKZG 3VDZA 4JBJA 4WWOA 1PFSA 3AFQA 5EQ0A 3U4VA 4AH6A 2JYTA 1C77A 3T16A 1A63A 2NBUA 1X3FA 1EL0A 2INCC 4GSWA 3IRBA 2H89B 4IPCA 4DKAC 5C2TB 3PF4A 4DDGD 5JZEB 1RHPA 3LDZE 2PI2A 4HCEA 5EJWA 1SJHD 4IPHA 4HAEA 5CHWA 1IXRA 3G6JB 1E7VA 5BN5A 3E9SA 3RD4A 1GAQB 1Q46A 4AOFA 2V3NA 5DPWA 2DYMA 1GXDC 2ATWA 2AHOB 2LVOA 1OTCA 3G6EA 5EPLA 5KYIA 1N62A 4PMBA 2HUGA 2JZPA 3K9OB 1JT8A 3N9YC 3L4PA 1UAPA 4O0AA 2FXQA 2IO3B 3TBIB 3S2DH 4Q0FA 1HZ5A 2AL6A 1U0LA 4X3UA 2WXJA 1E2ZA 3EVQA 3CCLA 3NRZA 4NKLA 2Y5BB 4KK7A 4YTPB 4JI2L 1L0VB 2YTVA 2ZTEA 4AQYQ 1IYFA 4KLKA 5E4WC 3Q22A 3QCAA 4ZQ3A 2KFKB 3BVGA 4A3BG 4A3PA 4E71A 1NMGA 3PZDA 4A3IG 1XCTL 3TZUA 3J7AV 1C4CA 2N9XA 2V9HA 1BR9A 1HFNA 1IHZA 1WM3A 2NVYH 3N3KB 4AQYL 4RF0A 1V5OA 2R3ZA 1WX9A 2A6HC 5CV8A 1GNUA 1LT3D 3PGEA 1WTHA 4ULLA 2V4DA 1PQSA 2WDTB 3Q23A 1VD2A 3NZUA 3Q6SA 1Z5SB 4A3FH 1FO4A 1YIJA 4H02A 4DR7L 1AEXA 2Z0EB 1KLUD 4H44C 4EOYA 5EKIA 5M5YH 4DPGA 3NXWA 1YJJA 2LHEA 1FEHA 3WIMA 3U52E 5CX3A 4DK6C 1NBFC 1RDPD 4A3IH 2B76B 3OW7A 3CP0A 3KF8A 3HOWB 4ANUA 1F9JA 5IP9G 1Q7YC 2MQHA 5IYBH 3V2TA 3JSVA 1X54A 1EQTA 5IY0A 1K8AC 1WY8A 4TUUA 3MXUA 2UXDQ 4UDUC 4KHPQ 2Y5CA 4IG7B 4CJ2C 3HVDA 4MSMB 4IC7B 1Y1VH 3PIO3 2N7EA 2BS4B 3M4OH 3PREA 1RFKA 1PYWD 3B1LX 3Q8DA 4WAAA 3C46A 2TSSA 1O7LA 4TV3A 2JN4A 1S3SG 4DDID 2LXJA 4J6HA 2MP1A 2UXDL 3EC8A 5TR5A 2ZXRA 1SIFA 1XQQA 3PIOA 4F8CB 2K28A 4MJSB 2UU9Q 2KX3A 2L52A 3Q6BA 5IP9H 4K8IA 3HOYG 4HJAA 1SNDA 3QK0A 1U4LA 1PV4A 1ZKOA 5GAGC 2W82A 4RMFA 2IT1A 1QZHA 2E74C 5DLQE 1VQ4A 4LF7L 2QW7A 2I46A 2UU9L 4C3JB 2M56B 1WCMG 4YT0B 3CCEA 4II2B 2E76C 4TSSA 3ITPA 2D0OA 1TBEA 2HTME 4I7AA 1NDDA 3UF8A 2RGFA 4BY1G 4JV5Q 5IE8A 3HM6X 5IGGA 2LKVA 2WIIB 2Y0SE 4A3KB 1CZPA 1FD6A 2O6VA 1L2NA 2PEAA 1RL2A 2UUAQ 3HOYH 4XZ4A 3SFEB 4GOPC 3OLMD 1FXIA 5CV5A 2JA7G 3S17B 4WJQA 1PFMA 5M3MB 4JV5L 2NBFA 5EGTA 2B8FA 2X38A 3KF6A 2E2HB 3FRPB 1SMXA 1HQRD 3NP8A 2UUAL 2JSVX 1D8LA 1E5WA 1OQQA 1GD7A 4DHZE 1ZGUB 1J9OA 1QE6A 3S15B 5J17A 4DV4Q 2A68C 1VQOA 1I3QH 4F7XA 3DOWA 1EQQA 3CWIA 1D5ZC 1CKMA 4KSKC 1F9PA 1DXMA 4F87A 4WJNA 4W9GA 4BBSH 4BBNF 3SEBA 1E0BA 3H09A 4I6NB 3I55A 1KM7A 2JA7H 1OQRA 2BS3B 5HY6A 1H9JA 4DV4L 4X3SA 1IW7D 3ZO5B 1XT9B 4KIKB 3A8JE 3BYYB 5A2QE 1C0AA 1V6EA 2LD9A 4G50A 3K0XA 2OHFA 4LFAQ 3LWEA 2DJFC 1YIWA 3KQ4A 4G0NB 1J7AA 2PQEA 1IBXA 4NJ7A 3LX0A 4E6IA 4A3MG 2DZIA 4FBJB 2BWFA 3KWLA 2KMAA 2F0QA 4AYBE 4LFAL 2MCNB 2E5LQ 2B63G 3IKJA 1Q5WB 3A1QB 2EIFA 4OGQC 1B9RA 3I2ZA 2DYOA 1AFPA 1WTWA 2KWUB 5FOBB 2JXMB 4LJZC 1YJNA 2E5LL 1C8CA 2QSDA 1X65A 4IQZA 2K5DA 3S2HH 1J19A 4JG2A 2BE5C 3DMUA 1BT0A 3MXNB 1HZAA 3TZDA 1EU4A 2WB1E 4A3MH 1XO3A 1PTOB 3Q3JA 3H7PA 3QO2A 3ZQ4A 2D62A 2JEAI 4WORA 4DK0A 2B63H 3OJ4B 5CTRC 1UGMA 4BXXH 5EPJA 2KJHB 2BT6A 4OWTB 3A5ZB 1XMQQ 1HA5A 2IPKD 3EFCA 5J22A 4GNXA 3KUZA 1KQSA 3J80c 5AJ3L 4C7YA 3CW2C 3DWPA 2HIVA 5JJLA 2VH2A 2DZJA 4ME3A 3RNFC 4XWWA 1VQAA 1XMQL 4KN7C 3CQZH 4C3JH 1HNXQ 1PRTB 2CQOA 1JROA 4HSPA 4M01A 1OXUA 2DYBA 2XWBB 1U5KA 4MHEA 2PQAB 1Z2MA 1NBWA 4L8JA 5KNDA 2JXTA 4FJZA 3L2PA 2K22A 2R7FA 3W1BA 1MG4A 1HNXL 1Q1OA 1YI2A 1BBWA 2KAJA 2ZNVC 1QB5D 2EOTA 3H0GB 1II3A 3K81C 4A93B 1BXTA 3R2TA 1VRAB 5M3MH 5L95C 4XQQA 5CBAE 1JRPA 1O78A 4L63B 3HP3A 1V80A 3HOUG 4GDKA 1H9KA 2MBEA 3RNAC 3T1HL 4OZAA 3CC2A 5D7GA 4WH4A 3J81E 1G6ZA 2B2YC 1B9MA 1G6JA 1A2UA 4BKTA 3V05A 2K8BA 4PYUA 2Q8RE 1UE5A 2UUBQ 3SU8X 2KDMA 1ET6A 2KECA 4IFDG 2GVAA 5BO4B 2NWGA 3Q8CA 1Z9FA 4ZRQA 2BYVE 4NJCA 2K32A 2WU2B 1E22A 1HTLD 2ICEC 2KENA 2N1WA 4JW0A 1MPEA 2BBCA 1F0ZA 2KCNA 1WWTA 1TT5B 1ZOYB 4JPBW 3BJUA 2UUBL 1VZ6A 3WAPA 2K5WA 1M1KC 3FDTA 1E7UA 3VFKA 1LACA 1PH3A 3PUWA 4K6LA 4FYDA 1GJXA 3ICEA 1RM6C 1S5ED 1WR1A 2L76A 4A3JH 3K7AB 4JBWA 1QVFA 2NVXB 5FKAC 2JK8A 4GLVB 4IFDH 1T5EA 3TEXA 3CKIB 3K80C 2K75A 4D2KA 4KJNA 2CWPA 2DUDA 3MC0B 3KFUA 2B2UC 5KEEA 2K5QA 4N9F4 2V4LA 3EUB2 4K81A 3SGIA 1LO5D 5LLIA 3QR8A 2Y0SB 2I5MX 2YYZA 2CCZA 2PW5A 4UPAA 4PZ7A 1I7HA 2KANA 5FLXE 1R4NB 3DVGX 3G4SA 4I6LB 2OF1A 4EZLA 3TP7A 1HA6A 2IY5B 2OJRA 3ALBA 1V43A 2NTSA 2ZJPA 2DNCA 3ENEA 1H9SB 5BYQA 2TMPA 5CR3A 2RDGA 4PMCA 1GOZA 2RKSA 1EWHA 4DN4M 2NBVB 3U8ZA 4WJPA 2WKDA 4IUTA 4A3DB 5IKCM 2N55A 4DHZB 2NN6I 2A74C 4DWFA 3PUYA 3ZJTA 4RFBA 2L15A 4UAIA 3VR2A 1D7QA 1YJ1A 1EO6A 2WHIA 3L13A 5JHBA 4KSLC 3NBHA 4LNQA 1XD3B 4U673 3RNGC 1KNAA 1CMXB 1LT5D 1XXGA 2LWPA 3PHWB 1CKNA 2NN6H 1WM2A 1QT9A 1JJCB 2CW0D 4QY7A 3J81L 4YSXB 3IAM1 4IFDJ 4CDCC 3ZRFA 1T0QC 1UF0A 2K3UA 2UYZB 3EFUA 3ZDTA 3AEGB 3OTOL 1TWGH 2K50A 4R4QA 4GOPA 2BYFA 1NY4A 2KLGA 3PO3G 3VR8B 1STNA 3MVVA 2Y3AA 1GPXA 1FYCA 4KY7A 5JEAG 1V9PA 2ZVOA 2LXCA 3PVLA 1TIFA 3C0RB 1E8YA 4OZBA 4US8A 2OOBB 4BOSC 3P20A 4AYBB 1B70B 3H0GH 3DDCB 3Q8BA 3JAMc 1EUJA 1CA6A 1NR4A 4QJFA 3E56A 3HUIA 1A6XA 3HOVG 1CQVA 3UDFA 1I4QA 5IP7G 2WDQB 3HRDD 3K0YA 4IOCA 1DCZA 3VRBB 5C44H 1P7EA 1TY0A 1XNRL 5GAEC 2RMMA 5L37A 1MGSA 3BIID 1QOBA 1MG8A 2NVUI 3L08A 4IW0A 1CM9A 2R93G 2WS3B 3AB5A 3FVQA 2O4XA 2WXHA 4ZYNA 2WB1B 4JI8Q 5LL6S 4IM2A 1BCPB 1EIGA 5EKLA 1L2FA 1EY9A 1VQJA 1VQHA 5FLXL 2BCOA 1P8LA 2HIXA 2QF7A 3OIQA 2Z0DB 4M00A 3RFZB 4JI3L 2IY0B 4BAXA 3PLUA 2YEPF 4HIKA 4JI8L 3RYTA 3H6MA 4F8MA 2L1AA 3S1NH 1BUIC 3DBRB 3K7AH 2R93H 5DAUA 1CA5A 1V1PB 1V2YA 3RT3B 3SD5A 1N63A 3ZXRA 4M8AA 4JI5L 2NPTA 4DV2Q 2JZ3B 4DHJB 1QOFA 4IPDA 3UQAA 3J7A5 4DF7A 3V6EB 4ODGA 5JJZA 1R4NI 2BH2A 4DR4Q 5LNK1 1FD7D 3A0JA 3HKZE 4QMGA 2UUCQ 2N9EB 3WWVA 4X65Q 4DV2L 4I7ZC 3D6WA 1TVXA 2PI2E 5CYUA 1SYDA 1X55A 3CPFA 3EHVA 1Q12A 2UXCQ 4LCDE 4X62Q 4DR4L 4OZCA 4ANWA 2JRIB 1S4ZA 1JICA 3UE1A 2UUCL 1ASZA 3GE3C 2JA5B 2K52A 5JEAJ 1DYQA 3TEHB 4X65L 2MP2A 4FJYA 3STBD 2G5DA 1HUNA 1B44D 2NVQH 4A3DH 1FFUA 2UXCL 4S0RA 4PZ6A 4X62L 2AX5A 3M63B 2HCIA 2IWHA 1GUGA 3E0JA 4CYEA 1HR0W 3OWEB 2L0TA 1WF9A 4G4KA 3FKIG 1IP9A 4HDOA 1H9RA 4EVOA 3DWMA 2WGSA 4KV6A 1E90A 1QLBB 4WWNA 3WOEA 5C4XB 5CMDA 2VS1A 2J53A 2C9OA 4MGIE 2AWOA 4FXKC 1QILA 1Q90A 2WV6D 4IWPA 2IJ0A 1SBBB 4MGYE 4ZLTF 1L5PA 1HH2P 2L83A 1G51A 1XEEA 4LF5Q 3CU7A 4QUFA 4HEA1 5IGEA 1P16A 2K4KA 5KNBA 3OSOA 5D65A 3Q0AA 1F77A 4TKOB 4QB4A 2Q8IB 2IYDB 3MJ5A 1ZYRD 5CHVC 1ET9A 4NPSA 1VQ5A 2VUMB 4WURA 2D3GA 2WINB 3CXCA 2IO0B 4P2CB 4GXBA 4LF5L 2N78A 2WX0A 3CIRB 2ACZB 2KT7A 4JBKA 1B4OA 1TQOA 1EZ8A 4XT3B 3MAQA 2EE1A 2WAQB 2XTIA 3TSSA 2KDIA 3HHMA 2BA0A 2QCPX 3AB9A 3BG3A 4R8NA 2RQXA 3KUPA 3P4RB 3A55A 3D3RA 4GN4B 4BY7H 1QOGA 1R4MB 3NEMA 3PZ7A 1GUOA 2EYOA 2X6GA 3G48A 4QQBX 1L6VA 1TS5A 2BF8B 2J0MA 2KOLA 3AEAB 4KGTA 2LMCB 4PS3A 5DPSA 1P1AA 1E8ZA 1PZJD 1TWFB 2OWOA 3ZYYX 3M4YA 5BMGA 1ENAA 3PZ8A 3F2BA 3CCUA 1NYRA 1E10A 2MRPA 3DBRI 1JOQA 2MW5A 1A70A 2ASBA 3U30A 5D14A 3L0OA 2EXDA 4C2MH 4IUNA 1MI2A 4QL5A 4C3HG 4USAA 3E6ZX 4MTNA 1TT2A 4U68A 2SDFA 5JOBA 5I2YA 3DHIC 1RAXA 1XLNA 4KD3A 1R9TB 5IWAQ 4K5VA 4OONA 3T13A 1VQPA 4OWXB 4S17A 2KTFA 1Q8KA 2BPSA 2M2LA 1PGAA 3PLVA 3I90A 3JW0X 5H92C 5BN4A 2KFJA 4KDLB 1MKHA 1R4PB 3E9IA 3IAYA 1RF2D 1HNZL 4MGZE 3AE3B 4IJLA 1UWMA 2XK5B 1QVGA 3BVZA 1VQEA 2EKEC 1K8RB 3DVNV 1ML0D 3ZIMA 2N7JA 2K9XA 1OXXK 1SNCA 1FGBD 4KHVA 2L00B 4QGUA 4R8IA 1G91A 4Y7NB 1L1OB 2JA5H 3R8BA 2MNAA 4HVBA 3HOXB 1QG7A 3KYHC 2Z6BA 1WD1A 2KJRA 1AARA 2KXJA 3AE4B 2V0GA 2L05A 2R92B 4HTHA 2KN5A 4W9FA 5JJKA 4HLEA 1CSQA 3FPPA 1P9DU 3M7NA 2NR2A 2Y5PA 1E8XA 4JI0Q 1AE3A 2QDFA 4HCNB 2FE8A 3U9SA 2V4IB 4OVUA 4PS8A 1TWHH 1I6VC 2O2LD 4Z9CB 1PFNA 1EY7A 2RSOA 3P75A 5C4XH 2K6QA 3D0FA 1PH1A 4JI0L 1ZEQX 2CHBD 1IBLQ 2X8XX 4UP9A 4HJ5A 1Q1EA 1TWCB 1CJEA 2KDBA 4W9JA 3W1YA 1NTGA 1J7BA 4TVAB 1IYUA 1IBLL 1NEKB 2N1VA 2W3RA 4KGSA 1K50A 3KBXA 5HGTA 1RIPA 3GB1A 1JMCA 3HKZB 4JI6Q 1DGJA 3RD2A 3ZTCA 1GHKA 3GZNB 4GMVA 3X3NA 5C3EG 2KD0A 3P4SB 3IVFA 4X66Q 2GBNA 3J81i 3DM3A 3K5OA 4HEDA 1YNTE 2IGDA 5EDSA 2M4NA 1UEAB 3OHXC 2MBHA 1IL2A 2DBYA 2DHZA 3ZDMC 4JI6L 3S2DB 4UP8A 3PIP3 3PT2B 2EYHA 1JWMD 3ND8A 4FP5D 3VDYA 4A3CG 1LM8B 2RF4A 1WD0A 1SIJA 3M3JA 3NVWA 4X66L 3PTFC 4X64Q 1NJIC 4A3OA 1LLRD 5T1GA 2LHDA 2EZVA 3S1QH 3U2SC 1NENB 4ZUJA 1I6HH 4PV1C 3RLNA 1X56A 4QUCA 3PIPA 2ZEQA 5AUKA 5IYDG 1F9QA 1LUZA 2QEXA 4KV2A 1I5FA 3GTMH 2QCZA 1I94Q 5HGQA 2F0KA 2Z1CA 1Y1WH 2KUMA 2Z6KC 1JOKA 2NVYB 1ZW7A 3RZFA 1CZGA 5IO9A 2L11A 1A5RA 1MBYA 4EZJA 1WR6E 5C23A 2VY3A 1I94L 3MC8A 2AEHA 3ECIA 1I4HA 4A3FB 4AWJA 2KQ4X 2PTLA 2D07B 1F9SA 1MVKA 4A3BB 4CGYB 4A3IB 1BOSA 2H88B 1UUPA 1CTMA 3NQIA 2F0VA 2ON8A 4B3TQ 4DV5Q
chains in the Genus database with same CATH topology
1QWYA 4L6TB 3IXSA 2O5JC 2KVMA 1Y1VB 1B3AA 2PMVA 4B9XA 5E6JA 5BYSA 2FMCA 4RWSC 1TKWB 4KI0A 3MXPA 4P16A 4AS1A 1FNVA 3AV8A 2CVRA 2BB5A 5ELFA 5ELDA 4IOIE 3LXFA 4KHZA 4AQ7A 5T8IA 2XIWA 2A6EC 3SR1A 4KJOA 3RLFA 4PQXA 1XLQA 3L3OC 1BQQT 5HHDG 4X3TA 4EGVA 1T3QA 3I72A 5FO9B 1LTTD 1HEZE 3HOYB 4ZKBB 1KDBA 1YQ4B 4XT1B 4RHSA 3I8ZA 4PT5A 4NDXA 4C3IG 4IUPA 2L0CA 1AYFA 1LT4D 2KWDA 1AW7A 1WTOA 1O80A 1OFFA 1I3QB 1AN8A 2K05A 1JWSD 1K51A 1IL8A 1EFID 3CRLC 4BBSB 3QOJA 5CORA 1F2MA 4ID6A 2JA7B 5EPKA 1ZE3D 2X69A 1X3PA 3MP9A 1Q8IA 3PO0A 2DLBA 2FUG1 4XTCS 1YNJD 2PW9A 1RKNA 1I50B 3EGRA 3A7LA 2ZT9C 4BWGB 1FXAA 4OL7A 1XYIA 3QWNA 4J1MA 3AH7A 3AEFB 2NZ1D 1BCPD 4O42A 3SVMA 3E5SA 1O7ZA 3AE5B 5EE9A 4DAVA 1A3TA 1TR5A 2EY1A 3S9WA 1IBXB 2CJNA 3S2HB 1CK1A 1M8AA 2WXGA 3S14B 2I07B 2GB1A 4WWMA 4A3MB 2LEKA 2EDGA 1Z7TA 2B63B 4US9A 2B2VC 2KN4A 2I2YA 4K8JA 1BUVT 1TU2B 5EKKA 5I6YA 3P4PB 2PIAA 5C5MA 1KNEA 4WJWA 4CBVA 5FO8B 4H7BA 2EJGC 4YSYB 1PTOC 4MIUA 4BA1I 3CQZB 5DM73 3MA2B 1ILQA 1NI3A 2NMQA 4TQ0A 2WACA 3GS2A 4Q5VA 3OMGA 1Z47A 3T4AC 1LTID 3WOFA 2E2DC 1JB3A 3HS0C 3DM1A 1CT1D 1GUSA 3HEJA 1PRTC 1OXVA 3I4LA 3I73A 3OIPA 4EQPA 2EKIA 4IN3A 3TMEA 1RWSA 4LK0M 2EJMA 1BDOA 2EYMA 1XTCD 1QQRA 5H8YE 4GDKB 1ZDXA 2K5PA 1SYEA 3KBGA 1XX8A 3QIAA 4WRDA 5K36G 4EQNA 1HZ6A 1YN5A 3VR9B 1LABA 3DEOA 1XCQL 4WQMA 4FNFA 4XQJA 4A8XC 1B2TA 5A35A 4A3JB 4OO1G 1S5DD 1K8OA 5E1FA 2E3TA 3D6CA 1SNMA 1CFMA 1XLPA 4B08A 2IX0A 4RNAA 5K36H 1IYVA 4WIPA 4NP5A 1PLFA 2L9HA 3VR3A 5IGBA 1SMYC 1QNUA 2K6AA 1DONA 4RGOS 1YNND 4P6VF 3D8GA 4RA8A 2KJXA 1VZ8A 1ESFA 3UI3A 2PZTA 4JWSC 3NUHB 1GB4A 2NTTA 4KX6B 1XLOA 2M9VA 3AEBB 1PXUA 2QIEB 2B2TC 4OHJA 1G291 3H8HA 3FILA 1ESRA 2DNEA 2XN9C 3K58A 2CJOA 4B0MA 2PZWA 3Q8AA 4FF2A 1ZPSA 2LGIA 2BA1A 4RGMA 3ETRA 1TWGB 1YN3A 1TY2A 3R3OA 4B0EA 1FIQA 1QKZA 4M0WA 2VB3X 3IAS1 5EE0A 4CKBA 1JQ4A 1KABA 3J80E 1CQFA 4DAYA 3P1MA 3W3AA 1AZQA 5C0XG 4C1NK 5C44B 5GXGB 1IKLA 2JSOA 3PO3B 1C4PA 3B2GA 2Z8LA 5I4DA 2E75C 3NTKA 2FFKB 1A15A 1SNQA 3C2PA 5AUIA 1JWUD 1E7PB 2IL8A 4NAMA 2BB6A 3HOVB 1C9FA 3WCQA 1HQMC 4IFDI 5C6AA 4FF3A 3DHQA 2O5IC 1SAPA 1WXQA 2AQ2B 5AFWA 5IGFA 3S1NB 2R93B 4R9WA 3LYYA 1BCPC 3IL8A 1PZID 2GA4B 1KTKA 2HQEA 2SOBA 1PTOF 1FRDA 3G7LA 3BYTB 3J9CA 2HCCA 2PKOA 1TKEA 1E0ZA 2J7ZA 2B2WC 2EELA 1T5XD 3NS1A 1JWBD 2F0EA 1V97A 3I9V1 3NK9A 4DNRB 1KAAA 3TP8A 1WTPA 2NVQB 2MHVA 2LY7A 4N6EB 1PRTF 1LTBD 1SE2A 4IUVA 5BN3A 3W9CB 3J80L 4ZUIA 1K53A 3VYUA 4K6DA 4RCNA 1DOMA 2DY8A 2KQ3A 3I3CA 2L32A 2OEOA 3DWAA 5EBDA 1HRJA 5T1IA 2W54A 1PDQA 4ZAIA 5ELBA 2EPBA 1KDAA 2F0OA 1OXSC 3K5MA 3IFDA 2V3PA 2Z4IA 1W6KA 2VB2X 3FKIB 3W2DA 1EEID 3M7GA 4LMQD 5ELCA 2CU3A 3AE1B 1NUCA 3NWSA 4IUUA 2D5DA 3QG1A 1EY8A 3NUCA 4O1NA 4BY7B 5JEAH 1S5CD 2L1BA 4IALA 5IODA 2F0WA 1ZXIA 1T6BX 2EYPA 3F2UA 3GD7A 1STBA 2HDLA 2RA4A 2MJDA 2XRSD 1ZUD2 4ZYSA 2WNMA 1JC7A 2ID0A 1IW7C 4XDCA 3C8YA 4PMWA 3JAME 1ZDVA 3AU7A 1SNOA 4C2MB 5CV4A 1C79A 1JW9D 4QIWB 4S3SA 1KFYB 1STAA 1D1IA 1SSNA 4N9TA 5CV9A 4MM3B 4YXDB 1DOXA 1PFBA 2BDNA 1QOHA 3HZXA 2Q8TA 1WTVA 4DGZA 1KRHA 1A3UA 2INPE 2J4XA 2M00A 1YNNC 4DXGA 2B2TA 1KH0A 4MT5A 1I4XA 1K8MA 1A3VA 4HKQA 2N9LA 3I91A 2F0DA 4I65A 5C4HA 1Y8PB 3K59A 1V1OA 3TN2A 1GUTA 4TQUS 4KKSA 1EYAA 2F0JA 4NAWB 5KRUA 1TWHB 1A2TA 1QCBD 1D5XC 4YTMB 3SDZA 4OVZA 2K01A 5IGCA 1BNZA 3A8KE 2N0SB 3AE9B 1F2RC 4KMUC 2L5TA 2QILA 1D6EC 2CQAA 5C4JB 1JORA 3K5NA 3OWFA 4KY6A 3JAML 2B2YA 2AUKA 3AE8B 4QF4A 2H4OA 2RBMA 4HKZE 5ISRA 1EQVA 4CQNA 3IT6B 3KLSA 3BDCA 3VR5A 3H91A 5CV7A 4ITKA 2MEKA 4ABNA 3RUZA 3A56A 1E9MA 3J7AF 3S1QB 1I6HB 4J8QA 5C3XA 5TSSA 3GTMB 5HI1A 1RODA 1C78A 5I2XA 2DY7A 1Y1WB 2B2UA 2F0HA 1TYGB 1D5MC 1J7CA 3MFYA 1VMCA 2IDYA 2VNUD 2ZW0A 3NE5B 2K0PA 2WP9B 2K7VA 4OIKA 2BYTA 3EQLC 2Z4HA 2JE6I 2WXPA 2L12A 4IUQA 5JVH3 5DNFA 3AEDB 2R61A 2F0LA 3W5UB 3V3XA 4L2YA 2A6HD 3FMCA 3TP6A 3SHLA 5JPMC 1KDCA 1BF4A 4FF1A 1F2LA 5ELEA 2KCCA 1AZPA 3NPPA 5JPNC 2CW0C 3LNNA 2BS2B 1WTRA 2EY2A 1SE3A 5CGKA 4HMIA 1N61A 4K2LA 1WRIA 1L0YB 3GTGB 2FBWB 1PDXA 3TEYA 1SDFA 1ZP0B 2D5GA 3NZ3A 4FVMA 2JX5A 3QB3A 4FO2A 4C56C 4IKGA 5I9PA 2E6XA 3MZ5A 2MH7A 2WXKA 5KNCA 3TDQA 2LUMA 2FHTA 3PUVA 4RH6A 3NSWA 3VRAB 4V0BA 1DOYA 2J0TD 2JA6B 1LV9A 3PV0A 4N58A 3A54A 3M85A 2AQ3B 3Q69A 3T51B 2G9DA 1K83B 1SB3C 2KHSA 4RF1A 3ZGZA 5CBEE 1UWXA 1LTRD 2EY5A 4RCOA 4C3IB 1MHXA 2HDEA 3AE7B 2QKIC 3C3LA 4BS9A 2A68D 2XNAC 4M1UB 3CHBD 3EROA 2MUYA 4OW0A 3IT4B 1I4PA 4G57A 2JYOA 3AE2B 4JPSA 2PMZB 1U4PA 1TJEA 3S1RB 2IW3A 3P1HA 2PZUA 5BYRA 2C5CA 3FAHA 5NUCA 3U9OA 2PVOD 1WSPA 5IOCA 1SYFA 1FMAD 1NR2A 3GV6A 1F2YA 3NVVA 5FK9C 3PUXA 1TIID 2DWQA 1YMHE 4KKTA 2BE5D 2RPVA 4L1BA 4IURA 4WAFA 2A5HA 1AWDA 2PYKA 2XWJB 1IUEA 1EWYC 5IIFA 1JALA 1EWCA 1PFDA 1ZYRC 4LLGM 1JE4A 2OT2A 5CV6A 5G3LF 1XWEA 2WDRB 5DM63 1C4AA 1MSHA 4FXCA 1WCMB 1WVLA 1HCZA 3BDOA 1NYQA 3DWQA 1UGJA 1VDZA 4BY1B 1RCVD 1STGA 3AN1A 2LFNA 4K5XA 2QDBA 4TQ1A 1XF5L 1CHPD 4V190 1U4MA 3HGBA 5IGDA 1WGKA 3VR6A 1FCLA 3HOZB 1QF6A 2F0SA 1ZXHA 5JAVA 1KF6B 2VZKD 4L23A 2W3SA 1VZ7A 3MXGA 3DWGC 3H94A 2WXQA 2M19A 1ZXTA 1CZWA 2GRIA 4KKIA 3MTSA 1EIHA 2F3VA 3P4QB 2WP8J 5EBCA 3UI2A 5HG2A 4CJ0B 3DXJC 3BK1A 3NHHA 1U4RA 2E2IB 2L4NA 3GTQB 3W1SA 2WKCA 5M9OA 1JOOA 2SNMA 2BTEA 4G7HC 1UNSA 2D2CC 1ONLA 2OXPA 4RAUC 4LAAA 3NVYA 5CC4A 1FR3A 5K5PA 3BZDB 1WTXA 4CHTB 4ARCA 2OEDA 3FILB 1HPCA 2PPBC 3T3NA 4N59A 4R3DA 1NSNS 4ZHPA 1NVID 1SNPA 2G9HD 2M0AA 4F88A 3AEEB 2H1EA 4YTNB 1SYBA 2X6LA 3NWTA 4WFN3 4ZOHC 3C1FA 1QJOA 4HCSA 3O13A 3Q8EA 3MFGA 2QJLA 1MSGA 2MJEA 3FEWX 1ENFA 1WYGA 3DUZA 1N5XA 3HVZA 2PO4A 3K5LA 1VDVA 3RZOB 4C80A 3SXHA 1QNKA 3HOUB 2WU5B 2ONQA 4DU9A 1EY0A 2K04A 4IZ8A 4XXEA 3X3MA 1LTSD 1SEBD 1MHHE 1V8QA 5M3FB 1D2BA 1DD2A 2SNSA 2ZXOA 4RKLA 2KMMA 4FXDA 1R4QB 4ME5A 3BK2A 1C4QA 2VXWA 2EVBA 4OO1I 1N60A 3GV3A 1Q10A 2Q5WD 3AE6B 2FINB 4REZA 3CRKC 3T3OA 1FRRA 1CI3M 1SJED 1FCCC 5C3WA 2IX3A 4ZRZA 4MN3A 4OO1H 3SR6A 3KK7A 4B9WA 2EXZA 2I38A 1D4BA 3NVZA 2ZXPA 1B50A 5COYA 1P7FA 5E3FA 3VYSA 2EYJA 1STEA 4EQOA 2KA7A 2SEBD 4C3JG 4H13C 1W6JA 5LL6X 3OMCA 2WDVB 1JMLA 3D4RA 4HMJA 3LB8C 1EYDA 5D3IB 5JXVA 2F4IA 2LJIA 1SF0A 2RVLA 4FF4A 3ND9A 4G7OC 1PZKD 3H3VC 3I4MB 1FFVA 1Q3LA 2K1BA 1RJTA 1E2WA 3S16B 5M5XB 1VLBA 4KKUA 3AMZA 3GTPB 2BDOA 2F0MA 3EFXD 1DJRD 5E4XA 1HUMA 1SSOA 3OOCA 1ICWA 5C0XI 5A2QL 4KY5A 5IT9E 1B9NA 5MPOA 4XYOA 1NAPA 3SK8A 5C0XH 1YNJC 2DN8A 3P7JA 1FNUA 4CKCA 3A7AB 1TKYA 1RYJA 4C1NI 2ICIA 3Q8FA 2WXMA 3SK6A 2JU6X 3OPOA 5DEHA 3KLRA 1YN4A 1WTQA 2BOSA 2WXRA 4ILWA 4KGRA 2EJFC 5D3DA 4CJ1B 4JWUC 1OXTA 3QOLA 2N9KA 2F0UA 3RMHA 2B39A 4ZHOA 2MJ3A 1EY5A 1PMRA 1L6UA 1TKGA 2B2VA 2FMMA 3D31A 4H0LC 1GUNA 1GUWA 3HG9A 3EA6A 4MACA 1N5WA 5FR3A 5G3LD 2WXNA 3SK4A 4TRDA 1TS2A 4A90A 4BA2I 3MXNA 5M5WB 2YEPB 4XDXA 3GTLB 4XYQA 1Y8NB 2NN6G 5I6WA 2XSCA 5C0XJ 4IDIA 5JVG3 4ZK9B 1HTPA 1GB1A 3GQBA 1MD2D 4YIJA 1E2VA 1ACCA 1PTOH 1VR9A 2F3WA 4DXFA 3NQTA 4QCLA 4KKJA 1TZOA 3N6RA 5LHY1 3Q24A 1VJKA 5IT9L 5FO7B 5EE1A 2F0FA 3IFTA 1BO0A 3PO2B 4A3EB 3B2FA 1EU3A 4A9AA 1ILPA 5C3JB 4HSVA 1L4DB 3FC4A 4K5WA 2AUJD 1F2ZA 1G2TA 1DM0B 1PGBA 4NW2A 3J7YW 3VA5A 2VZKB 2E2JB 2LS01 2PLPA 1DOLA 2F03A 1E6EB 3D4WA 2JYEA 4KD4A 1D1KA 5EE3A 4K2KA 1VCIA 4Q2JA 4BBRB 3MEHA 1EY4A 4KTAA 4GDLB 4DK1A 3GTJB 4NMZA 3ONAB 2FJ2A 3T53B 5F2DA 3QJYA 3C1EA 4J3OD 4NZLB 1PUTA 2NUCA 2A69D 2F0GA 3D4DA 4ZKCB 1LTAD 1TS4A 3NBIA 3AMUA 3B9JA 1CHQD 4X3KA 1AP0A 1IGDA 4XDDA 5HFYA 3GP7A 5HURA 3RZDB 4HR7B 1JR0D 3SFDB 4C3HB 1TS3A 1O7YA 1ROEA 4HJGE 2IGGA 2PW7A 1JCKB 2J52A 3TEZA 4GLSC 1STHA 2RDHA 3VA7A 3AM9A 1H9SA 1U9RA 4ZRPA 2A73B 3ABVB 1HFGA 1SYGA 5J39A 3L7ZC 1MI0A 3SE0A 3GO5A 3SK5A 1BBXC 1EEFD 3BDLA 3I4NB 2W55A 1VMPA 1B53A 2F0IA 2WXLA 4A55A 2EYLA 1RTNA 3T56B 5G5HA 2JEBI 4CKEA 1TWAB 2EYFA 1BCPF 5C5LA 1LT6D 2KEEA 2RSNA 2F0NA 4TMAB 2JQRB 3TUOA 3BWUD 2A6ED 2QEJC 1C48A 1J8IA 3VYTA 2NVTB 4HRSA 2IGHA 5KGUA 2K03A 2KEDA 3KLSX 2INNE 2N88A 2F0TA 2MJ8A 2QMTA 1VF5C 2WXFA 2MPMA 1L0XB 3DEPA 2JA8B 2ENBA 5C3EB 1YJIA 2BW2A 2YU9B 1EYCA 3LWUA 3BVMA 2F0PA 1EZ6A 2PVGC 3ERQA 1Y8OB 2B2WA 4XWTA 1SYCA 3I70A 5KIXA 3U4EG 1DZ1A 4XE0A 4DA2A 1V1PA 3TEWA 1EOTA 4YWGG 4DFAA 2NYZD 1DOKA 2RDFA 1X3QA 3VQIA 4N9PA 4A6QA 2J42A 1R7SA 1M4VA 3L9AX 3M3YB 4DAPA 1G8ZD 1Q1BA 3I57A 1FNWA 1S5BD 2NB0A 4DQOC 4HROA 2MGSA 4RGNA 1SE4A 1I4GA 1K52A 4C7ZA 3FPUB 3N52A 3KWVA 4MH8A 2HDMA 2JWUA 1C76A 4FXGC 1V8CA 2L55A 4A3GB 2WQYB 3EJIA 1FM0D 1ENCA 1F9RA 2R7ZB 3NTIA 4JX1C 2IX1A 4JE3B 2WXIA 1PGXA 1HHVA 1X32A 1RD9D 2JP1A 1L4ZB 1DOIA 2LFIA 1YQ3B 1Z6HA 2XVSA 2EY6A 3R2IA 2WLBA 4H2AA 1VF7A 1PTOD 2K33A 5J1ZA 1HXYD 3S1MB 3W5VB 1GHJA 3MHBA 4RGTA 2SAKA 1BMLC 4GZYC 3RPFC 2PCFB 4XQNA 4HN7A 1QOAA 2ZW1A 2LMCA 3P42A 1NCVA 2R6GA 2B8GA 3V96A 1STYA 3PMFA 1PRTD 4ARIA 1IGCA 1EY6A 3K57A 5G5GA 5I9OA 2XRQD 2A69C 2WXOA 2AWNA 3URYA 3ZJVA 5KYLA 3R93A 3BS1A 1OO9B 1B1ZA 1H9MA 5BMIA 4EE2A 4YSZB 3NTHA 3A8IE 3MHZA 4DNTB 1SFOB 2GI9A 1Y56A 4RHRA 1KLGD 3TP5A 2F1MA 3HRZC 5BMHA 2KACA 3GTKB 4G7ZC 2D9UA 1LTGD 3GTOB 5M5YB 4LTUA 1I4RA 1EM7A 1G2SA 4RKBA 2G1EA 3VR4A 3AECB 3K6OA 1Y69U 1IKMA 4OIJA 3PUZA 1JQYD 4K14A 1RTOA 4LK1C 1SMYD 4JK1C 3VYRA 5C4ZA 1F2RI 1JWAD 2PNRC 3ZJUA 4XIGS 1SXTA 3M4OB 4KN4C 4PNYA 3WDNA 3P63A 2AQ1B 1S5FD 3MWYW 5EQ0A 2JYTA 1C77A 3T16A 1EL0A 2H89B 5C2TB 1RHPA 4HCEA 5EJWA 1SJHD 4HAEA 3G6JB 5BN5A 3E9SA 3RD4A 1GAQB 2V3NA 2DYMA 1GXDC 5EPLA 5KYIA 1N62A 4PMBA 2HUGA 2JZPA 3N9YC 3L4PA 1UAPA 3TBIB 4Q0FA 1HZ5A 4X3UA 2WXJA 1E2ZA 3EVQA 3NRZA 4NKLA 4KK7A 4YTPB 1L0VB 3Q22A 5E4WC 4ZQ3A 3BVGA 1XCTL 3TZUA 3J7AV 1C4CA 1BR9A 1HFNA 1IHZA 4RF0A 2R3ZA 2A6HC 5CV8A 1LT3D 4ULLA 2V4DA 3Q23A 3Q6SA 1FO4A 1AEXA 1KLUD 4H44C 5EKIA 3NXWA 1YJJA 2LHEA 1FEHA 3U52E 1RDPD 2B76B 3OW7A 3KF8A 3HOWB 3V2TA 1EQTA 3MXUA 4UDUC 2Y5CA 4CJ2C 3HVDA 3PIO3 2BS4B 1RFKA 1PYWD 3C46A 2TSSA 1O7LA 4J6HA 2MP1A 2ZXRA 2K28A 2L52A 4K8IA 1SNDA 1U4LA 1ZKOA 2W82A 2IT1A 2E74C 2I46A 4C3JB 2M56B 4YT0B 2E76C 4TSSA 3ITPA 2HTME 5IGGA 2LKVA 2WIIB 4A3KB 1CZPA 1FD6A 3SFEB 1FXIA 5CV5A 3S17B 1PFMA 5M3MB 2NBFA 5EGTA 2B8FA 2X38A 2E2HB 3FRPB 1HQRD 3NP8A 2JSVX 1OQQA 1J9OA 1QE6A 3S15B 2A68C 4F7XA 3CWIA 1D5ZC 1F9PA 1DXMA 4F87A 3SEBA 1E0BA 3H09A 2BS3B 1OQRA 1H9JA 4X3SA 1IW7D 3A8JE 3BYYB 5A2QE 2OHFA 3LWEA 3KQ4A 1J7AA 2PQEA 1IBXA 3LX0A 4E6IA 3KWLA 2F0QA 3IKJA 4OGQC 1B9RA 2DYOA 1AFPA 1WTWA 5FOBB 2JXMB 4LJZC 1C8CA 2QSDA 4IQZA 2K5DA 2BE5C 3DMUA 1XO3A 3TZDA 1EU4A 1PTOB 3QO2A 3ZQ4A 2D62A 2JEAI 4WORA 4DK0A 5EPJA 2BT6A 1HA5A 2IPKD 5J22A 4C7YA 3DWPA 4XWWA 4KN7C 1PRTB 1JROA 4HSPA 1OXUA 2XWBB 4MHEA 4L8JA 5KNDA 2JXTA 2K22A 2KAJA 1QB5D 2EOTA 3H0GB 1II3A 4A93B 1BXTA 3R2TA 1VRAB 4XQQA 5CBAE 1JRPA 1O78A 4L63B 3HP3A 1H9KA 4OZAA 5D7GA 4WH4A 3J81E 1G6ZA 2B2YC 1B9MA 1A2UA 3V05A 2Q8RE 2KDMA 1ET6A 2KECA 4IFDG 2NWGA 3Q8CA 4ZRQA 4NJCA 2K32A 2WU2B 1HTLD 2ICEC 1F0ZA 1MPEA 2BBCA 2KCNA 1WWTA 1ZOYB 1VZ6A 2K5WA 3FDTA 1LACA 3PUWA 4K6LA 4FYDA 1GJXA 1RM6C 1S5ED 3K7AB 4JBWA 2NVXB 5FKAC 3TEXA 4IFDH 1T5EA 3CKIB 4D2KA 4KJNA 3MC0B 2B2UC 5KEEA 2K5QA 3EUB2 1LO5D 2Y0SB 2YYZA 2PW5A 1I7HA 5FLXE 2OF1A 3TP7A 1HA6A 1V43A 2NTSA 2DNCA 1H9SB 5BYQA 2TMPA 5CR3A 2RDGA 4PMCA 1GOZA 2RKSA 1EWHA 4DN4M 2WKDA 4IUTA 4A3DB 2N55A 2NN6I 2A74C 3PUYA 3ZJTA 4RFBA 4UAIA 3VR2A 3NBHA 4U673 1KNAA 1LT5D 1XXGA 2NN6H 1QT9A 2CW0D 3J81L 4YSXB 3IAM1 4IFDJ 2K3UA 3AEGB 3VR8B 1STNA 3MVVA 2Y3AA 1GPXA 1FYCA 4KY7A 5JEAG 4OZBA 4US8A 3P20A 4AYBB 3Q8BA 1CA6A 1NR4A 3E56A 3HUIA 1A6XA 1CQVA 1I4QA 2WDQB 3HRDD 3K0YA 1DCZA 3VRBB 1P7EA 1TY0A 2RMMA 3BIID 1MGSA 1QOBA 1CM9A 3AB5A 2WS3B 3FVQA 2O4XA 2WXHA 2WB1B 5LL6S 1BCPB 1EIGA 5EKLA 1EY9A 5FLXL 2BCOA 2QF7A 3OIQA 3RFZB 2YEPF 3H6MA 4F8MA 2L1AA 1BUIC 5DAUA 1CA5A 1V1PB 1N63A 4M8AA 1QOFA 4DF7A 4ODGA 5JJZA 5LNK1 1FD7D 4QMGA 4I7ZC 3D6WA 1TVXA 5CYUA 1SYDA 1Q12A 4OZCA 1S4ZA 1JICA 2JA5B 5JEAJ 1DYQA 1HUNA 1B44D 1FFUA 2AX5A 2HCIA 2IWHA 1GUGA 3E0JA 3OWEB 4G4KA 1H9RA 4EVOA 3DWMA 4KV6A 1QLBB 3WOEA 5C4XB 5CMDA 2J53A 2C9OA 2AWOA 4FXKC 1QILA 1Q90A 2WV6D 2IJ0A 1SBBB 4ZLTF 1L5PA 2L83A 1XEEA 3CU7A 4QUFA 4HEA1 5KNBA 5IGEA 3OSOA 5D65A 3Q0AA 1F77A 4TKOB 4QB4A 2Q8IB 3MJ5A 1ZYRD 1ET9A 2VUMB 4WURA 2WINB 4P2CB 3CIRB 2ACZB 1B4OA 1TQOA 1EZ8A 4XT3B 3MAQA 2EE1A 2WAQB 3TSSA 3U7ZA 2BA0A 2QCPX 3AB9A 3BG3A 4R8NA 2RQXA 3KUPA 3P4RB 3A55A 3D3RA 1QOGA 3PZ7A 1GUOA 2EYOA 2X6GA 1L6VA 3AEAB 1TS5A 2KOLA 4KGTA 2LMCB 1PZJD 1TWFB 3ZYYX 3M4YA 5BMGA 1ENAA 3PZ8A 1NYRA 1E10A 1JOQA 1A70A 5D14A 4IUNA 1MI2A 4C3HG 4USAA 3E6ZX 1TT2A 4U68A 2SDFA 5JOBA 5I2YA 1XLNA 4KD3A 1R9TB 4K5VA 3T13A 2M2LA 1PGAA 3I90A 5H92C 5BN4A 1R4PB 3IAYA 1RF2D 3AE3B 1UWMA 3BVZA 1ML0D 2N7JA 2K9XA 1OXXK 1SNCA 1FGBD 4KHVA 4R8IA 1G91A 4Y7NB 3R8BA 3HOXB 1QG7A 1WD1A 2V0GA 3AE4B 2R92B 4HTHA 3FPPA 3M7NA 2Y5PA 2FE8A 3U9SA 2V4IB 4Z9CB 1I6VC 2O2LD 1PFNA 1EY7A 2RSOA 3P75A 1ZEQX 2CHBD