4ZYSA

Crystal structure of an exotoxin 6 (sav0422) from staphylococcus aureus subsp. aureus mu50 at 2.25 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
195
Chain Sequence
TEVKQQSESELKHYYNKPVLERKNVTGYKYTEKGKDYIDVIVDNQYSQISLVGSDKDKFKDGDNSNIDVFILREGDSRQATNYSIGGVTKTNSQPFIDYIHTPILEIKKGKEEPQSSLYQIYKEDISLKELDYRLRERAIKQHGLYSNGLKQGQITITMKDGKSHTIDLSQKLEKERMGDSIDGRQIQKILVEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an exotoxin 6 (SAV0422) from Staphylococcus aureus subsp. aureus Mu50 at 2.25 A resolution
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Sugar binding protein
molecule keywords exotoxin 6
total genus 63
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zysA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zysA01
1BCPD 1AW7A 1UUPA 2Z8LA 1HQRD 2RDHA 1ESFA 1XTCD 1D5MC 1S5ED 3R8BA 4UDUC 1EEFD 1HXYD 1LO5D 1SXTA 3BZDB 1FNWA 1D5ZC 1L0XB 1RDPD 1CT1D 1CQVA 2XRSD 1TY2A 3DWQA 1PRTB 1JWUD 1YN4A 2J4XA 5FK9C 1CHQD 1LT6D 1T5XD 1PRTC 1S5DD 2AQ1B 1FNUA 1JWSD 4TSSA 5ELEA 4Z9CB 1L0YB 1LT3D 1LTRD 1SE2A 1BCPB 5ELDA 1SE3A 1DJRD 2AQ2B 1TS2A 1EWCA 1JCKB 1PYWD 1PTOC 3KLSX 1S5BD 1S5FD 5D3IB 1I4QA 1SEBD 1ET6A 1QILA 2CHBD 2XN9C 1TS3A 1M4VA 1G8ZD 1SE4A 1I4PA 1PRTD 2SEBD 2IPKD 1EEID 1CK1A 1SBBB 1V1PB 3URYA 2XRQD 1EU4A 3R2IA 1KLGD 3R2TA 4L63B 4C56C 1GOZA 1PRTF 1BXTA 1JR0D 1MD2D 1STEA 4DXFA 1SJHD 3EA6A 5ELCA 1ENFA 1LT4D 1ET9A 3GP7A 1B44D 4NZLB 1EFID 1RF2D 1FGBD 5D3DA 4DXGA 2WV6D 1KLUD 1CHPD 5ELFA 4RH6A 3OWEB 1LTTD 5TSSA 1LTID 1XXGA 3BVZA 1LTBD 1LT5D 1HTLD 1HA5A 3BYTB 3DWPA 4OHJA 1PTOB 3O13A 4RCOA 5I4DA 2IJ0A 1V1PA 3BYYB 1F77A 1D6EC 1I4HA 2XNAC 4RGTA 3EFXD 1YN5A 3SEBA 1EU3A 2G9HD 2RDGA 1TY0A 4RGNA 4RHRA 1I4GA 3W2DA 1UNSA 5ELBA 4ZYSA 1FD7D 1PTOD 1SJED 2QILA 2ICIA 2NTSA 4BWGB 3TSSA 2QEJC 1BCPF 1DYQA 4RHSA 2TSSA 3MC0B 2NTTA 4RGMA 1LTAD 1PZID 5FKAC 1FNVA 4O1NA 3CHBD 4RFBA 1KTKA 3BVGA 1TS4A 1JQYD 1AN8A 1TS5A 1PTOF 3MFGA 1D5XC 1I4RA 3V05A 1S5CD 1V1OA 4L6TB 1I4XA 2R61A 3DWAA 3BVMA 4RGOS 1PTOH 2AQ3B 2O2LD 4K6LA 1LLRD 1LTGD 1YN3A 1JWMD 1RCVD 1B1ZA 1RD9D 1PZKD 1PZJD 1LTSD 1BCPC
chains in the Genus database with same CATH superfamily
4XTCS 3FEWX 1HQRD 3T53B 4K7UA 1F52A 1QZEA 3I4MB 1D5MC 2JUOA 1S5ED 1H9MA 2MRPA 4AS1A 5MPOA 1SYFA 2EJMA 1F1HA 1SXTA 1ILQA 3BZDB 2KKCA 4CDEC 3V60A 5CV4A 5AUIA 5CHVC 5BYQA 2D10A 3CQZB 3H0GB 2FJ2A 4A3MH 1S72A 3IRBA 1RWSA 1GUWA 2R2QA 1PFSA 4MGIE 2PMZB 4ALPA 1TVXA 2PI2E 3D4WA 1WI0A 2VQEQ 4YSXB 2F0FA 1U4PA 4AWJA 1JW9D 5C3EG 4X3KA 1K8RB 1SE3A 1H9KA 2K7VA 1K8GA 4OO1G 1J6QA 2Q2UA 1WRDB 3IG3A 3BK1A 3AECB 3S1QH 1K53A 1C3TA 4ZOHC 3M62B 1PTOC 3M95A 2KCMA 1V80A 3E5SA 1S4ZA 1TKWB 5IWAL 3CCRA 1HFGA 1C79A 4JI0Q 4FVMA 4DV2L 4KHZA 4L5SA 4IUMB 1KABA 5C4JH 4N9F4 1VLBA 1CKOA 3B6YA 2CKHB 2KWCA 3PLVA 4GN3B 5LL6X 1F2RI 1GG3A 3QIJA 4S3SA 1O7YA 3TMEA 5I6WA 1QVCA 2V1CC 2PKOA 4LNIA 3M9BA 4ULLA 1VQJA 4LNFA 1QE6A 5M3FG 3HM3A 3I9V1 3VUYA 1PVOA 3M3YB 3QAQA 4A55A 1EFID 3ZDMC 4PS3A 4W9CA 1HNZQ 3I3TB 1XNQQ 2PIAA 3ABVB 1LV9A 4X6AH 2ONQA 1VQ5A 2BB5A 1V6EA 5M3FH 1QT9A 3UDGA 1SFOH 3PLUA 3OJ3A 3PRZA 3P2BA 4C00A 5FO8B 4YTMB 4MSQB 5CV8A 3AE2B 4EEWA 5A2QL 2J0TD 1ASYA 2DLBA 1A62A 1HFNA 1I7HA 1O80A 3I4NH 1A3VA 1WH3A 1O7ZA 2CH4A 4KV2A 5C3JB 1SMYD 2FCNA 1TY0A 1I4GA 1WWTA 3V6CB 5I6YA 5LMNL 3CF5A 4MIUA 4N58A 4I6LB 1WFYA 2PW7A 2QEJC 2JE6I 4W9LA 4APVA 5JPNC 2E8GA 3ZVVA 3K0YA 4EQ5A 1PZID 1RAXA 2C7HA 4K8JA 1Y14B 4OO1I 2NCNA 2EELA 3X3NA 5JOBA 3F8TA 5HFYA 2LY7A 4DU9A 3H7PA 2NS5A 4LW1A 1A63A 4GB9A 3T3OA 1YVCA 1PH8A 2GLSA 2Q8IB 3KYCD 3W9CB 2MUYA 2L9HA 2Y0SB 4M8AA 1N33Q 2E3TA 3AE6B 2XWJB 3KDFB 4HEDA 1H9RA 4R3DA 4EUTA 1NR2A 3K7UC 2PW5A 4IFDG 5FLMH 2D3AA 5E3FA 5JJIA 3AE5B 2MX2A 2RKSA 3KW5B 2AQ3B 1OXSC 4ILWA 1UE7A 3X23A 2K5PA 2B8FA 4F8CB 2IY5B 5G5GA 1RD9D 3GTKH 3D8GA 2OF1A 1YJNA 4YWKA 2NVQH 2K5QA 2JYTA 5HHDG 4ODGA 3HVDA 4W9KA 3GTPH 3ZRCA 3MXNB 5JHAA 3TEWA 2QJLA 1Y1VH 3DBHB 4BA2I 2EJGC 1DCZA 4FNFA 3UINB 3VYTA 2PZWA 2NZHA 1JJ2A 4IFDI 2F0LA 5EKLA 1STAA 4JI4Q 3RNEC 1OGWA 2XRSD 3MWYW 3U30A 4R1JA 4GDLB 1YJWA 2H5XA 2WGSA 5A35A 1EF1A 4JQWC 2VW9A 4DV6Q 3NBIA 2W3SA 4WWNA 4ZRPA 3N1XC 3PZ8A 3OMCA 5JEAJ 4Y52H 1VQ9A 2UU9L 1TR5A 3HKZB 3SHLA 2A8VA 2OEOA 2X69A 5IYBG 3VTUA 2PW9A 2LS01 3STBC 4FA6A 1A2UA 2L4NA 4TKNA 4ME3A 2A5HA 3RLNA 4L1BA 5JH5C 4DV5L 1YMHE 3C2PA 1ET6A 4ME5A 1GHJA 5DPWA 4K5VA 4LLGM 1G8ZD 2LMCA 1I4PA 1IKMA 3P7JA 3L10B 3HUIA 3VTVA 1E1OA 3AN1A 4HJKA 4FHJA 1UBQA 1PFBA 3RN2A 2CCZA 1NYRA 3KBXA 1UE6A 1KLGD 1ZKHA 1VS0A 4JI1L 1AEXA 3G71A 2Q2TA 4ITKA 1C9OA 1KNAA 4N8X1 1TKYA 4UPAA 4JI8L 1K73C 2K1FA 5T8IA 2D11A 4HSVA 3L0OA 3J80c 2ZEQA 3DBRI 4XX5A 3IFDA 1X9NA 1FGBD 4DBGA 5D3DA 3CXCA 1CM9A 2R7DA 1V8QA 3P20A 3EC8A 3T4AC 1KRSA 1LT5D 1VF5C 4NMZA 3E9SA 1PTOB 1PH7A 2F0GA 1MJDA 2XGTA 2YYZA 2Y5BB 2A6HD 1XWEA 3Q8EA 4ANVA 4OVVA 4HEA1 2KA7A 2AEHA 2B29A 4N9PA 1PGXA 3TBLD 1DD2A 1J0GA 1X56A 1N62A 2WXFA 1NTGA 4K0KQ 1EY8A 1V86A 2KC1A 2KZRA 1WYWB 3EFXD 2PVOD 3OOCA 2N3SA 2O5JC 2Z6KA 3NK9A 2M8SA 2EDGA 2G9HD 1IBLQ 1UH6A 1L6VA 3H7SA 5JXVA 2Y5CA 1WMHA 2EJFC 1XQQA 1AP0A 2VXWA 1TIFA 3U4ZA 1EOTA 4JOIA 4HJ8A 2I46A 4ABNA 2PVGC 3DHGC 5HGTA 1QNUA 2NN6G 4YCUA 1JQ4A 4XYOA 3K5MA 4GKJQ 2KAJA 2G4SA 4DR6L 1HCZA 2B2TC 2LRWA 3K7AH 1KFYB 3ULLA 4CBVA 3SR1A 2WXNA 1T5EA 3FAHA 4LWCA 5D6JB 1HPCA 2CVRA 1N5WA 2NPTB 1S5CD 2Q8TA 3CCUA 3AEGB 3AM9A 3C1FA 4HPPA 4NAWB 1KRTA 3A56A 4KN7C 1RRBA 1PTOH 5D94A 3ULJA 3PQIA 5C3WA 2IHEA 4P75A 1WIAA 2IT1A 4OW0A 4EZJA 4RMFA 4DAYB 2INPE 2BA0A 1BCPC 5EBDA 3B9JA 4I7ZC 2WXGA 2EYHA 3GE3C 3TEXA 1N36L 4XT3B 5C6AA 4DV4Q 5T1IA 2K04A 3R8BA 2Y0SE 2WYQA 2WDQB 2WP8J 1SSOA 1E22A 1QOGA 5IGDA 5CMDA 1TWHH 2N4FA 2Z0DB 2NZ1D 4A3OA 3BDCA 3AU4A 2QW7A 3HKZG 3Q8DA 4ARIA 2A74C 3KK7A 3Q22A 1YN4A 1M90C 5HI1A 1YEZA 1WTRA 4LNKA 4GKKL 4GGQA 1NNXA 4KKUA 1UGMA 3OJ4B 1L6UA 5KNBA 2R7ZH 1N5XA 1WXVA 1MPEA 1VQBA 4IUVA 2VRRB 4N59A 1LTRD 4FBJB 2BGFA 5G3LF 4YXDB 1BCPB 3ZKJC 2HIXA 1VQFA 5LXIB 4NB3A 1AWDA 1EY7A 2B8GA 3WDNA 5CV5A 4DV7Q 5J18A 4KN4C 4DR3L 4GSWA 1T9HA 4CDDC 3G4SA 4LFCL 2WX0A 3U2SC 3S2DH 2CQAA 1C7YA 1JE4A 2K75A 4B3SQ 2JA7B 2KDEB 2I5LX 4ZCKA 1IW7C 2FHTA 1K8OA 4B9WA 1HZAA 2LGIA 5G2NA 3NQIA 3NTHA 3U50C 1PGAA 1TBEA 1EY4A 2CS4A 2PMVA 4EVOA 1FCCC 4HIOA 1WJNA 1V1PB 1WSPA 5CX3A 3EBEA 2F0IA 4C56C 4B0EA 3B0AA 1EY6A 1ZE3D 2LUMA 4A3JG 1PRTF 2EZVA 4BOSC 5KEEA 1STEA 3BJUA 4YY3Q 2AUKA 1BBXC 2LRUA 5LMNQ 4HWIB 5E6NA 2R93G 3KDFA 2BVCA 1UE5A 2N88A 3JVZX 4MT5A 2HIVA 1Z9FA 3T16A 3GTJH 2Y3AA 3MXPA 2B63B 4A75A 1BDOA 3ICEA 2CU1A 4RH6A 1GC7A 3H7PB 1XXGA 2GRIA 2INNE 1DONA 3MJWA 4ZRKA 3LX0A 4JI6Q 2KD0A 4HJ7A 1HNXQ 2JZZA 2MBEA 1QOAA 4DAPA 2V4IB 3HOYH 3S2HB 4K2KA 1EWYC 2A19A 2NPTA 1KM7A 4KJNA 2KFKB 3V6EB 1VQHA 5EKKA 1SDFA 4A3GB 5D65A 3E9HA 2WACA 3LYYA 3WAPA 2N9KA 4LK0M 1D6EC 2BE5D 2CR5A 4A93G 3X3MA 3PS6A 1ZEQX 3FRPB 4GU2A 2BOSA 2IO1B 3VDZA 1T0SC 2KX3A 2OTLA 2BE5C 4LK1C 4AQYQ 2KACA 1D4BA 2NWGA 3GD7A 2DJGC 2WAQE 4BBRH 4BBRB 3HS0C 2RVLA 2E2HH 4LF8Q 3JW0X 3PHXB 1X3GA 2VZKB 2UXDQ 2HCCA 3HOZB 2HTHA 1VQOA 2HJ1A 4AH6A 2IDYA 2MEKA 2B2VC 4LUZA 1Y1VB 2K5HA 4JI4L 2J0KA 1TS5A 3DMUA 1QLBB 2ZW1A 3UGBB 2M1MA 3NVZA 3V05A 2ZNVB 4JGHB 3P4QB 3A9KB 3W1YA 1PH5A 4RGOS 2IO0B 2JF5A 3RMKC 4B3MQ 2N55A 3DQVA 3H8HA 2GBRA 1MG4A 1V9PA 1TJEA 2G1EA 4AJWA 2EYOA 2O6VA 1XPOA 3VH3B 2K33A 1GKHA 4XDXA 4UHVA 3TZDA 5IGGA 2REXA 1DGJA 2ZCCA 2KC2A 2K03A 4TQ0A 2CWAA 1H8CA 3CMAA 3PV1A 5GAHC 1Q82C 2UXCL 2YV5A 1F2LA 3MZ5A 4KY7A 1VCBA 3PVLA 4US8A 2WXQA 4A3JB 3H3VI 2F0JA 1D7QA 2I0QA 2MBQA 4L5TA 4X66L 2OXPA 3S1RH 3RZOB 3HOWB 2L00B 2ZNVC 3IFWB 3G6EA 2V3SA 2WXOA 5C3EB 1E24A 3PIPA 4IN3A 2K6AA 3EROA 4OEMB 3W5VB 1KAWA 5M3MB 4R9WA 5CV6A 2ZW0A 1NMGA 2ENBA 5IO9A 4IALA 2XVSA 2D2QA 1R4MI 4KZCA 2GN5A 3I4NB 1A15A 1VQMA 2FIFA 3DBSA 3VAWA 3ZNZB 3RUZA 4A4IA 2VB3X 4KIKA 5FO7B 1WYDA 4YHHQ 1L5PA 4YSZB 4US9A 3BG3A 3S24A 1WJ6A 1Q8KA 5BR8L 1KDBA 1S5BD 2BB6A 4WJQA 1EYDA 3NS1A 2R7ZB 4WJ3M 1QUQB 3I72A 3L9AX 1ZOYB 2W82A 3W1SC 5FR3A 1B9RA 3PIP3 2EQSA 4RCNA 3GDEA 1XMOL 1FM0D 2GBJA 1XLQA 4QGUA 1JMCA 3E56A 4BVUC 1UZXB 1S3SG 4DUYL 3K58A 1MIUA 5FLMG 4IM3A 3R2TA 3CCMA 4DV1Q 4OZBA 1EQRA 1HNWL 2ZXPA 3Q3NC 3PUWA 5DEHA 1ENFA 1TT2A 3H09A 3DHHC 2NVUI 1RF2D 1G6PA 3SHQA 3HRZC 3AEVA 3VYUA 4GKJL 2LVPA 3OWEB 1G2TA 1Y8PB 3J7AV 2CJOA 2KNBA 1PDQA 2ZJRA 3I4NG 3D31A 3NENA 4JPSA 4NW2A 2RA4A 2KCNA 2IX1A 5E6JA 1ENCA 1ILPA 4POGA 1M94A 5DAUA 5IN7A 1V1PA 2LXCA 2WINB 1TIID 1VQNA 4BKTA 3MVVA 1IL2A 4BBNF 1JE5A 4QL5A 1GUTA 1DM0B 2PNRC 4A3FB 3A74A 1J19A 3RYTA 2EY6A 4GIVA 1EU3A 2RDGA 1WXQA 4HCNB 2QDBA 5DLQE 3JYUA 5CHWA 3UE1A 1WTOA 5EGTA 3A8KE 3H0GH 4WAAA 4K2LA 2LD9A 2IX0A 4ZLTF 1MKHA 1I35A 1NCVA 3UIPB 5LMUL 1XYIA 3S16H 2QHOA 5IP7G 2WDRB 2JX5A 4HTHA 1GHKA 5GMVA 3N32A 1FNVA 3D3RA 2QF7A 4O0AA 2IX3A 3I4MH 2WQYB 3AFQA 2BYEA 4XIGS 2AL6A 2QEXA 1A2TA 3L13A 1V1QA 4ARCA 2JQRB 1V9JA 2PZUA 1Y1WG 2IZVB 1K51A 3H9DA 1I4XA 1LUZA 2B2WA 5AJ3L 2O5IC 1A5RA 2QSDA 2O2LD 2UUBQ 1YBYA 3BZKA 4HR7B 3J81j 3W3AA 3M4OB 4OVUA 2M00A 1XEEA 1LTSD 4FHKA 3VA5A 3GTGH 2G45B 2LFIA 3A5UA 1BCPD 2ZM6Q 4DGZA 1ESFA 2F0KA 3Q3MC 4AP4C 4B9XA 3KH0A 3OG5A 1R4MB 1LO5D 2G5DA 1CZWA 1FL0A 3EN2A 3M4YA 1V5OA 4I6PA 5EPKA 1CQVA 4XE0A 3PO3B 3ZRFA 1PRTB 3I5JC 4EE2A 4H13C 3Q8BA 2O6VD 2WXMA 4XQQA 1P0RA 2MP2B 1S5DD 3A1QA 3HOYG 2DY7A 5IGEA 3TP5A 3E0JA 2Y5PA 1JMLA 1YZ6A 4BY1H 4IWOA 3SFDB 2A6EC 1IBML 3BDOA 1HA6A 3E0EA 3N1ZC 2UWQA 3ML9A 2E2IH 1KIXA 5C2TB 2E2JB 2OQ0A 2VB2X 4DR2L 2K01A 1KH0A 4PZ8A 2WKCA 2CW0C 3MTSA 1I4QA 3A55A 2HHHL 4NXNQ 2D0PA 2JA8B 1STYA 4A3BH 3MP9A 4FN2A 4HXDA 5LNK1 1GUGA 2DX5B 1YIWA 2C5CA 1JWBD 3JC66 4P1BC 2CJNA 3RD2A 1SLJA 4L63B 3HKSA 1Q1EA 1E0BA 2RPQA 1VDZA 3UE0A 2N9PC 4G3XB 4K14A 4IOIE 4DR5Q 3EA6A 2JA7G 4IM2A 3PF5A 4M0WB 3C1EA 2F0TA 2KHIA 2LASA 1QF6A 1WCMB 2RHQB 1WX9A 2NZOA 4DK3C 2HDMA 3F2DA 1PYBA 1R9TB 4BXXG 3A8IE 5TSSA 1NY4A 1PH1A 2FCMA 4LFAL 2GI9A 1XJVA 3QARA 4A93H 4K81A 3NHHA 4P6VF 3L2PA 4H0LC 1V8CA 4NP5A 1CQFA 4B3RL 5EDSA 4WQOB 5IA7A 4GN4B 1EWHA 1E2VA 2B2YC 4H44C 1YIJA 5AZHA 4XYQA 1YN5A 2LGXA 3T1YL 2PQEA 3CD6A 3JAMi 4KGTA 1EFWA 2VQFQ 3U4VA 3A33B 1NE3A 5H92C 2L1BA 4DXAB 2FUG1 3ZIMA 2W9NA 2KQ4X 1RTNA 1BBWA 3K59A 2KDIA 3HM6X 2NTTA 1FEHA 2X8XX 1SYCA 3NVYA 2ASQA 4REZA 2BQQA 2N1VA 4J6IA 4JPBW 1HEZE 1TS4A 4QF4A 2N7JA 4JK1C 2UUAL 3B08A 4M00A 4JWUC 1WR6E 4BKSA 2RSOA 2EY5A 4X65Q 1PDXA 2R93H 3R7RA 1QOFA 4M0WA 2ZVOA 1CUKA 4OELB 2JRIB 4WIPA 2N1WA 2YTVA 2KHSA 3SD5A 1HZBA 2OHFA 2E2DC 3KVFB 5E4WC 4HIKA 2KDFB 1GUOA 1PUTA 3GOEA 4II3B 2F0VA 3GTLH 4HN7A 3AE4B 1VQPA 3ZGZA 1EY9A 1N9WA 3H15A 4RG1A 1LM8B 5E6OA 5M9OA 3SDZA 2VUMG 1XTDA 1P1AA 1HHVA 1P3QU 4X62L 2AWTA 2Q8RE 2YTYA 2BS3B 2IY1B 4LNOA 4XDDA 3ZW3A 4RA8A 1E2WA 1BF4A 1AE2A 3B1LX 1PHJA 1XMOQ 2O4XA 1OXTA 1ZKOA 1VCIA 5JZEB 3QX1A 2E2HB 4Q5VA 2WB1B 2C9OA 4A3EG 5IE8A 2K32A 1Y1VG 3K80C 3VDYA 1IP9A 5FK9C 1FXAA 3DVGX 3J7YW 3J80L 2R7ZG 2LKVA 1JWSD 3C3LA 2K28A 2PPBC 4JI2Q 3VR5A 3RZDB 4DAVA 2VH1A 1WGHA 5M5WB 1VZ7A 2IY0B 4HSPA 4IUQA 2B2UA 1GPXA 3R3OA 3JSVA 4A3IB 1C76A 4EZLA 3AEAB 4S17A 5EE9A 1XLNA 2JQOA 1K0RA 3I55A 4BBSH 1IZ6A 3HOYB 3S2HH 1YJIA 3NEMA 2EMTA 4A93B 2WXHA 4DR4L 4YWLA 3AI5A 2DY8A 3A0JA 4GNXC 4HIMA 5KYLA 3TRZA 2NN6I 2C9WB 1B2TA 5IODA 4LF4Q 1AE3A 1G51A 2JA5B 1WGYA 2MJEA 2RPVA 1WGDA 4G7ZC 3CKIB 2WXKA 1WE6A 2KOXA 2F0DA 2XRQD 1L0VB 2BDNA 2Z4HA 3PSEB 4NJ6A 4AYBE 2CHXA 2Z0EB 4P7IA 2QMTA 1BR9A 1HE8A 3PPAA 3TJPA 3R93A 1V5TA 1B44D 2IGDA 1I3QH 4FF3A 3KYDD 1TXYA 4KTAA 2HJ8A 1QCBD 3HP3A 5C4JB 1KLUD 1U4LA 5LMUQ 1VJKA 1V43A 1Q7YC 5EKIA 2RSUA 4GDKA 2E5LQ 1YNJC 5E1FA 3P4RB 4C2MH 3HOXH 5KHQA 3A7AB 2RR9A 4R4OA 4JL9A 2GA4B 3GTMH 1Z5SB 1NJIC 2L52A 4MGKE 2HDEA 1P7FA 2DN8A 4YCWA 4N9TA 1CSPA 4IPGA 4PZ7A 2K4KA 1D1IA 4BY1B 2MO1A 4RGTA 2L05A 1WTHA 1FR3A 1Q90A 3BU2A 2UUBL 1J7BA 1HR0L 1JOOA 4LF7Q 3NWTA 4WQMA 4AIMA 1CA6A 2R6GA 4WJ4A 3QQ8B 1J8IA 2V3PA 3V62A 1UNSA 2VS1A 1D8LA 3SK5A 3MHZA 1JB3A 1R4PB 1MBYA 2I38A 1DGSA 3D4RA 1B9MA 1PLFA 4ZAIA 1EM7A 1DYQA 1TWAH 1Z7TA 5IGBA 3VYRA 4A3FH 1XLOA 4RWSC 4YTNB 4M02A 1EO6A 3L08A 4C3JG 1ROEA 3GTGB 2NB0A 1I4RA 4RF0A 3OWFA 4HAEA 3J81E 3J7AF 2LWPA 3M4OH 4RNAA 5GAGC 2J7QB 1Q46A 2DUDA 2INDC 1E10A 3I73A 4O42A 1XMQL 2JVCA 4DWFA 3ZLZA 1Y56A 4LF9Q 1N32L 2UU9Q 5IOCA 2KANA 1B1ZA 4HLEA 4KI0A 2B3GA 4CHTB 4CDFC 1CA5A 4OXPA 4IOAA 4NY0A 4P72A 1U5KA 3ONSA 5C5MA 3PF4A 4DAYA 3V61A 2K39A 2DHZA 2JEBI 2F3VA 4KK7A 1C1YB 4IJHA 1XTCD 3B2GA 1X1MA 5D2MB 2B2YA 1SNPA 3I4LA 3K7AB 3AMZA 3M85A 2BH2A 1C0AA 4X64L 1TWAB 2FBWB 2KVRA 4IM0A 2PI2A 1WZ3A 2QA4A 3DDCB 2MJ3A 4KD4A 4FJZA 1XNRL 2KVMA 1HTOA 4OZCA 3FPPA 3MAQA 5NUCA 2FE8A 4G4KA 2J7ZA 1TZ1A 4LCDE 4XDCA 4G57A 1QKZA 3SFEB 1I94L 4LF6Q 5EE1A 4NQKE 4KKJA 4GN5A 4ZRIA 1Y1WB 3ERQA 3LJ3A 3RPFC 2PLPA 2OEDA 4KX6B 4P16A 2EYLA 1PH9A 5IYCG 4LF5L 1BUIC 5L83A 1PYWD 3AU5A 3M3JA 3PO3G 4A3DB 4BBSG 1TZOA 3KLSX 1Q10A 3T1HQ 3AE7B 1BO0A 4KHPL 2KCTA 4EX5A 2CW0D 3ZYYX 1J7AA 1WGKA 3ZO5B 2ZT9C 2DAFA 3GTOB 2JP1A 4H7BA 1JICA 2J52A 4YIJA 2WDTB 4R4IA 3IT4B 1I3QB 4M01A 3HOWH 2K5VA 3URYA 3KF6B 1YX5B 3IXSA 2FXQA 3T1YQ 4J8QA 4MNOA 2A4ZA 4NJCA 1D3ZA 4KVGB 4GOPB 2QC8A 4ZHPA 2LJIA 2HTME 2VZKD 2NBUA 3ZTDA 1JJCB 2F52A 4MACA 3KF6A 4DHJB 5ELNA 2IYDB 2W54A 3V96A 4PV1C 1EIFA 4NAWA 1MVKA 1NI2A 4C4VA 1HA5A 3U8ZA 3FKIH 1I6HB 2O2VA 3KOJA 1SB3C 4DNTB 1RM6C 4KKTA 1CTMA 1VQ7A 4FADA 4A3DG 2F0NA 1WM3A 2KDBA 2MGSA 3H6NA 2JK8A 4E74A 3DHQA 1IUEA 4J1MA 2MJDA 4A90A 3QOJA 2M4NA 2NBVB 4GOPC 2V4DA 3FDTA 1XPUA 2QDFA 4LNNA 2K9XA 1L7YA 1SYDA 5EBCA 4RHRA 4GNXA 3S1MB 4JIOU 2D62A 3VHTC 3ALBA 1K28A 3RULA 2LHEA 4KZ0A 1FGUA 5IYDH 2EVBA 1K8MA 3ULPA 1F9SA 1WM2A 3FKYA 4QAYA 2ZVNA 1PH6A 1F0ZA 4JVZA 5GROA 3OTOL 1KQSA 2D3CA 2AKWB 2L76A 3AE1B 4C4VB 3CMMB 2A73B 2DWQA 4BOZB 1BT0A 3GTPB 3PIO3 2ZTCA 3MFGA 5JPMC 2VUMB 4FP5D 4OONA 3A8JE 4G7HC 1TWFB 3MTNB 3NHEB 2B2WC 3WCQA 2JY6A 2JWUA 2PO4A 3NE5B 2PQAA 2QCZA 1F9JA 1ZUD2 3FC4A 5C0XI 1TWCB 3I57A 1UF0A 5TR5A 1B50A 1UAPA 1JWMD 1MFWA 2D07B 4DV2Q 2EIFA 2F0QA 3EGRA 1ENAA 3N1YC 4ZHOA 4LJZC 3U52E 3QWNA 2XEWA 1LABA 1KD1C 1EL0A 4FXDA 2UU7A 4DR4Q 2CH4W 2L12A 2KVZA 3AE3B 4UDUC 1HXYD 2XK5A 1V97A 5DPRA 2RBMA 3ND9A 4TV3A 5HURA 1F2RC 4CJ0B 2KWDA 4OO1H 2XIWA 1QWYA 2FINB 3ERSX 3U58A 1IBKQ 1I6VC 1B70B 4GXBA 1STGA 2Q2IA 4IUUA 1W2BA 3D32A 3DVNV 3HFZB 3NVVA 1NYQA 1U4AA 1WTQA 1CKNB 5IP7H 4BA1I 1L0YB 4CJ1B 2IW3A 3H1UA 4NJ7A 1V49A 2KX0A 2P5ZX 1I42A 4QUCA 1S3OA 1YQ3B 1GXDC 2K8BA 2HD5B 3CCQA 2IBIB 2E5LL 2J0MA 3T9LA 1OXXK 4ZK9B 1YNTE 5C5LA 4JI6L 2MBBB 1HNXL 1SMXA 3BY4B 4A8XC 5IT9L 3PUYA 5KNCA 2WDVB 4W9IA 1NSNS 4IPCA 3CF6E 3VTWA 2GBNA 3RLFA 3JAME 1Q5WB 2Z1CA 3M3YH 3GQBA 5FLXE 2BW2A 1SAPA 3A9JA 1FFVA 4C7ZA 3DM1A 2M0XA 2KO3A 2WXRA 4DA2A 3GZNB 2M56B 3IVFA 1FCLA 3MXNA 3B2FA 1UBIA 4RM9A 4QB4A 1X3QA 2M9VA 5CGKA 2EOTA 2I5MX 5ELCA 1H95A 3N30A 3NRZA 4JBKA 1FMAD 4IUPA 3V3XA 4A3LG 1Z6HA 2K5DA 2NVYB 3ZJTA 4DXGA 2LSSA 2UXDL 3GTOH 3DBHI 4GS3A 5IAAC 1LTBD 2BKRB 1X32A 3SR6A 1Y8OB 2KHWB 1QOBA 2WWZA 2E2JH 3TEYA 1FFUA 3HOUG 1YQBA 5KHOA 4B3TL 4IJLA 4AYBB 2JA6H 4ID6A 2GB1A 3KBGA 3OLMD 2B39A 3J80E 1TWGH 2XNAC 4UP7A 3L4PA 2WX1A 1L1OB 2KCCA 2YVCA 3JSVB 3Q8AA 1DOYA 2V9HA 3SEBA 4CYEA 3N6RA 2WFWA 1JRPA 4RGNA 2J0JA 1PA6A 3HG9A 2F1MA 3CWIA 1EY5A 3HZXA 5LL6S 3TSSA 1G6JA 1U0LA 4HKZE 1NMFA 1LFDA 2BWES 4JI1Q 2MA9B 3NELA 4MM3A 4L8JA 5CV9A 3UDFA 4JBWA 1YHAA 2G3QB 3WWVA 2F0WA 5HGQA 3J7A5 1H9SA 4DV6L 3NZUA 3T8MA 1J9OA 4X66Q 3BVGA 3H0GG 5BYSA 2N8NA 4EKUA 4TQUS 5FO9B 2JZ3B 3PT2B 4UAIA 2HD3A 2JXXA 4ZUIA 2KQ3A 2DENB 1RJTA 3BVMA 5BMGA 1ICFB 1HTPA 4KY5A 2FCSA 4JX1C 3OIQA 5KIXA 3F2CA 3VR3A 4LFBL 1JROA 1EQTA 1WJUA 3AEFB 1VQEA 3H6MA 4A76A 3PMFA 4GN1A 2KECA 3U9OA 1QG7A 1ZYRC 4JOIC 3S1NB 1E8YA 4LF5Q 3C8YA 4IUTA 4JBMA 3DUZA 3A9KA 4KLKA 3VUXA 3I8ZA 1RFKA 2Z9HA 4KHPQ 3GV3A 5I2XA 1PMRA 2RQXA 5KRUA 4GMVA 3FILA 4YL8A 1JJGA 1QNKA 3QR8A 4DK0A 4ZKBB 4K6DA 2KUMA 2PEAA 2LUEA 1ZPSA 1TY2A 5DPTA 2UUCL 3I7FA 1JWUD 3G6JB 4ZUJA 1ZXIA 3N20C 4IUNA 4DR6Q 3J81c 1CHQD 1LT6D 4PT5A 3PV0A 4MSMB 2NMQA 5AUKA 1JOKA 3NQTA 4TSSA 3HOZG 1K8AC 5JHBA 4HCEA 1EIYB 3VFKA 2LXJA 3J81i 4Y7NH 3RMHA 4NQLB 4TMAB 3J7ZC 1FRRA 3ZTCA 4HMJA 3M7GA 4TRDA 2F0HA 2C60A 1K9MC 1A70A 1E90A 2KJRA 3AEBB 3H3VC 1QZHA 1R7SA 4LMQD 3PUZA 2A5UA 1UEBA 4DV3L 3RZDH 1NENB 4TQ1A 5M3MH 1E3PA 3ITPA 1AZPA 1MI0A 5IYCH 1GUAB 3T3NA 1WCMG 5FLXL 4L2YA 3MC9A 4C80A 2A69C 4GZYC 1BVSA 4A3KB 3MJ5A 1PQSA 4MH0E 1SBBB 4DV4L 5FJ8H 4DUZL 2R3ZA 3AYHB 1OQQA 2L5TA 4B08A 3ZJUA 4A3JH 3DVGY 3IAYA 4RF1A 1EIGA 3HOXG 1K83B 3S17B 3P75A 4K7SA 4HMIA 3NS8A 3M63B 2QKIC 3GP7A 1VF7A 3D0FA 4OWXB 1B9NA 5KNDA 4A3LH 1P8LA 3GTKB 3OAWA 2ZXOA 4DFAA 1LTID 2CKZB 1WXSA 4H2AA 3TQYA 3OTOQ 1HZ9A 1N34L 1FJGL 1KXLA 3PZDA 4M8NA 4ANWA 3L0WB 1TGZB 1TWFH 2KT7A 4DV7L 4ICVA 1SNOA 5CC4A 3RZWC 1F77A 5E4XA 3TBIB 3CP0A 3OHXC 3KFUA 4OWWB 1FVIA 2A1AA 4OGQC 3WIMA 2JN4A 2PNHA 4XWTA 2D3GA 3AEEB 3PO2B 3RCZA 1UE1A 1RLFA 1EUVB 5ELBA 2DZKA 4HCSA 5M3MG 3A1QB 4BY1G 3SK8A 4BFRA 4QJFA 1WOCA 3NXWA 4MN3A 4C3JB 4C3JH 1STHA 5LHY1 4JI7Q 2C7NB 1MG8A 4LNQA 1JOQA 1C4CA 2KN5A 4II2B 3M4PA 4RHSA 2TSSA 3UI2A 2RCFA 3HOWG 2O2VB 1UGJA 1WE7A 1F2MA 2LXKA 3TS0A 1LTLA 4W9JA 5C4XG 2RGFA 5CR3A 1JQYD 1DOKA 2JRHA 3MEFA 3IAM1 3KF8A 2X38A 1SNMA 3PUVA 4MHEA 3GS2A 3DOWA 3Q24A 4FDBA 1U9RA 5DM63 4JYAL 3NWSA 2YEPB 3DBLB 3NUCA 4BKSD 4IFDH 2DYMA 2KTFA 4MJSB 5JJKA 4EQNA 2WAQB 1L1OC 1EQQA 1OXUA 4WWMA 3NP8A 2YU9H 4BY7H 1FPYA 1YN3A 2INCC 2WLBA 1IBMQ 4LUOA 2X6LA 5M5XB 3BIID 4IKGA 2OT2A 2OWOA 2DNFA 1FYCA 3RT3B 4AQYL 3CCVA 1CMXB 4E3CA 3I70A 4P71A 1YNXA 3WALA 4OIKA 4YY3L 4K1RB 2MW5A 4LF8L 2MO0A 5C44B 2C5LC 5KGUA 3DWQA 3RNUA 3T51B 3TEZA 3S1MH 1VQ6A 1R4QB 1JRUA 2EYMA 3BINA 4CKBA 4F8MA 1NBWA 2K50A 3PZ7A 2LZ6A 2BF8B 3EQLC 2X6GA 3S15B 2KMAA 1PFNA 3A4RA 4XYCA 3UQBA 4A20A 2YTXA 4JI3Q 2M2LA 1ASZA 5IYDG 5G5HA 2WB1G 5IYBH 1GUSA 4QIWE 3CCEA 1BKBA 1SFOB 3ECIA 5BN3A 1WF9A 2H89B 1VQIA 3ER0A 2SNMA 4RKLA 2MHJA 4YTPB 1ZDVA 3FKIB 1I6HH 3FVQA 1P98A 1TS3A 1XO3A 1SE4A 1PRTD 4MH8A 2K1BA 1SIJA 1VMPA 4E6IA 4LJOB 2MBOA 2IPKD 3H3VH 2K6DB 3RNCC 1K83H 3S17H 2IGHA 4W9DA 4OVZA 1C8CA 1GOZA 3MHBA 1BXTA 4M1UB 2ZJDA 2F0SA 3P4SB 4F88A 4DXFA 4URKA 1SJHD 3I3CA 2XSCA 4A3EB 2YLMA 2RCNA 1JWAD 1ET9A 1LM0A 2CFMA 4NZLB 4I7AA 1J8CA 2JA5G 2R92H 2WV6D 2WXIA 1MGSA 2F0UA 1YHQA 3W1SA 3BYTB 2JA7H 2R2OA 3L3OC 1STBA 2BH8A 1SSNA 1KDAA 3FP9A 2PE9A 3HHMA 2MPMA 1ISNA 2MFIA 4C3IH 4A3CG 2K22A 4N6EB 2NBWB 4W9HA 5CBEE 1UEAB 3PTFC 4F7ZA 1N63A 3W2DA 3I4MG 4HDOA 1FD7D 3CQZH 4P2CB 1LQBA 1Y8NB 5C0XG 3K6OA 2NVXB 3NSWA 4EOYA 1MSHA 4GDLA 3EFUA 3KUZA 1HNWQ 1F2ZA 5FKAC 3SK4A 3DLLA 1Q1BA 3PREA 3RUIB 4DR1L 1HJPA 1GO3E 5JAVA 4E71A 1KTKA 1LACA 1RL2A 5DPSA 4DNIA 5BMIA 3VR8B 2DAJA 1U4RA 4R4CA 4KKIA 5C0XH 1DZ1A 4HPLB 4KGSA 4PMBA 1KOTA 2DNCA 1XNQL 1GUNA 3PRPB 3ZJYC 1X6OA 3IHPC 1IHZA 5BR8Q 4JI2L 2DYOA 4GLAC 5IWAQ 1ZDXA 2JU6X 1WTXA 2DJFC 1TS2A 4WRDA 4S0RA 1CI3M 3K5LA 1HUNA 3K5OA 4JV5L 1L2FA 1SMYC 4DV3Q 2L11A 2F4VQ 2WXLA 4DV1L 4DNRB 3S16B 1PH4A 4LAAA 3IKJA 1L0XB 3KLWA 1G2SA 3QB3A 5GQOA 5DM73 4XQNA 2JA5H 1CT1D 4LF4L 1T3QA 3ZDTA 2D3BA 1SROA 1NBFC 1HZCA 3OMGA 2V0GA 4TVAB 1DOMA 3QK0A 3E6ZX 1O78A 3KUDB 5AZGA 1YD8U 4X3TA 1PXUA 4B6WA 3KWLA 2JEAI 5LLIA 3AMUA 1N33L 5FR6A 4KDLB 1BBUA 3CC7A 4B95A 5L95C 1E8XA 4O2DA 2ZPYA 3NG0A 2V4LA 4YT0B 1XD3B 1WMHB 1SYBA 2M17A 5ISRA 5T1GA 1C4PA 1GAQB 4EFOA 1IYUA 1KLVA 3TS2A 3E3XA 4ZRJA 1IGDA 2A68C 1RODA 4R4QA 3F1ZA 1WD1A 4ZDVA 2PMZE 2L8JA 3PO0A 2Z59B 2SDFA 4HROA 2KWUB 5BN5A 4EQOA 2NVTH 3S14H 5HY6A 3K9PB 2BYFA 1CKMA 3R2IA 5GXGB 2JT4B 4TUUA 1L4DB 4A6QA 2K52A 4MTNA 1CFMA 5IGFA 4PG3A 3OW2A 3WAMA 4A9AA 4DDGD 4QIWB 2JYOA 2EXDA 2GMIC 2I1KA 4NDXA 2K5WA 4V0BA 3UDXA 1N6ZA 1WJJA 2R7FA 3MEHA 1LT4D 3PCOB 5KYIA 3Q0AA 4YCVA 3RNBC 4BKGA 1DXMA 2NVQB 4QQBX 1SN8A 3AU7A 1CHPD 2OJRA 5ELFA 4PZ6A 1TWCH 1X55A 4R8NA 1D1KA 5LMNW 4OHJA 2BPSA 4JI5L 2L15A 4RCOA 4DK1A 1J5EL 1DOXA 4FXGC 2GVBA 1QVGA 5AEKB 5I2YA 5BMHA 3NOBA 3RLOA 1HR0W 4OX9Q 1MHXA 1D2BA 2CHZA 2E6XA 2R93B 2KOLA 4A3IH 2LVOA 3W1GA 5C4HA 3I4OA 1T0YA 4DKAC 4DR2Q 4M8MA 4IW0A 2ZM6L 4DV5Q 1F9PA 2HHHQ 1WTVA 4C3HB 2JZPA 4N8FA 2RMMA 1EZ6A 2KJHB 1VDVA 4A3PA 2KBNA 1QB5D 3HVZA 2CQOA 2Y0SG 3HIZA 4MEMA 1Q8IA 2AUJD 3KLRA 5CTRC 4GLXA 2F3IA 1VQGA 4DR7Q 4EGVA 1OQYA 2KFKA 3DWGC 4Q2JA 3MC0B 3Q3FA 3RFZB 4DHJD 4CJ2C 1GD7A 4HDQA 3Q3OC 5C0XJ 4EQPA 3SVMA 5CV7A 3WANA 3CHBD 1ESRA 2ZJPA 1UD7A 3DM3A 4K7WA 1ICWA 1MHHE 1FD6A 3QO2A 4RAUC 1SYEA 4LDTD 1BUVT 1ONLA 3QOLA 2LGSA 1NEKB 4IWPA 1M1KC 4HVBA 2KWVB 2Q5WD 1JT8A 1XT9B 4DPGA 3K5NA 1LLRD 3QWZB 4NXNL 1O7IA 4PNYA 2B63H 3DBRB 3NY5A 4RKBA 1PZKD 4KMUC 5JJLA 2EYJA 1WVLA 1UUPA 3PIOA 4QCLA 5BO4B 4WORA 3HKZE 1WYGA 1VQDA 2KENA 3NVWA 3TUOA 4POFA 2VQFL 3ZUNA 1WI5A 1D5ZC 1RDPD 3SU8X 1YHBA 1WJ4A 1FO4A 2ATWA 2DZIA 1CJEA 5D14A 3SDLC 1VZ6A 5IP9H 1UELA 2JA8H 4A3BB 3GZNI 4IDIA 5ELEA 2B2TA 3LGJA 1X3PA 2HCIA 4LFAQ 2E76C 2ALYB 2G9DA 3TZUA 3V2TA 5K36H 4A3FG 1QQRA 1DJRD 1R4NI 4IG7B 1IYJB 1I50H 4NKLA 4DV0L 3UI3A 4GLSC 2PZTA 1WD0A 4IWQA 1GVPA 2IL8A 3QJYA 1Y1WH 2BYTA 4GNXB 2CU3A 1A6XA 4CO7A 2EMSA 2WB1E 1HRJA 2LJ5A 2BA1A 3TN2A 1M4VA 4CGYB 4A3MB 3VR2A 1WCMH 1X3EA 1KJTA 2F4IA 3GTJB 2L0TA 4OZAA 3PO3H 1EEID 1OTCA 3X0WA 1S40A 1N36Q 5C1ZA 1EU4A 3RN9C 2F0OA 4FJVB 1TKGA 1B3QA 1JR0D 2D5DA 5ELOA 3S2AA 2B2UC 4J15A 3TP7A 1H4RA 2OOBB 2J53A 3ZNGC 1SF0A 2MSED 2I07B 2N0SB 4X65L 3KUPA 4LTUA 4GKKQ 4IPHA 2VH2A 5EE0A 1EIHA 4F87A 2NR2A 3DWPA 1HTLD 1ZXHA 1K50A 1PH3A 3O13A 2LMCB 3GTQH 2KQ7A 4F7XA 1OO9B 3VR9B 2GOWA 2L83A 3A5ZB 1FIQA 4J3OD 3AXCA 4DR3Q 3VRBB 1NDDA 5CHFA 3EVQA 5AFWA 1VQAA 4LFCQ 2M19A 1W6KA 1QZGA 1Q86C 2NN6H 2F0PA 1VR9A 2VY3A 3TIXA 1P16A 4KSKC 3AQQA 2BKFA 3ZNHB 3VR6A 1KL9A 2ZJQA 2PPHA 3Q3JA 4YWGG 2HUGA 3RNGC 1ACCA 4AYBG 5C44G 2ES2A 1KNEA 2H4OA 4BWGB 2DZJA 1K52A 2A6ED 4JV5Q 2PJHA 5J39A 3AE9B 1EYGA 2A68D 2HQLA 4R4TA 4RGMA 1OEYJ 1N8RC 1SE9A 2KHJA 2PYKA 3T56B 1YX6B 2JYEA 3U7DA 3U7ZA 2EY2A 1L0WA 5GADC 3C46A 4C3IB 2UXBL 4G11A 1DOLA 1RYJA 5JVG3 4BBRG 1XCQL 2M0AA 2FNJB 1FXTB 1D5XC 5CYUA 3AULA 4V190 3Q8CA 1IBKL 2RD0A 5FJ8G 2PE6B 1IKLA 3VXWA 2VNUD 4U68A 4KDIC 3DHIC 4B3SL 3NJTA 1LTGD 3CRLC 4IOCA 1E5WA 3TL5A 3CPWA 4UP9A 2OTJA 2KEEA 2DYBA 4D2KA 4A3GG 4LJPB 2JXTA 1MHWC 2WU2B 2F3WA 1E8ZA 3DPDA 3APDA 3BS1A 4A3EH 4BAXA 2N49A 1QUQA 1VQLA 4LF7L 3CCLA 1LGRA 3FPUB 1VMCA 2MH7A 5J3BA 1T6BX 1R4NB 5DCNA 3LDZE 1WZ0A 4DK6C 1XX8A 2QGQA 3ETRA 3L54A 2XBBC 1NAPA 2W55A 3CW2C 1QVFA 2BS4B 2AQ1B 2JA8G 4Z9CB 1F9QA 1GJXA 2FUHB 1KDCA 2JSOA 1VQ4A 2ACZB 4OL7A 1VD2A 2F0MA 1PFMA 1HQMC 2SNSA 3I63C 1A8VA 4X3SA 2JA6B 4KV6A 1E8WA 3K8AA 2FFKB 1I50B 1WXMA 4ZQ3A 3GTMB 2K25A 3Q23A 3VUWA 1E0ZA 3UDIA 5M5WH 1K3BC 2Z6KC 3HGBA 2XK5B 4JI5Q 1XMQQ 3RNAC 3GTQB 4GLVB 5IT9E 3MFYA 2XN9C 1QILA 4KD3A 1K0SA 3Q8FA 3KJOA 1BNZA 1HUMA 3P1HA 1Z2MA 2KJ6A 4FXCA 4OX9L 2NYZD 2SEBD 3KQ4A 4IPDA 1TQOA 2VL6A 4P73A 1YI2A 2NVYH 2AWNA 3BZCA 2B63G 2G4DB 3ND8A 3DBLI 1YJJA 4XT1B 1PH2A 1EWIA 3RZOH 1NI3A 2AMCB 1WTPA 2K8HA 2BDOA 3APFA 2QCPX 4ZRQA 4X64Q 3VH4B 1PYSB 5CBAE 1IL8A 2WU5B 2JPHA 4NPNA 4KHVA 2HQEA 1RTOA 3ENEA 3I2ZA 4FULA 2BTEA 2JJQA 1A0IA 5EQ0A 5JEAG 2RDFA 4IQZA 1LTTD 4BXXH 3AE8B 3UF8A 1P7EA 2JSVX 4X57B 5EE3A 2KK8A 1BQQT 4G50A 1C9FA 4G7OC 5C23A 2K5NA 4RMAA 5K36G 4A3IG 2OJWA 3BYYB 4PQXA 2VUMH 4ZYNA 3HOVB 2WXJA 3GE8C 3A7LA 2DNEA 1TTNA 2MLBA 3BWUD 2KTRB 3NTIA 1S1QB 2MHVA 3NPPA 3VVWB 2OCEA 4JW0A 1XCTL 2XTIA 1YJ9A 3HOUH 1MJEA 4JI8Q 4WJNA 5HKHA 1SJED 3CPFA 5C3EH 2L0FA 1VQ8A 3D4DA 5IY0A 2RSNA 4DUYQ 4H02A 2L7RA 3KWVA 3Q6SA 5IP9G 3QHTA 1IGCA 1Y8RC 5C4ZA 2VZAA 1J7CA 1BMLC 4FXKC 4LF6L 1WGRA 2MQJA 3DEOA 1AN8A 3W1BA 3PGZA 1NR4A 4ZRZA 4C7YA 2KLGA 5M5XH 3BK2A 2DGYA 1E7ZA 5EAYA 4FF1A 1V1OA 2SOBA 4L6TB 3SGIA 2K0PA 4GOPA 2R61A 5M3FB 3TMPB 4MDKE 3EHVA 4K6LA 4BS9A 1WGGA 3ZQ4A 3EFCA 1IBLL 3AB5A 1CZPA 5J17A 3LXFA 3PSIA 2E75C 3TREA 2BS2B 1PZJD 4DV0Q 2EXZA 1QJOA 2QIEB 3CIRB 2C35B 2L3ZA 4WURA 4LUVA 3WOFA 2GVAA 2RDHA 4FF4A 3IBEA 1MI2A 4WAFA 3R3MA 3UQAA 3MXGA 1M8AA 4C1NK 1A3UA 3A54A 2K8CA 2FCQA 1YITA 1JORA 2FIDA 4DQOC 1EY0A 1FXIA 2IGGA 2EPBA 1PV4A 3F2UA 3CC2A 4UY8C 2CHWA 1YNNC 2WKDA 3TDQA 2LGDA 4PYZA 2B76B 3R7QA 4ANUA 4K8IA 1VQKA 2KXJA 2AHOB 3MC8A 3KF8B 3L16A 3JAMc 2JXMB 3FKIG 3CCJA 4WJPA 2EYPA 1OQRA 1FNUA 5EJWA 5IGCA 3QJZA 1C78A 3D6CA 3IFTA 4K3BA 2E2IB 2KMCA 1B3AA 3SK6A 5ELDA 4CKCA 4NPSA 5L37A 3HOVH 1E7PB 4XGAB 1GJZA 1T0RC 3TP8A 1N61A 5LXHA 1L2NA 1CKNA 4HKQA 5AJ3Q 2LFNA 1Q81C 4Y7NB 1S5FD 1N34Q 4IURA 1FJGQ 3AFPA 4A3BG 3MHSD 4TKOB 1I5FA 4XQJA 1GC6A 4I65A 1R9TH 1E7VA 2AX5A 3HK0A 3WAOA 2SAKA 4R8IA 4OIJA 4DN4M 1TKEA 3CMEA 1ZGUB 3MA2B 4HK2A 1CSQA 3OPOA 1O7LA 1MD2D 1AZQA 4RM8A 5JVH3 4JG2A 4PMCA 4Q0FA 3CC4A 4NAMA 3NBHA 4XXEA 4PK1A 3K57A 1V2YA 2EY1A 1IPGA 1WTWA 4IZ8A 4A3KH 4XWWA 4DF7A 4JI7L 4JC0A 2BCOA 2H88B 3QA8A 4MZ9A 4WWOA 4CHKA 2PQAB 1SRUA 3ZXRA 4PYUA 1B7YB 3RI7C 5G3LD 1EOVA 2UXBQ 3IAS1 2KLCA 3S2DB 2JWZA 4L5QA 5I9PA 5E6PA 1EQVA 1EUJA 1A3TA 1H9JA 3L7ZC 4HJ5A 2KEDA 4A3DH 2L55A 3HEJA 1LXDA 2ON8A 3AV8A 3OSOA 4L5RC 3VA7A 1X54A 4MTKA 1E6EB 1V81A 3IT6B 1YNND 2UYZB 3ML8A 3P4PB 2N7EA 4KIKB 5IIFA 3LWEA 2W3RA 4WWPA 2WP9B 4QMGA 4QY7A 3N52A 3P42A 2K14A 2NVXH 1W3SA 4KGRA 2LI5A 3QIAA 1IXRA 2ICIA 4MGZE 2EKIA 2I5HA 1TYGB 5BYRA 1TWHB 3GO5A 3RR5A 5CORA 1SNCA 1E9MA 1LTAD 2ASBA 2FAZA 1II3A 4HPMB 3EECA 4DR5L 4NNJB 2J42A 2B2VA 4KSLC 1GM5A 2MP2A 1TWGB 2DBYA 3DVNU 4BZAA 4J6HA 2N7DA 1PTOF 3Q6BA 3FMCA 1NVID 3GV6A 1DOIA 3ZJVA 1UWVA 4PS7A 2ID0A 5F2DA 1WXAA 3RNFC 1SE8A 2BWFA 3VR4A 2LXAA 5C4XH 4HJ9A 5C4XB 4C2MB 1B53A 2O6VB 1E1TA 1RKNA 4IO9A 1C77A 4HJAA 2IO3B 1TU2B 4FLHA 2HT1A 5E7NA 5JEAH 1P9DU 2HDLA 1F9RA 3CRKC 1AW7A 2Z8LA 4CKEA 1HZ5A 5FLXc 2FMMA 2LHDA 2WAQG 4WJOA 4WH4A 4DHZE 2F0EA 3G7LA 1FRDA 4UP8A 2EE1A 4NXMQ 5COYA 4A3KG 1FNWA 1NUCA 3STBD 2MBHA 1C4AA 2KYWA 4FJYA 3MXUA 4PMWA 4X3UA 1ZYRD 3G48A 1OFFA 2J4XA 3E9IA 4JLCA 1T5XD 3QG1A 1PRTC 1AH9A 5I9OA 3U4EG 4K5XA 4B3ML 2MCNB 2UUAQ 1LT3D 2N9LA 2WXPA 1SE2A 3PHWB 3K9OB 3N3KB 2GBKA 3IL8A 1ZW7A 5H8YE 3TP6A 3DCGA 4B3TQ 1WFQA 4K5WA 4C3IG 4A3CH 4EZKA 4W9EA 4B3RQ 2UXCQ 3S15H 2L0CA 4LFBQ 3HOXB 3SXHA 3L17A 2NBFA 3NTKA 3HOVG 2L1AA 1L1OA 2Q2HA 4JBJA 3I56A 2WNMA 3ZXVA 2AWOA 1BOSA 1EZ8A 1U4MA 3Q2AC 4X62Q 3JAML 1N60A 5IOIA 1PFDA 3OW7A 2A6HC 3WA0A 2BYVE 3VQIA 1HH2P 2JA9A 2VQEL 2YEPF 5AZFA 5J2RA 2K6QA 4AOFA 3RD4A 3N9YC 4WJWA 4F1SA 3PUXA 2UUCQ 3J81L 4ZKCB 4G0NB 2KMMA 1C4QA 3GTLB 4YHHL 2L32A 1IBXB 2AL3A 1Q0WB 3H91A 2YU9B 4BY7B 3QCAA 2Z0SA 1SIFA 2MJ8A 3Q14C 4DR1Q 5I4DA 3PRMB 4BBSB 4JI0L 1C48A 4LDTB 3K0XA 3O65B 1HTQA 2WHIA 2K3UA 2F03A 2KN4A 1HZ6A 4KJOA 1VZ8A 4CDCC 1Q12A 2LEKA 1VRAB 5DNFA 4FF2A 4B9KA 2N9XA 3PGEA 3OIPA 4YWMA 4BBNC 1Q3LA 5M5YH 5JJZA 1XPRA 2IWHA 4ZYSA 1XF5L 3M4QA 2ZZPB 5C3XA 3APCA 3LWUA 1MJCA 4JE3B 2NTSA 5C44H 3QC8B 4IFDJ 4DUZQ 1KRHA 3S1RB 2RF4A 1RIPA 1HNZL 3F2BA 4XZ4A 2F4VL 2WIIB 3PO2H 3VYSA 3W5OA 4C3HH 3EJIA 4RFBA 1AARA 1L4ZB 3R66C 3DEPA 1AYFA 1IBXA 1WRIA 4BY7G 2PTLA 2MQHA 1G91A 1ZP0B 3J80i 2FMCA 3WOEA 4A3GH 1GB1A 3A4SC 3HRDD 4W9FA 2R92G 3AB9A 2KQSA 3Q69A 1VQCA 4MELA 4CQNA 4GDKB 1W6JA 3KLSA 2LGYA 5EPJA 4OWTB 1EF5A 3GB1A 1GB4A 1STNA 3LNNA 1KC8C 1RCVD 4PS8A 3NZ3A 1EYAA 2IO2B 1XLPA 1SYGA 3T13A 1SR3A 5D7GA 1K3RA 4AUQC 3TCAA 2ZCBA 1HR0Q 1X65A 4A3MG 3EIVA 3J9CA 4ICUA 4YSYB 3I90A 3CSTA 1EEFD 3HOZH 2K05A 1H9SB 3CU7A 4MGYE 3C0RB 3S14B 2NVTB 4FYDA 4HJGE 2MNAA 5A2QE 1F2YA 2MWSB 1SNQA 2A69D 4IC7B 4MM3B 4HCPB 2JA6G 2IHFA 3CCSA 2DZMA 2AYOB 2KFJA 3S9WA 5EPLA 3HOUB 4XC2A 1IW7D 4KKSA 5M5YB 1Z47A 4GOCA 4C1NI 5FOBB 1EYCA 2D0OA 5K5PA 1IYVA 1WX8A 2Z4IA 2V1YA 3CSFA 4K3CA 2QDLA 2AQ2B 2WS3B 4P74A 3NUHB 3H94A 4WFN3 1EWCA 1JCKB 3BDLA 3ONAB 1WR1A 5HG2A 2C7MB 3RN5A 4AQ7A 5D3IB 1SNDA 1X3FA 1J5EQ 4C3HG 1SEBD 2CHBD 2ZTDA 3TEHB 4LF9L 1N32Q 4ASWC 1E7UA 1OEYA 2KTRA 1OXVA 5G55A 4L23A 4USAA 2B3AA 4AJYB 2NUCA 1JALA 1AFPA 1IYFA 1CK1A 1LYLA 2KJXA 1MSGA 4DAMA 1Y69U 4HRSA 2BBCA 2I2YA 1SGHA 2MP1A 1JB7A 1UWXA 3NBHB 3DXJC 2E74C 4DR7L 3A9JB 1B4OA 2D2CC 1I94Q 3VRAB 4MJSA 3DWMA 2ZTEA 4JYAQ 4P1CC 1YJ1A 4ANXA 3SE0A 3BVZA 1YQ4B 2RDBC 5J1ZA 2H1EA 3I91A 1WY8A 1YOVB 3LB8C 2IJ0A 3KYHC 2BT6A 2V3NA 4DDID 2CWPA 2LVQA 3S1QB 1B8AA 1G6ZA 3AEDB 1RHPA 1UWMA 1PGBA 4HIDA 2N9EB 5IT9c 3OYYA 3K81C 5J22A 1I4HA 2RHSB 1QOHA 2EYFA 1G291 3C19A 3RZFA 1KAAA 4JWSC 4DK5A 5H1SE 4JCVE 1PTOD 2QILA 2Z6BA 3P63A 2ICEC 2EKEC 2TMPA 3D6WA 1XNRQ 4FO2A 1BCPF 2ZXRA 4ACFA 3U9SA 1ZXTA 4QUFA 3ZNID 3PO2G 2HE7A 3UIOB 1YNJD 2I1JA 1T0QC 1E2ZA 4NXML 4O1NA 2D5GA 4W9GA 4B0MA 3P1MA 1OTRB 2PCFB 4U673 3EUB2 5IKCM 2OQKA 2XWBB 1TT5B 2GBMA 4DHZB 2D9UA 4JI3L 1JC7A 3KJPA 2KDMA 1CZGA 3S1NH 3W5UB 1ML0D 5GAEC 4K0KL 2N78A 3DWAA 3FILB 5BN4A 5IP4D 3T1HL 1Q1OA 3KUCB 4I6NB 2ZPNA 1GNUA 3FHWA 3NZSA 3AH7A 4KY6A 3CAMA 2R92B 1KF6B 1WX7A 1KHIA 3M7NA 1RFAA
chains in the Genus database with same CATH topology
4XTCS 3FEWX 1HQRD 3T53B 3I4MB 1D5MC 1S5ED 1H9MA 4AS1A 5MPOA 1SYFA 2EJMA 1SXTA 1ILQA 3BZDB 5CV4A 5AUIA 5BYQA 3CQZB 3H0GB 2FJ2A 1RWSA 1GUWA 2PMZB 1TVXA 3D4WA 4YSXB 2F0FA 1U4PA 1JW9D 4X3KA 1SE3A 1H9KA 2K7VA 4OO1G 3BK1A 3AECB 1K53A 4ZOHC 1PTOC 3E5SA 1S4ZA 1TKWB 1HFGA 1C79A 4FVMA 4KHZA 1KABA 1VLBA 5LL6X 1F2RI 4S3SA 1O7YA 3TMEA 5I6WA 2PKOA 4ULLA 1QE6A 3I9V1 3M3YB 4A55A 1EFID 2PIAA 3ABVB 1LV9A 2ONQA 2BB5A 1QT9A 5FO8B 4YTMB 5CV8A 3AE2B 5A2QL 2J0TD 2DLBA 1HFNA 1I7HA 1O80A 1A3VA 5C3JB 1O7ZA 1SMYD 1TY0A 1I4GA 1WWTA 5I6YA 4MIUA 4N58A 2PW7A 2QEJC 2JE6I 5JPNC 3K0YA 1PZID 4K8JA 4OO1I 2EELA 3X3NA 5JOBA 5HFYA 2LY7A 4DU9A 3T3OA 2Q8IB 3W9CB 2MUYA 2L9HA 2Y0SB 4M8AA 2E3TA 3AE6B 2XWJB 4HEDA 4R3DA 1H9RA 1NR2A 2PW5A 4IFDG 5E3FA 3AE5B 2RKSA 2AQ3B 1OXSC 4ILWA 2K5PA 2B8FA 5G5GA 1RD9D 3D8GA 2OF1A 2JYTA 2K5QA 5HHDG 4ODGA 3HVDA 3TEWA 2QJLA 4BA2I 2EJGC 1DCZA 4FNFA 3VYTA 2PZWA 4IFDI 2F0LA 5EKLA 1STAA 2XRSD 3MWYW 4GDLB 5A35A 3NBIA 2W3SA 4ZRPA 3PZ8A 3OMCA 5JEAJ 1TR5A 3HKZB 3SHLA 2OEOA 2X69A 2PW9A 2LS01 1A2UA 2L4NA 4L1BA 2A5HA 1YMHE 3C2PA 1ET6A 4ME5A 1GHJA 4K5VA 4LLGM 1G8ZD 2LMCA 1I4PA 1IKMA 3P7JA 3HUIA 3AN1A 1PFBA 1NYRA 3KBXA 1KLGD 1AEXA 4ITKA 1KNAA 1TKYA 5T8IA 4HSVA 3IFDA 1FGBD 5D3DA 1CM9A 1V8QA 3P20A 3T4AC 1VF5C 1LT5D 4NMZA 3E9SA 1PTOB 2F0GA 2YYZA 2A6HD 1XWEA 3Q8EA 4HEA1 2KA7A 4N9PA 1PGXA 1DD2A 1N62A 2WXFA 1EY8A 3EFXD 2PVOD 3OOCA 2O5JC 3NK9A 2EDGA 2G9HD 5JXVA 1L6VA 2Y5CA 2EJFC 1AP0A 2VXWA 1EOTA 2I46A 4ABNA 2PVGC 5HGTA 1QNUA 2NN6G 1JQ4A 4XYOA 3K5MA 2KAJA 1HCZA 2B2TC 1KFYB 4CBVA 3SR1A 2WXNA 1T5EA 3FAHA 1HPCA 2CVRA 1N5WA 1S5CD 2Q8TA 3AEGB 3AM9A 3C1FA 4NAWB 3A56A 4KN7C 1PTOH 5C3WA 2IT1A 4OW0A 2INPE 2BA0A 1BCPC 5EBDA 3B9JA 4I7ZC 2WXGA 2EYHA 3TEXA 4XT3B 5C6AA 5T1IA 2K04A 3R8BA 2WDQB 2WP8J 1SSOA 1QOGA 5IGDA 5CMDA 2NZ1D 3BDCA 4ARIA 2A74C 3KK7A 3Q22A 1YN4A 5HI1A 1WTRA 4KKUA 1L6UA 5KNBA 1N5XA 1MPEA 4IUVA 4N59A 1LTRD 5G3LF 4YXDB 1BCPB 1AWDA 1EY7A 2B8GA 3WDNA 5CV5A 4KN4C 3U2SC 2CQAA 1JE4A 2JA7B 1IW7C 2FHTA 1K8OA 4B9WA 2LGIA 3NQIA 3NTHA 1PGAA 2PMVA 1EY4A 4EVOA 1FCCC 1WSPA 1V1PB 2F0IA 4C56C 4B0EA 1EY6A 1ZE3D 2LUMA 1PRTF 2EZVA 5KEEA 1STEA 2AUKA 1BBXC 2N88A 4MT5A 3T16A 2Y3AA 3MXPA 2B63B 1BDOA 4RH6A 1XXGA 2GRIA 2INNE 1DONA 3LX0A 2V4IB 1QOAA 4DAPA 3S2HB 4K2KA 1EWYC 4KJNA 5EKKA 1SDFA 4A3GB 5D65A 3LYYA 2WACA 2N9KA 4LK0M 1D6EC 2BE5D 3X3MA 1ZEQX 3FRPB 2BOSA 2BE5C 4LK1C 1D4BA 2KACA 2NWGA 3GD7A 4BBRB 3HS0C 2RVLA 2VZKB 2HCCA 3HOZB 2IDYA 2MEKA 2B2VC 1Y1VB 1TS5A 3DMUA 1QLBB 2ZW1A 3NVZA 3V05A 3P4QB 4RGOS 2N55A 3H8HA 1TJEA 2G1EA 2EYOA 2K33A 4XDXA 3TZDA 5IGGA 1DGJA 4TQ0A 2K03A 1F2LA 3MZ5A 4KY7A 4US8A 2WXQA 4A3JB 2F0JA 2OXPA 3RZOB 3HOWB 2WXOA 5C3EB 3W5VB 4IN3A 2K6AA 3EROA 5M3MB 4R9WA 5CV6A 2ZW0A 2ENBA 4IALA 2XVSA 3I4NB 1A15A 3RUZA 2VB3X 5FO7B 1L5PA 4YSZB 4US9A 3BG3A 1KDBA 1S5BD 2BB6A 1EYDA 3NS1A 2R7ZB 1B9RA 3I72A 3L9AX 1ZOYB 2W82A 5FR3A 3PIP3 4RCNA 1FM0D 1XLQA 3E56A 3K58A 3R2TA 4OZBA 2ZXPA 3PUWA 5DEHA 1ENFA 1TT2A 3H09A 1RF2D 3HRZC 3VYUA 3OWEB 1G2TA 1Y8PB 3J7AV 2CJOA 1PDQA 3D31A 4JPSA 4NW2A 2RA4A 2KCNA 2IX1A 5E6JA 1ENCA 1ILPA 5DAUA 1V1PA 2WINB 1TIID 3MVVA 1GUTA 1DM0B 2PNRC 4A3FB 2EY6A 1EU3A 2RDGA 1WXQA 2QDBA 1WTOA 5EGTA 3A8KE 4K2LA 2IX0A 4ZLTF 1NCVA 1XYIA 2WDRB 2JX5A 4HTHA 1GHKA 1FNVA 2IX3A 2QF7A 3D3RA 2WQYB 4XIGS 1A2TA 4ARCA 2JQRB 2PZUA 1K51A 1I4XA 2B2WA 2O5IC 2QSDA 2O2LD 4HR7B 3W3AA 3M4OB 2M00A 1XEEA 1LTSD 3VA5A 2LFIA 1BCPD 4DGZA 1ESFA 2F0KA 4B9XA 1LO5D 1CZWA 3M4YA 5EPKA 1CQVA 4XE0A 3PO3B 1PRTB 4EE2A 4H13C 3Q8BA 2WXMA 4XQQA 1S5DD 2DY7A 5IGEA 3TP5A 3E0JA 2Y5PA 1JMLA 3SFDB 2A6EC 3BDOA 1HA6A 5C2TB 2E2JB 2VB2X 2K01A 1KH0A 2WKCA 2CW0C 3MTSA 1I4QA 3A55A 2JA8B 1STYA 3MP9A 5LNK1 1GUGA 2C5CA 1JWBD 2CJNA 4L63B 1Q1EA 1E0BA 1VDZA 4IOIE 4K14A 3EA6A 3C1EA 2F0TA 1QF6A 1WCMB 2HDMA 1R9TB 3A8IE 5TSSA 2GI9A 3NHHA 4P6VF 4H0LC 1V8CA 4NP5A 1CQFA 1EWHA 1E2VA 2B2YC 4H44C 4XYQA 1YN5A 2PQEA 4KGTA 5H92C 2L1BA 2FUG1 2KQ4X 1RTNA 3K59A 2NTTA 1FEHA 1SYCA 3NVYA 4REZA 1HEZE 1TS4A 4QF4A 2N7JA 4JK1C 4JWUC 2RSOA 2EY5A 1PDXA 1QOFA 4M0WA 4WIPA 2KHSA 2OHFA 2E2DC 5E4WC 1GUOA 1PUTA 2F0VA 4HN7A 3AE4B 3ZGZA 1EY9A 5M9OA 3SDZA 1HHVA 2BS3B 2Q8RE 4XDDA 4RA8A 1E2WA 1BF4A 2O4XA 1OXTA 1ZKOA 1VCIA 2E2HB 4Q5VA 2WB1B 2C9OA 2K32A 5FK9C 1FXAA 3J7YW 3J80L 2LKVA 1JWSD 3C3LA 2K28A 2PPBC 3RZDB 3VR5A 4DAVA 5M5WB 1VZ7A 4HSPA 4IUQA 2B2UA 1GPXA 3R3OA 4A3IB 1C76A 3AEAB 5EE9A 1XLNA 3HOYB 1YJIA 2WXHA 4A93B 2DY8A 5KYLA 2NN6I 1B2TA 5IODA 2JA5B 2MJEA 2RPVA 4G7ZC 3CKIB 2WXKA 2F0DA 2XRQD 1L0VB 2BDNA 2Z4HA 2QMTA 1BR9A 3R93A 1B44D 2IGDA 4FF3A 4KTAA 1QCBD 3HP3A 5C4JB 1KLUD 1U4LA 1VJKA 1V43A 5EKIA 1YNJC 5E1FA 3P4RB 3A7AB 2GA4B 2L52A 2HDEA 1P7FA 2DN8A 4N9TA 1D1IA 4BY1B 4RGTA 1FR3A 1Q90A 1J7BA 1JOOA 3NWTA 4WQMA 1CA6A 2R6GA 1J8IA 2V3PA 1UNSA 3SK5A 3MHZA 1JB3A 1R4PB 1MBYA 2I38A 3D4RA 1B9MA 1PLFA 4ZAIA 1EM7A 1DYQA 1Z7TA 5IGBA 3VYRA 1XLOA 4RWSC 4YTNB 4C3JG 1ROEA 3GTGB 2NB0A 1I4RA 4RF0A 3OWFA 4HAEA 3J81E 3J7AF 4RNAA 1E10A 3I73A 4O42A 1Y56A 5IOCA 1B1ZA 4KI0A 4CHTB 1CA5A 5C5MA 4DAYA 2JEBI 2F3VA 4KK7A 3B2GA 1XTCD 2B2YA 1SNPA 3I4LA 3K7AB 3AMZA 3M85A 2FBWB 1TWAB 2MJ3A 4KD4A 2KVMA 4OZCA 3FPPA 3MAQA 5NUCA 2FE8A 4G4KA 2J7ZA 4XDCA 4G57A 1QKZA 3SFEB 5EE1A 4KKJA 1Y1WB 3ERQA 3RPFC 2PLPA 2OEDA 4KX6B 4P16A 2EYLA 1BUIC 1PYWD 4A3DB 1TZOA 3KLSX 1Q10A 3AE7B 1BO0A 1WGKA 2CW0D 3ZYYX 1J7AA 2ZT9C 3GTOB 2JP1A 4H7BA 1JICA 2J52A 4YIJA 3IT4B 1I3QB 3URYA 3IXSA 4J8QA 4NJCA 4ZHPA 2LJIA 2HTME 2VZKD 4MACA 2W54A 3V96A 4PV1C 1MVKA 1HA5A 1I6HB 1SB3C 4DNTB 1RM6C 4KKTA 1CTMA 2F0NA 2MGSA 3DHQA 1IUEA 4J1MA 2MJDA 3QOJA 2V4DA 3FDTA 2K9XA 1SYDA 5EBCA 4RHRA 3S1MB 2D62A 2LHEA 2EVBA 1K8MA 1F9SA 1F0ZA 3AE1B 2A73B 2DWQA 3GTPB 3PIO3 3MFGA 5JPMC 2VUMB 4FP5D 4G7HC 3A8JE 1TWFB 2B2WC 3WCQA 2JWUA 2PO4A 3NE5B 1ZUD2 3FC4A 5C0XI 1TWCB 3I57A 1B50A 1UAPA 1JWMD 2F0QA 3EGRA 1ENAA 4ZHOA 4LJZC 3U52E 3QWNA 1LABA 1EL0A 4FXDA 2L12A 3AE3B 4UDUC 1HXYD 1V97A 2RBMA 3ND9A 5HURA 1F2RC 4CJ0B 2KWDA 4OO1H 2XIWA 1QWYA 2FINB 1I6VC 1STGA 4IUUA 3NVVA 1NYQA 1WTQA 4BA1I 1L0YB 4CJ1B 2IW3A 4QUCA 1YQ3B 1GXDC 1OXXK 4ZK9B 1YNTE 5C5LA 4A8XC 5IT9L 3PUYA 5KNCA 2WDVB 1NSNS 3RLFA 3JAME 2Z1CA 3GQBA 5FLXE 2BW2A 1SAPA 1FFVA 4C7ZA 3DM1A 2WXRA 4DA2A 2M56B 1FCLA 3MXNA 3B2FA 4QB4A 1X3QA 2M9VA 5CGKA 2EOTA 5ELCA 3NRZA 1FMAD 4IUPA 3V3XA 1Z6HA 2K5DA 2NVYB 3ZJTA 4DXGA 1LTBD 1X32A 3SR6A 1Y8OB 1QOBA 3TEYA 1FFUA 4AYBB 4ID6A 3KBGA 2B39A 3J80E 2XNAC 3L4PA 2KCCA 3Q8AA 1DOYA 3SEBA 3N6RA 1JRPA 4RGNA 3HG9A 2F1MA 3CWIA 1EY5A 3HZXA 5LL6S 3TSSA 4HKZE 4L8JA 5CV9A 4JBWA 2F0WA 1H9SA 1J9OA 3BVGA 5BYSA 4TQUS 5FO9B 4UAIA 4ZUIA 2KQ3A 1RJTA 3BVMA 5BMGA 1HTPA 4KY5A 4JX1C 3OIQA 5KIXA 3VR3A 1JROA 1EQTA 3AEFB 3H6MA 3PMFA 2KECA 3U9OA 1QG7A 1ZYRC 3S1NB 3C8YA 4IUTA 3DUZA 3I8ZA 1RFKA 3GV3A 5I2XA 1PMRA 2RQXA 5KRUA 3FILA 1QNKA 4DK0A 4ZKBB 4K6DA 2KUMA 1ZPSA 1TY2A 1JWUD 3G6JB 4ZUJA 1ZXIA 4IUNA 4PT5A 1CHQD 1LT6D 5AUKA 3PV0A 2NMQA 1JOKA 3NQTA 4TSSA 4HCEA 3RMHA 4TMAB 1FRRA 4HMJA 3M7GA 4TRDA 2F0HA 1A70A 3AEBB 3H3VC 1R7SA 4LMQD 3PUZA 4TQ1A 1NENB 3ITPA 1AZPA 1MI0A 3T3NA 5FLXL 4L2YA 4C80A 2A69C 4GZYC 3MJ5A 4A3KB 1SBBB 2R3ZA 1OQQA 2L5TA 4B08A 3ZJUA 3IAYA 4RF1A 1EIGA 1K83B 3S17B 3P75A 4HMIA 2QKIC 3GP7A 1VF7A 1B9NA 5KNDA 3GTKB 2ZXOA 4DFAA 1LTID 4H2AA 1SNOA 5CC4A 1F77A 5E4XA 3TBIB 3OHXC 4OGQC 4XWTA 3AEEB 3PO2B 5ELBA 4HCSA 3SK8A 3NXWA 4MN3A 4C3JB 5LHY1 1STHA 1JOQA 1C4CA 4RHSA 2TSSA 3UI2A 1UGJA 1F2MA 5CR3A 1JQYD 1DOKA 3IAM1 3KF8A 2X38A 1SNMA 3PUVA 4MHEA 3GS2A 3Q24A 5DM63 1U9RA 3NWSA 2YEPB 3NUCA 4IFDH 2DYMA 4EQNA 2WAQB 1OXUA 4WWMA 3NP8A 2WLBA 1YN3A 2X6LA 5M5XB 3BIID 4IKGA 2OT2A 1FYCA 3I70A 4OIKA 5C44B 5KGUA 3DWQA 3T51B 3TEZA 1R4QB 2EYMA 4CKBA 4F8MA 3PZ7A 3EQLC 2X6GA 3S15B 1PFNA 2M2LA 5G5HA 1GUSA 1SFOB 5BN3A 2H89B 2SNMA 4RKLA 4YTPB 1ZDVA 3FKIB 3FVQA 1TS3A 1XO3A 1SE4A 1PRTD 4MH8A 2K1BA 1SIJA 1VMPA 4E6IA 2IPKD 2IGHA 4OVZA 1C8CA 1GOZA 3MHBA 1BXTA 4M1UB 3P4SB 2F0SA 4F88A 4DXFA 1SJHD 3I3CA 2XSCA 4A3EB 1JWAD 1ET9A 4NZLB 2WV6D 2WXIA 1MGSA 2F0UA 3W1SA 3BYTB 3L3OC 1STBA 1SSNA 1KDAA 2MPMA 4N6EB 2K22A 5CBEE 1UEAB 1N63A 3W2DA 1FD7D 4P2CB 5C0XG 1Y8NB 3K6OA 2NVXB 3NSWA 1MSHA 1F2ZA 5FKAC 3SK4A 1Q1BA 5JAVA 1KTKA 1LACA 5BMIA 3VR8B 1U4RA 4KKIA 5C0XH 1DZ1A 4KGSA 4PMBA 2DNCA 1GUNA 1IHZA 2DYOA 1ZDXA 2JU6X 1WTXA 1TS2A 4WRDA 1CI3M 3K5LA 1HUNA 3K5OA 1SMYC 2L11A 2WXLA 4DNRB 3S16B 4LAAA 3IKJA 1L0XB 4XQNA 1G2SA 3QB3A 5DM73 1T3QA 1CT1D 3OMGA 2V0GA 1DOMA 3E6ZX 1O78A 4X3TA 1PXUA 3KWLA 2JEAI 3AMUA 4YT0B 1SYBA 5ISRA 5T1GA 1C4PA 1GAQB 1IYUA 1IGDA 2A68C 1RODA 1WD1A 3PO0A 2SDFA 4HROA 5BN5A 4EQOA 3R2IA 5GXGB 4A6QA 1L4DB 1CFMA 5IGFA 4A9AA 4QIWB 2JYOA 4NDXA 2K5WA 4V0BA 2GB1A 4A90A 3MEHA 1LT4D 5KYIA 3Q0AA 1DXMA 2NVQB 3AU7A 1CHPD 5ELFA 4R8NA 1D1KA 4OHJA 4DK1A 4RCOA 1DOXA 4FXGC 5I2YA 5BMHA 1MHXA 1D2BA 2E6XA 2R93B 2KOLA 5C4HA 1F9PA 2JZPA 1WTVA 4C3HB 2RMMA 1EZ6A 1VDVA 1QB5D 3HVZA 1Q8IA 2AUJD 3KLRA 4EGVA 3DWGC 4Q2JA 3MC0B 3RFZB 4CJ2C 5C0XJ 4EQPA 3SVMA 5CV7A 3CHBD 1ESRA 1ICWA 1MHHE 1FD6A 3QO2A 4RAUC 1SYEA 1BUVT 1ONLA 3QOLA 1NEKB 2Q5WD 3K5NA 1LLRD 4PNYA 4RKBA 1PZKD 4KMUC 2EYJA 1WVLA 1UUPA 4QCLA 4WORA 1WYGA 3NVWA 3TUOA 1D5ZC 1RDPD 1FO4A 1CJEA 5D14A 1VZ6A 4A3BB 4IDIA 5ELEA 2B2TA 1X3PA 2HCIA 2E76C 3TZUA 2G9DA 5K36H 3V2TA 1QQRA 1DJRD 4NKLA 3UI3A 4GLSC 2PZTA 1WD0A 2IL8A 3QJYA 2BYTA 2CU3A 1A6XA 1HRJA 2BA1A 3TN2A 1M4VA 4CGYB 4A3MB 3VR2A 2F4IA 3GTJB 4OZAA 1EEID 1EU4A 2F0OA 1TKGA 1JR0D 2D5DA 2B2UC 3TP7A 2J53A 1SF0A 2I07B 2N0SB 3KUPA 4LTUA 5EE0A 1EIHA 4F87A 3DWPA 1HTLD 1ZXHA 1K50A 3O13A 2LMCB 4F7XA 1OO9B 3VR9B 2L83A 4J3OD 1FIQA 3VRBB 3EVQA 5AFWA 2M19A 1W6KA 2NN6H 2F0PA 1VR9A 3VR6A 4YWGG 2HUGA 1ACCA 1KNEA 2H4OA 4BWGB 1K52A 2A6ED 5J39A 3AE9B 2A68D 4RGMA 2JYEA 3U7ZA 2PYKA 3T56B 2EY2A 3C46A 4C3IB 1DOLA 1RYJA 5JVG3 1XCQL 2M0AA 1D5XC 5CYUA 3Q8CA 4V190 1IKLA 2VNUD 4U68A 1LTGD 3CRLC 4D2KA 2KEEA 2JXTA 2WU2B 2F3WA 3BS1A 3FPUB 1VMCA 2MH7A 1T6BX 1XX8A 3ETRA 1NAPA 2W55A 2BS4B 2AQ1B 4Z9CB 1F9QA 1GJXA 1KDCA 2JSOA 2ACZB 4OL7A 2F0MA 1PFMA 1HQMC 2SNSA 4X3SA 2JA6B 4KV6A 2FFKB 1I50B 4ZQ3A 3GTMB 3Q23A 1E0ZA 3HGBA 3GTQB 5IT9E 3MFYA 2XN9C 1QILA 4KD3A 3Q8FA 4FXCA 1BNZA 1HUMA 3P1HA 3KQ4A 2NYZD 2SEBD 1TQOA 2AWNA 3ND8A 1YJJA 4XT1B 1NI3A 1WTPA 2BDOA 4ZRQA 2QCPX 5CBAE 1IL8A 2WU5B 4KHVA 2HQEA 1RTOA 2BTEA 5EQ0A 5JEAG 2RDFA 4IQZA 1LTTD 3AE8B 1P7EA 2JSVX 5EE3A 1BQQT 1C9FA 4G7OC 5K36G 3BYYB 4PQXA 3HOVB 2WXJA 3A7LA 2DNEA 3BWUD 3NTIA 2MHVA 3NPPA 1XCTL 1SJED 3D4DA 2RSNA 3KWVA 3Q6SA 1IGCA 5C4ZA 1J7CA 1BMLC 4FXKC 3DEOA 1AN8A 1NR4A 4ZRZA 4C7YA 3BK2A 4FF1A 1V1OA 2SOBA 4L6TB 2K0PA 2R61A 5M3FB 4K6LA 4BS9A 3ZQ4A 3AB5A 1CZPA 3LXFA 2E75C 2BS2B 1PZJD 2EXZA 1QJOA 2QIEB 3CIRB 4WURA 4WAFA 3WOFA 2RDHA 4FF4A 1MI2A 3MXGA 1M8AA 4C1NK 1A3UA 3A54A 1JORA 4DQOC 1EY0A 1FXIA 2IGGA 2EPBA 3F2UA 1YNNC 2WKDA 3TDQA 2B76B 4K8IA 2JXMB 2EYPA 1OQRA 1FNUA 5EJWA 5IGCA 1C78A 3D6CA 3IFTA 2E2IB 1B3AA 3SK6A 5ELDA 4CKCA 1E7PB 3TP8A 1N61A 4HKQA 2LFNA 4Y7NB 1S5FD 4IURA 4TKOB 4XQJA 4I65A 2AX5A 2SAKA 4R8IA 4OIJA 4DN4M 1TKEA 3MA2B 3OPOA 1O7LA 1MD2D 1AZQA 5JVH3 4PMCA 4Q0FA 4NAMA 3NBHA 4XXEA 3K57A 2EY1A 1WTWA 4IZ8A 4XWWA 4DF7A 2BCOA 2H88B 5G3LD 3IAS1 3S2DB 5I9PA 1EQVA 1A3TA 1H9JA 3L7ZC 2KEDA 2L55A 3HEJA 2ON8A 3AV8A 3OSOA 3VA7A 1E6EB 3IT6B 1YNND 3P4PB 5IIFA 3LWEA 2W3RA 2WP9B 4QMGA 3N52A 3P42A 4KGRA 3QIAA 2ICIA 2EKIA 1TYGB 5BYRA 1TWHB 3GO5A 5CORA 1SNCA 1E9MA 1LTAD 1II3A 2J42A 2B2VA 1TWGB 2DBYA 4J6HA 1PTOF 3FMCA 1NVID 3GV6A 1DOIA 3ZJVA 2ID0A 5F2DA 3VR4A 5C4XB 4C2MB 1B53A 1RKNA 1C77A 1TU2B 5JEAH 2HDLA 1F9RA 3CRKC 1AW7A 2Z8LA 4CKEA 1HZ5A 2FMMA 2LHDA 4WH4A 2F0EA 3G7LA 1FRDA 2EE1A 5COYA 1FNWA 1NUCA 1C4AA 3MXUA 4PMWA 4X3UA 1ZYRD 1OFFA 2J4XA 1T5XD 3QG1A 1PRTC 5I9OA 3U4EG 4K5XA 1LT3D 2N9LA 2WXPA 1SE2A 3IL8A 5H8YE 3TP6A 4K5WA 4C3IG 2L0CA 3HOXB 3SXHA 2NBFA 3NTKA 2L1AA 2WNMA 2AWOA 1BOSA 1EZ8A 1U4MA 3JAML 1N60A 1PFDA 3OW7A 2A6HC 3VQIA 2YEPF 3RD4A 3N9YC 4WJWA 3PUXA 3J81L 4ZKCB 2KMMA 1C4QA 3GTLB 1IBXB 2L32A 3H91A 2YU9B 4BY7B 2MJ8A 5I4DA 4BBSB 1C48A 2K3UA 2F03A 2KN4A 1HZ6A 4KJOA 1VZ8A 1Q12A 2LEKA 1VRAB 5DNFA 4FF2A 3OIPA 1Q3LA 5JJZA 2IWHA 4ZYSA 1XF5L 5C3XA 4JE3B 3LWUA 2NTSA 4IFDJ 1KRHA 3S1RB 2WIIB 3VYSA 3EJIA 4RFBA 1L4ZB 3DEPA 1AYFA 1IBXA 1WRIA 2PTLA 1G91A 1ZP0B 2FMCA 3WOEA 1GB1A 3HRDD 3AB9A 3Q69A 4CQNA 4GDKB 1W6JA 3KLSA 5EPJA 3GB1A 1GB4A 1STNA 3LNNA 1RCVD 3NZ3A 1EYAA 1XLPA 1SYGA 3T13A 5D7GA 3J9CA 4YSYB 3I90A 1EEFD 2K05A 1H9SB 3CU7A 4HJGE 3S14B 2NVTB 4FYDA 5A2QE 1F2YA 1SNQA 2A69D 4MM3B 3S9WA 5EPLA 3HOUB 1IW7D 4KKSA 5M5YB 1Z47A 4C1NI 5FOBB 1EYCA 5K5PA 1IYVA 2Z4IA 2AQ2B 2WS3B 3NUHB 3H94A 4WFN3 1EWCA 1JCKB 3BDLA 3ONAB 5HG2A 4AQ7A 5D3IB 1SNDA 4C3HG 1SEBD 2CHBD 1OXVA 4L23A 4USAA 2NUCA 1JALA 1AFPA 1CK1A 2KJXA 1MSGA 1Y69U 4HRSA 2BBCA