4ZYSA

Crystal structure of an exotoxin 6 (sav0422) from staphylococcus aureus subsp. aureus mu50 at 2.25 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
195
Chain Sequence
TEVKQQSESELKHYYNKPVLERKNVTGYKYTEKGKDYIDVIVDNQYSQISLVGSDKDKFKDGDNSNIDVFILREGDSRQATNYSIGGVTKTNSQPFIDYIHTPILEIKKGKEEPQSSLYQIYKEDISLKELDYRLRERAIKQHGLYSNGLKQGQITITMKDGKSHTIDLSQKLEKERMGDSIDGRQIQKILVEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords exotoxin 6
publication title Crystal structure of an exotoxin 6 (SAV0422) from Staphylococcus aureus subsp. aureus Mu50 at 2.25 A resolution
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Sugar binding protein
total genus 63
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zysA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4zysA01
1AW7A 1BXTA 1LT6D 4RH6A 3BYTB 1SXTA 4RHRA 4RFBA 1HA5A 1RDPD 1XTCD 1BCPF 1V1PA 2AQ1B 3R2TA 4NZLB 2XRQD 4RGOS 1UUPA 1S5CD 1MD2D 2IJ0A 1AN8A 3TSSA 1SE2A 1D6EC 1YN3A 1EEID 1FNUA 1L0XB 1UNSA 1RCVD 2XN9C 1LTRD 1PRTB 1ESFA 1ET6A 4Z9CB 1M4VA 1DYQA 5TSSA 1LT3D 3BVGA 1BCPC 5ELEA 1JWMD 1DJRD 3CHBD 4RGMA 5ELDA 5FKAC 1FNWA 1PRTF 1BCPD 1LT5D 5FK9C 1HQRD 1JR0D 1F77A 1FNVA 3W2DA 1PTOB 2G9HD 4C56C 4RCOA 1T5XD 2QEJC 2NTTA 2Z8LA 4UDUC 4K6LA 1D5XC 1ET9A 2J4XA 1G8ZD 2SEBD 1EU4A 1I4XA 1PTOF 4L63B 1PRTC 5D3DA 3SEBA 1PZKD 1PYWD 2ICIA 1PTOH 3BYYB 1LTBD 1LTSD 1V1PB 3BVZA 1I4QA 1EWCA 1HXYD 1CQVA 3EA6A 1YN4A 2IPKD 4DXFA 4O1NA 2CHBD 1SE4A 1TY2A 3OWEB 1PZID 3R8BA 1KLUD 1LTTD 3GP7A 1SBBB 1STEA 1SJED 1HTLD 1I4PA 1PTOC 2RDHA 1EFID 1JQYD 2O2LD 5ELBA 3URYA 4RGTA 1CHPD 1YN5A 1LLRD 1LT4D 5D3IB 1I4RA 1JWUD 1TS5A 3MC0B 1LTGD 1L0YB 1LTAD 1S5DD 2NTSA 1TS3A 1QILA 1FGBD 1KTKA 2WV6D 1LTID 4RGNA 4ZYSA 1B1ZA 3KLSX 1PZJD 1SJHD 1BCPB 3EFXD 3MFGA 1JCKB 1PRTD 5ELCA 1CHQD 5ELFA 2QILA 2AQ3B 2R61A 1S5ED 5I4DA 1I4HA 1SE3A 1CT1D 1JWSD 2RDGA 1TS4A 4L6TB 1D5ZC 3BZDB 2AQ2B 1RD9D 1GOZA 1SEBD 3O13A 4TSSA 1XXGA 1LO5D 2XNAC 2XRSD 1RF2D 1B44D 4RHSA 3V05A 1D5MC 1ENFA 1EEFD 1CK1A 1PTOD 3R2IA 4BWGB 1S5BD 1TS2A 1TY0A 4DXGA 1EU3A 1FD7D 1S5FD 3DWPA 1V1OA 4OHJA 2TSSA 3DWAA 1KLGD 1I4GA 3DWQA 3BVMA
chains in the Genus database with same CATH superfamily
4M0WB 2INDC 3CU7A 4ZRIA 2R6GA 3J80i 1RJTA 3FRPB 2J0KA 1I6HB 3Q3FA 4PMWA 2Y5PA 1TWFH 3KF8B 1N60A 5EPLA 5ISRA 2V1YA 2I38A 2RBMA 2F0WA 1QVGA 2PW7A 3W1BA 1F2ZA 4ZRQA 3L0WB 3QAQA 2UXDQ 1MFWA 3A33B 2BE5D 2KVRA 1JE5A 1Y1WH 1X65A 1SE2A 2R7DA 2FNJB 3CSFA 1UNSA 2OTLA 3FKIH 2N7DA 2YEPF 4C7ZA 1II3A 1IYUA 1TGZB 1N33Q 2NN6H 4ABNA 4IOAA 2DNEA 2MHJA 4WJQA 3MXUA 1WRIA 1ZDVA 1UD7A 5BYQA 2N9PC 1QWYA 3ZTCA 1Q7YC 1UAPA 5CTRC 4QAYA 4HK2A 4ILWA 4OO1I 1I94Q 2E2JB 5FR3A 2F0SA 1VQ9A 2F0PA 2R7ZH 5A2QE 2EYHA 3Q8EA 5G2NA 1FRDA 4X64L 4JV5L 4A93B 2I5MX 1RHPA 4C3JG 3OSOA 2Y3AA 4EFOA 4S3SA 1C8CA 4WFN3 2JZZA 3CWIA 4XQNA 3PHWB 2J4XA 2VZAA 1Q1OA 5FJ8G 3QJYA 3OIPA 1DD2A 2NPTB 3IVFA 4DK5A 1WTWA 2JA8B 1WM3A 3A5UA 4M00A 4A3MB 1I7HA 3RUIB 2JRIB 3HIZA 3OG5A 3BVZA 1GJZA 4DR6Q 1FRRA 5GAHC 3P4PB 3PRPB 4KKTA 4HKQA 1VQ7A 1Q46A 2K5QA 2WXLA 1OO9B 3GD7A 3UF8A 1NCVA 4HRSA 4N9F4 3A8KE 4APVA 5I6WA 1U0LA 2EQSA 1HTLD 2C5CA 5EBDA 3IHPC 3RNEC 4GZYC 2IHFA 2KCMA 3CXCA 1AYFA 3I2ZA 3URYA 1LXDA 1Y8RC 2AYOB 1F2RI 3ENEA 2L15A 4X62L 4DV4Q 5D3IB 2O5IC 2H4OA 3SK4A 3HVDA 3S17B 2SDFA 3WA0A 3ZUNA 4II2B 1L0YB 3BINA 2ZW1A 3M62B 4XIGS 4N6EB 3CCSA 2CHZA 1C4AA 1IYVA 2MP1A 3KLSX 3AE6B 1H4RA 2LMCB 3K9OB 2MJ8A 3ZDMC 4EZLA 1FO4A 3WWVA 2R61A 2PKOA 3RNCC 2IX0A 1I4HA 2EVBA 1WTQA 1TS4A 4DV3L 2JZ3B 3DBHB 3ABVB 4MT5A 3ZNZB 3U52E 1GKHA 1D3ZA 1QUQB 2KENA 2YV5A 2Y5CA 4DR1L 1CFMA 3M4PA 5EGTA 3ECIA 4IFDI 1LFDA 3DBSA 1MIUA 4L5RC 2A69C 1O7LA 4UHVA 1XMOQ 4QUCA 4FDBA 2Z0DB 4G50A 3T16A 1KAAA 3EECA 4X57B 3C3LA 2MJDA 1IPGA 3QJZA 4A20A 3DQVA 3DCGA 2YTYA 3DWQA 4K2LA 3KBGA 1A8VA 2NVYH 2KMAA 2N9KA 1V81A 1A3UA 1BXTA 4YCVA 5JEAJ 2WP9B 1WXQA 1Y8NB 4DU9A 3M85A 3PO3B 4OXPA 3K5NA 1N6ZA 2MWSB 3I90A 1XTCD 2AQ1B 3ERQA 3F2UA 2OJRA 4HAEA 3MC8A 2LXKA 3HGBA 4ZRZA 4N8X1 2BCOA 2EYPA 5ELNA 4GOCA 4HPLB 4RKLA 2EYFA 1EIGA 2QF7A 5EKKA 2LVOA 3WAOA 5KNCA 2PE6B 1B7YB 1PRTB 5BR8L 3V3XA 1WCMH 4E6IA 2LZ6A 1KF6B 5IA7A 2ON8A 5J1ZA 3UE1A 1HZ5A 1XLNA 3B08A 4C1NI 2KCNA 3VYSA 4YHHL 3AEAB 4JQWC 2N3SA 5GXGB 3L9AX 4G0NB 3TZDA 2DNFA 4C2MH 4OWWB 1JWBD 4P1CC 1I6VC 1WXSA 2F0TA 5A2QL 2GBNA 3MJWA 1XO3A 1ZXHA 2LXJA 4KD3A 1HNZL 1K8MA 4W9HA 2LVQA 2NCNA 4KY5A 2OWOA 4RCOA 5L37A 4LFAL 2UUAL 2SEBD 5D65A 1OXUA 2BOSA 3E3XA 3PLUA 1W3SA 5DPRA 4HLEA 4KMUC 3CMEA 1F9QA 4J8QA 3AQQA 3HOUH 1Q8KA 3MXGA 4ZKCB 1PGAA 2R7ZB 4DK1A 2OXPA 3JC66 2IGGA 3MEHA 3LYYA 1HCZA 1VQAA 3CRLC 3CCJA 5JJLA 3U8ZA 1VD2A 5HKHA 5I9PA 1MGSA 3NENA 4JK1C 4JYAL 2BTEA 4KD4A 4KHPQ 3PPAA 4A3KH 2K6AA 4A9AA 2J0JA 2M9VA 1VQMA 4A3CH 4RM9A 3ZKJC 4PZ6A 4K0KQ 5JJZA 1KNAA 1YQ3B 1NSNS 2B2YC 4HR7B 3GE3C 3W1YA 2BA1A 2Z6KA 4GDKA 5G55A 5EJWA 2KTFA 2KMMA 2E8GA 4UPAA 4LJZC 2LGYA 4WQMA 2NWGA 2K1FA 2N0SB 3AE3B 3T13A 3AMZA 4KX6B 3MXPA 4R4OA 3BJUA 3VYUA 4K5VA 5FO7B 4PS8A 4A3FG 1YJ1A 1TWGH 4LF9Q 3PO2G 2IY0B 1FGBD 2CWPA 4RGNA 5CGKA 4ZRKA 1ZP0B 1CZWA 1KM7A 2KLCA 3AE1B 5EE1A 4II3B 1YVCA 4R1JA 4NQLB 5LNK1 1CHQD 3FPPA 1XMQQ 1ZE3D 5ELFA 1RFKA 2AHOB 5NUCA 3H7PA 1E7ZA 4WJPA 4G7ZC 4TUUA 3EBEA 3RUZA 2KHIA 1W2BA 1Q5WB 3H9DA 2WNMA 1VQ6A 3UDIA 2HD3A 4H13C 2WDQB 2IO3B 1FVIA 1UEAB 4TKNA 1F1HA 2ZJPA 1SEBD 3DXJC 4J6HA 1C76A 1C78A 3DVGX 3WAPA 4NQKE 1XXGA 1YIJA 1OQQA 3Q6BA 3HOWG 1XPRA 2DWQA 1CK1A 1PTOD 3AU7A 2A6HD 4JI6Q 2M19A 1TY0A 5EE0A 2XBBC 3I55A 2PW9A 1O7IA 1R4NI 2WXFA 1Y1VH 1XEEA 1QCBD 2KTRB 3NK9A 2J52A 3VR5A 3KH0A 4ZRPA 3K5LA 5IGFA 2AKWB 1C77A 3HOYB 4OONA 2WU2B 1JB3A 4HEDA 3U58A 4R4TA 2K8BA 2ONQA 1SYBA 3HOVH 4C4VA 2L0TA 1QOAA 5IODA 3H0GH 4UY8C 3UINB 5JHBA 2INPE 5FLMG 4DAVA 1YHBA 2GA4B 1VQ4A 1TKEA 3OJ3A 1QNKA 3ZJVA 1FIQA 2N9EB 3WOFA 1MKHA 1E5WA 3KWLA 1GHKA 3SDLC 2V3NA 1YQ4B 3PUWA 5E6OA 5JZEB 1AEXA 3AM9A 3P1MA 1FD6A 1NY4A 3I4NH 1YN3A 2NVYB 1YX5B 2K5HA 1FNUA 4ICUA 4J3OD 3DLLA 2F4IA 1ZGUB 3W5UB 3RNAC 5AFWA 3P7JA 3KLRA 2RPVA 1R9TB 1WI5A 5IGCA 2AEHA 2BVCA 3PO0A 3H6NA 5M3FB 4A4IA 3U9SA 4WJNA 1QZEA 2KJXA 4CDCC 2W55A 5COYA 4KN7C 1H9SA 4A3JB 2CR5A 1VQDA 1WTXA 3DOWA 1BCPD 3QOJA 1O80A 1JC7A 4N59A 3OAWA 3AMUA 3EHVA 3E56A 4JWSC 4P74A 1WGGA 2D3AA 1QB5D 1WMHB 1V8QA 1JR0D 1F77A 4PNYA 2VXWA 1WCMB 2KHWB 1L2FA 2UWQA 1IHZA 2GBMA 2KWDA 5HI1A 3T9LA 3NWTA 3R3MA 4DR4L 5M3MB 3L7ZC 5D3DA 5CV4A 1R4QB 3GTGB 2IX1A 2E75C 4L5SA 4C2MB 1F9PA 2J0MA 2KX0A 3W1SC 4GLXA 4GDLA 2FCQA 2JVCA 4NJ7A 2G1EA 1WSPA 2M0XA 4DXFA 3J7ZC 4O1NA 3P4RB 4KLKA 3M7NA 5LMUL 2IDYA 4PS3A 3RYTA 1ENAA 4LNOA 2F3IA 1IL8A 2D2QA 4GKKL 1STEA 4NJ6A 3RPFC 2H89B 3L3OC 4M0WA 4GOPC 3RZFA 3VVWB 2N7EA 2WDVB 1VQNA 3HOUB 3KF8A 2VL6A 3I4MH 3N9YC 3RZOH 1O7ZA 3KUPA 4REZA 4XC2A 1LTGD 5I6YA 1XNRL 4A3BH 2KEEA 3NUHB 3P20A 5H92C 1N34L 1PVOA 4MSMB 3DVNU 3MFGA 2MA9B 4KDLB 3D6CA 1FL0A 1X6OA 5IGBA 2AQ3B 3SR6A 3PGZA 2KACA 5IYCH 1KAWA 3C0RB 2IWHA 3KDFB 1HRJA 1E8XA 1EIHA 1UGJA 2JSVX 1YHAA 3LXFA 1UGMA 2IY5B 5MPOA 4MACA 3STBC 3L0OA 2AQ2B 4A3EH 2L3ZA 3UI2A 1EZ6A 4IPHA 2RR9A 3AXCA 2B76B 2XNAC 4DKAC 3N1YC 1XWEA 4DPGA 2MP2B 2E3TA 3V05A 3V2TA 3G6EA 4RMAA 4BOSC 3KWVA 5HHDG 4A3LH 4JVZA 2FIDA 1Y56A 4BKGA 1TS2A 2N1VA 1JB7A 3TP5A 4DHJD 3K8AA 4OHJA 3CCEA 1V49A 1YOVB 2BKRB 2CHXA 2NZHA 2K6QA 1J9OA 1U5KA 4DR7L 1M1KC 5C0XJ 3GQBA 4FP5D 2B63H 2ZNVC 2NR2A 3GZNI 3Q69A 2MBOA 3AU4A 2CKZB 4DNIA 2MQHA 2F0IA 1IZ6A 3RN9C 2E2IH 2NPTA 4W9KA 2Q8TA 5D14A 3E9IA 1C48A 1I5FA 1E2VA 1EWHA 5G3LD 5FOBB 2L76A 4NW2A 2PPHA 2ZCCA 4ZDVA 1SMXA 2M2LA 4M1UB 1CTMA 2UU9Q 4K0KL 1VJKA 3L4PA 1UUPA 1Y1VB 1TZOA 3G4SA 3OHXC 4JGHB 3JAME 2ID0A 3RN2A 3NVZA 2ASQA 5JOBA 4RA8A 2V4DA 2ZVOA 4BY7H 4EZKA 3ER0A 3S14H 3HOVB 2F0KA 2GVBA 3NP8A 4AJYB 4DUYQ 4LF9L 4OELB 1FNWA 2ZVNA 1KDCA 2L1AA 2YVCA 4QB4A 2PO4A 1A63A 2N88A 2LJIA 4LF4L 1KH0A 1WX7A 1CZGA 3PQIA 3GV6A 1OFFA 1RODA 2F0QA 3I4NB 2BYTA 2K04A 2MBHA 2NYZD 2WXGA 5C44G 3D8GA 2LMCA 3VTWA 1PTOB 2CCZA 5AZGA 2MHVA 4IWPA 4BVUC 1EY5A 5EQ0A 4C3HB 3VQIA 2EKEC 4K6LA 2CJNA 1E1OA 3CPWA 3H09A 3AB9A 3TP6A 3ALBA 2X69A 3BYYB 4JI6L 2UXCL 1MJDA 1QUQA 2NVXH 1E7UA 1TIID 4BZAA 1N62A 4JOIA 2JA6H 1EIYB 2JA9A 2C60A 3Q8AA 4B3ML 3DVGY 3VXWA 4V0BA 3TIXA 2KBNA 2C9WB 3J81j 3L08A 2CW0D 2NBUA 1NVID 4CGYB 1LUZA 1X3EA 2K03A 5DNFA 1MG8A 3S2DH 3HOXB 3K7UC 5D7GA 3OOCA 2L83A 5BN5A 4B3SQ 3J7YW 3J7AF 2FAZA 3AYHB 2NVUI 1V5TA 2KNBA 4L8JA 2J0TD 2C7NB 3ZVVA 3OTOQ 1SNQA 3JAMc 5C4HA 1C79A 1KTKA 1RL2A 4MTKA 2IBIB 1BCPB 1ZEQX 3RZDB 5JJIA 2WB1B 2GOWA 2OQ0A 2HD5B 4P16A 3A8IE 3VR6A 4FNFA 3S1RH 2INCC 1UWVA 1J5EL 4FF1A 2QA4A 4TVAB 5IIFA 3I4MB 3RZOB 1BQQT 2KVZA 1KL9A 1C4CA 1D7QA 3VH3B 4JBWA 1IXRA 3PREA 4IALA 1J7BA 1LO5D 2WHIA 4TRDA 2WXRA 1TWAH 3ULJA 4A3GH 5C3JB 2DYBA 3HEJA 3SK8A 1V1OA 1TZ1A 4LCDE 2EXDA 2K5PA 1PFMA 3VR2A 2NS5A 2KX3A 4K7WA 1T0SC 4BBSH 1F9JA 3BVMA 5CHVC 2K14A 2JA5G 3M3JA 2WAQB 1KC8C 4A3EB 1VQGA 2MSED 4NPSA 2JQOA 3I72A 1JRUA 1QLBB 5G5HA 2JEBI 4ODGA 4X64Q 4JV5Q 5C3WA 1BCPF 1ZUD2 1VQOA 4WH4A 2M00A 4NZLB 4OWXB 2OT2A 2K5DA 4KSLC 3C19A 2M0AA 3GTJB 2A6EC 2N7JA 4GXBA 1EFWA 5C0XI 2B63B 3JAML 5C4XG 1Q82C 2N9LA 1KHIA 1H9KA 1K50A 2NZOA 2LFIA 3TMEA 2E2IB 4FHKA 1J7AA 2ASBA 2KJRA 2MBQA 2Z6KC 4CYEA 2K28A 2I5LX 5EE9A 3CHBD 3FDTA 1ZPSA 1PYBA 3M4OB 3GTPH 2JXXA 4C3IG 4BBRG 5JJKA 2DUDA 5IOIA 4GIVA 1DGSA 2KQ3A 3VHTC 5CC4A 2KDIA 3GO5A 4DAPA 4X62Q 3FVQA 4BY7B 2E2JH 3S14B 3PVLA 1F2YA 5CBEE 3K6OA 3L13A 1PH3A 4LUZA 2RKSA 4QQBX 2Y0SB 1WFYA 2G9DA 1PDXA 1GB4A 4A93H 5K36H 1XLPA 1SFOB 4Q2JA 1U4MA 4GN3B 2JF5A 3QIJA 5KGUA 2QW7A 3ETRA 3AEVA 4A3PA 1HNWL 1B3QA 5J3BA 2H1EA 3EA6A 4P71A 4DNRB 4ZHOA 4P73A 3MA2B 1ASYA 3NPPA 5CV5A 2PMZB 4DNTB 2JA8H 1QNUA 1Y14B 1E3PA 1KLUD 4A3MH 4FJVB 3P1HA 2KTRA 5IYBH 2EYLA 4DR1Q 4HXDA 2BS2B 1G2SA 2L4NA 4YTNB 3RN5A 1EIFA 4ZK9B 4OL7A 3E5SA 4U68A 4A3DB 1NBWA 2JA6B 2BWES 1TS5A 1YD8U 1KLVA 3SGIA 1S5DD 5H1SE 4C4VB 1DOMA 4ANWA 2EELA 1L7YA 1PZJD 3EFXD 1F9SA 3H3VH 1FM0D 4NAWA 1KDAA 3MXNB 3UDGA 3S17H 1WTHA 2GN5A 4YL8A 3T3OA 3VR4A 4KIKB 4XX5A 2OTJA 4DUYL 1B9RA 1NEKB 4H02A 5I4DA 4OWTB 3KJOA 3FPUB 1GUWA 3RI7C 1J6QA 4M8MA 3BS1A 2MUYA 3IL8A 1SR3A 4B3TL 3KFUA 2RVLA 1GOZA 5E3FA 2VUMG 2JUOA 4P7IA 3O13A 3D31A 3I5JC 1YI2A 3K80C 4ME3A 2F0DA 5H8YE 2HUGA 1PQSA 2N49A 3BK2A 1A6XA 4BWGB 2I0QA 5BR8Q 1QJOA 1WOCA 4DXGA 3S1RB 3S16B 1VQCA 2F52A 1SIFA 2JXTA 2MQJA 1BUVT 4R4CA 3BDLA 3RLOA 1MHHE 1Q10A 1XX8A 4IUVA 4YHHQ 1Z2MA 3Q8BA 4R8NA 4LJPB 1N9WA 2B2UA 1WYGA 3G71A 3VDZA 2LD9A 3APFA 4NDXA 4I7ZC 3K9PB 3T1YL 4DA2A 3ND9A 2WDRB 4EQNA 1HA5A 3JAMi 1STYA 4KHVA 4X3KA 3UIPB 1WE7A 1HNZQ 4A3GB 4FYDA 5L95C 1KDBA 2YEPB 1TBEA 4XDDA 4RGOS 4LFAQ 3WDNA 2KO3A 3PSEB 1U4PA 3PO3H 4BBSB 3WALA 1WJ6A 2KQ7A 2WXHA 2BYFA 3HRZC 2AWOA 2MPMA 2ZTDA 4MTNA 2WX1A 1KNEA 2Z4IA 2VH1A 3AU5A 4LDTD 1FR3A 2UXBL 2NMQA 3K58A 5LXIB 3HKZG 2SOBA 2FFKB 2IX3A 4BXXG 4JYAQ 2NZ1D 4X6AH 2CHWA 5IAAC 3ZNGC 1TU2B 4F7XA 2GBJA 3K7AB 2AL6A 3TN2A 2BPSA 1IYFA 1SROA 2HDEA 3DEOA 1STAA 2PCFB 1STNA 3P42A 5AZHA 4PZ7A 1CUKA 1S3SG 4HJGE 2G9HD 2WB1E 2NUCA 4C56C 4ZRJA 4NXMQ 1SMYC 3HFZB 2LI5A 3G6JB 2MJ3A 1XCQL 2RCFA 1N63A 4YSYB 3KDFA 2BB6A 1JT8A 2A68D 1PDQA 3NG0A 1LGRA 5IYDG 5LL6S 2UUCL 3GTPB 3SEBA 3SK6A 1G2TA 2X38A 1LTLA 1A3TA 3R7QA 1CSQA 3N1XC 4YIJA 4WWMA 1LTSD 1GVPA 2J7ZA 1I4QA 2LGSA 3P63A 4JI7L 4BA2I 2MP2A 3ICEA 1WR6E 3I4OA 2JWZA 1WJNA 3HVZA 1DM0B 4GNXB 1SE4A 1A2TA 4Q0FA 2MO1A 3OWEB 1Q1EA 4FN2A 2MO0A 2BGFA 1WTRA 3GP7A 1BVSA 1Y1WG 1YEZA 4WJOA 4M02A 1I4PA 1CI3M 2RDHA 4U673 2BH8A 3FKIG 2J53A 3RD2A 4HJ7A 2LWPA 4BY1G 2WAQE 5GQOA 2WX0A 4YWGG 4F8CB 4OEMB 4LK1C 3EQLC 4JPBW 1VCIA 3SHLA 1HZAA 2D9UA 4CKEA 3M3YB 2L7RA 2NTSA 3IFWB 1E7VA 4YCUA 5HGTA 5I9OA 3PUYA 3EVQA 3F2DA 1H9RA 4XTCS 2A4ZA 3LJ3A 3I73A 3PIP3 1GNUA 2YTXA 3NUCA 5JVG3 1F0ZA 1F2LA 3LB8C 4DGZA 1MVKA 4WJWA 3DHQA 1UWMA 5C1ZA 3BG3A 4F88A 1T5EA 3HG9A 5DLQE 1S72A 2D62A 1VZ7A 2R92B 4IQZA 1FFVA 3MHSD 1D1IA 1NMGA 1T0RC 3A5ZB 4GN1A 1SNPA 3H3VC 1Y69U 2RSNA 1ICFB 5J18A 2QDBA 5DM73 2AWNA 4LF6L 1X9NA 4JCVE 2A1AA 2Q8IB 3AEGB 4XWWA 2F0MA 4DK0A 2Z9HA 2EPBA 2O2VA 1MJCA 1SNDA 1H9JA 4L1BA 2I2YA 4LF5L 4CJ0B 3HS0C 1CA5A 4NXNL 2LASA 2MJEA 4GU2A 1LV9A 3CC4A 4OVZA 3DEPA 4GKJL 1K73C 1LT6D 2D2CC 2PI2E 2Y0SE 1QOHA 1CJEA 1SF0A 1HA6A 1WXAA 3NVVA 2GBKA 3DVNV 1UE1A 1KRTA 2F03A 1EWYC 4IN3A 5JPMC 3HOYH 4K6DA 4ANVA 4JOIC 1V86A 4NP5A 2AX5A 2KCTA 2LFNA 3CAMA 4DR4Q 5C3EG 4KHZA 2PMZE 1STGA 3DBRI 1TWHH 3KLSA 3J9CA 4F7ZA 3APCA 5EPKA 2KWUB 4CJ1B 1KOTA 1SRUA 3CCVA 3TS2A 2L05A 1G6ZA 1JE4A 4C00A 1DJRD 3U7DA 5LMUQ 1BMLC 3TUOA 3Q6SA 1UE6A 2EYOA 2WFWA 1NBFC 4GKKQ 1R9TH 1WYDA 3SE0A 2JZPA 5JEAG 1JMCA 1YJIA 2LGXA 2HE7A 5BMIA 5M3FH 1VQ5A 1X3QA 2A19A 1IGDA 2Q2TA 4CJ2C 4YY3L 1OEYA 3WAMA 2BDNA 4A3JH 1HUMA 1YNTE 3OW7A 4KV6A 4DN4M 2P5ZX 2KZRA 5HURA 4UP9A 3CKIB 3GTOH 5LLIA 3NS1A 1HZ9A 2PZTA 5I2XA 1UF0A 1XNRQ 1D5XC 3RR5A 1PRTC 1K0SA 2JYOA 1N34Q 1PYWD 3Q8FA 1GUSA 1EO6A 4KZCA 2CQAA 2PQAB 1OXSC 1GG3A 2LS01 2N8NA 1AP0A 3KQ4A 1TKGA 1K8AC 2R2QA 2XK5A 3PT2B 4QL5A 2WGSA 5M3MH 2R93G 1UBQA 2N78A 4TV3A 3GTGH 1HZ6A 1QQRA 3ZRFA 5GAGC 1HR0L 3D4RA 1FMAD 3NS8A 3VTVA 1PGXA 2Z0SA 5JVH3 4N58A 3CCLA 3I57A 1WRDB 2PVOD 3LX0A 1WTOA 5E1FA 4GSWA 2KUMA 4IOIE 3PIO3 1IW7C 2A73B 3GTMH 1EY0A 1J7CA 2MGSA 1PLFA 1GD7A 2B29A 3D4DA 3M63B 4KGRA 1T6BX 1I4RA 1JQ4A 4LDTB 2DAFA 3RMKC 2G4SA 2W9NA 4BBNC 3QO2A 4BFRA 3VRAB 4DR7Q 1U9RA 2DHZA 4X3TA 3V61A 2VB2X 1UH6A 4OZCA 4WWOA 2N9XA 3GOEA 3HOZG 3W3AA 2BT6A 2FBWB 2FMMA 2EKIA 1NE3A 2NN6I 4GB9A 4PYUA 5BMHA 4L5QA 1F9RA 2I5HA 4Y7NH 1U4LA 3OWFA 2RDGA 1GO3E 5GROA 1VRAB 3Q3MC 1V9PA 3BZDB 3NSWA 2R3ZA 2BYEA 2CU3A 1Q8IA 2Z4HA 1RRBA 3IRBA 4MEMA 5DAUA 2D3CA 3FKYA 1YNND 1RYJA 3HOUG 5HG2A 5IY0A 4IPCA 2HIVA 2F0OA 3C1EA 4NXML 2H5XA 1V9JA 1MJEA 2HJ8A 3J7AV 4DV7Q 3ULPA 1QOGA 3OYYA 3TBLD 3PUZA 3M95A 4B9KA 1Z6HA 4F1SA 3TMPB 4A3KG 2IL8A 1JMLA 1E10A 5J22A 2PE9A 2IYDB 4ZOHC 2BB5A 3PO2H 2PI2A 2YLMA 4LF4Q 3ZTDA 3Q2AC 3CW2C 1VMCA 1EY9A 2IGDA 3JW0X 2GMIC 4TQ1A 5EE3A 3I7FA 1CKNB 2SNSA 2MFIA 3R2TA 2KN5A 3RFZB 1NI2A 1E7PB 2OEDA 3UI3A 1ZW7A 2KHSA 2XRQD 3U2SC 1DOLA 5CHFA 4WURA 2O4XA 3TEXA 5EBCA 1P16A 2K01A 3IFTA 3TDQA 4IPGA 1P98A 3SDZA 1WI0A 5HFYA 4LFCL 3D6WA 1B53A 2UXCQ 1XLOA 2KD0A 3CRKC 3HOWH 2RHQB 1N32L 1ET6A 4EGVA 5JAVA 1ILPA 3H91A 4ALPA 1TIFA 2KKCA 3N1ZC 3D0FA 4K3BA 5EPJA 3IT6B 1ACCA 4B3MQ 2BW2A 3MHZA 5JXVA 3IAM1 5CMDA 3LGJA 2VRRB 1L1OB 2IW3A 3VTUA 2HQEA 1BBUA 2IT1A 4KN4C 1R4NB 5LMNW 3HM6X 1B9MA 1X56A 4IW0A 4ZYNA 2CH4A 4YTMB 5IGGA 2LGIA 1K83B 1Z47A 1TWHB 4IOCA 4K14A 2D11A 3SFDB 3MXNA 4IUMB 3SFEB 1MBYA 2WACA 1JW9D 5FLMH 4KKSA 1XNQL 2LHEA 4KIKA 2WIIB 4DDGD 2QEJC 2N55A 4NAWB 4EOYA 2VH2A 5E6JA 1S3OA 2V3SA 5AUIA 1MHXA 3Q23A 2CU1A 2I07B 3GTKB 4BS9A 1PTOH 3C46A 3JYUA 5JPNC 2HT1A 4HCPB 3CCRA 4QY7A 4A3IG 1C9OA 2B8GA 3H0GG 4C3HH 2Y5BB 4GN5A 5BYRA 4AJWA 1J5EQ 3NEMA 1YBYA 2A74C 3BZCA 4ID6A 4RMFA 1MPEA 2PJHA 2Q5WD 1AARA 4OW0A 1UELA 4LTUA 4CHKA 3GTOB 2TMPA 3MHBA 2HDMA 3EC8A 4G11A 4P1BC 2KDMA 5LXHA 4JPSA 1DONA 3IT4B 1EFID 3EN2A 2K32A 4WQOB 3J7A5 4A8XC 5L83A 1LLRD 2B2UC 2WDTB 1PFDA 2DZMA 3AE5B 1JWUD 4W9LA 1BR9A 4EZJA 3CCUA 1L6VA 2JA7H 4MH0E 1TS3A 1QILA 2EY6A 3HOXH 5FO9B 4B0MA 4DR2L 2UUBL 1CZPA 3NJTA 3GTMB 4O0AA 2ZXOA 1K8RB 2B39A 2JN4A 3Q8CA 1F2MA 3RZDH 1Z7TA 3OW2A 2F0EA 2WXIA 5IP7H 1Y8PB 3ZLZA 4BOZB 2Q2IA 2VS1A 4PYZA 4MIUA 1HHVA 3GTLH 1TYGB 3BWUD 3D3RA 3R2IA 4YWLA 1IUEA 1AE3A 4PK1A 1GB1A 4MGIE 2C9OA 2ZM6L 2H88B 1GUNA 3DWPA 5J2RA 2NVTB 3OLMD 4KGTA 4Y7NB 4HIOA 1ZOYB 1OEYJ 5E6NA 2KYWA 2ZTEA 3KLWA 1Q90A 2I46A 1VQKA 4NB3A 4LNFA 1M94A 4H2AA 3BYTB 3NY5A 4RF1A 2QC8A 5CV8A 3I8ZA 4AS1A 3QR8A 3Q8DA 2PZWA 2WKCA 2KFJA 3W1GA 3KUCB 3U4VA 4A3BG 4HJ9A 2K3UA 3U30A 2VB3X 4GNXA 2RSUA 1VQHA 1DOKA 5IP9H 4JI5Q 4R3DA 1IYJB 2D5GA 1ZYRD 4HJKA 4A3FB 1WE6A 1VMPA 3PO2B 2RGFA 4YSXB 3ZJTA 2G5DA 1HNWQ 1NJIC 1T0QC 5IYCG 2JT4B 4K7SA 3RCZA 2K5VA 3FP9A 3AEEB 3GTJH 3FHWA 2DJGC 2ZT9C 4FO2A 2QDLA 2NBFA 3VA7A 1R4PB 3EFCA 2HTME 2WWZA 3ML8A 4KV2A 5IO9A 5C0XG 2F4VL 2K25A 3DHIC 4BKSD 2AL3A 3LNNA 3X3NA 1H9MA 3GZNB 2QKIC 4ZCKA 5GAEC 1G6JA 4DQOC 3PSIA 3M4OH 3HOWB 3W5OA 4FXDA 1YNJC 2ZTCA 3NRZA 3A4SC 1G8ZD 2SNMA 1TT2A 4JI8L 5CV6A 2G3QB 3A8JE 2PTLA 2ZJDA 4B95A 1V1PB 4DV7L 1X55A 3Q3NC 4LNKA 2JJQA 3A7AB 3NVYA 2IPKD 2KWCA 3ZIMA 2K4KA 5T1IA 5HGQA 2CHBD 1FGUA 1SFOH 2M4NA 1SYFA 1A2UA 3AEFB 3DBLB 4GGQA 3TEYA 2LUEA 3B6YA 4B3TQ 2K39A 4PT5A 1ENCA 2K50A 2BH2A 1XQQA 1PTOC 1BDOA 3CCMA 2O2VB 2EOTA 3QA8A 1HFNA 4HIMA 4KTAA 4N9PA 4CQNA 4EE2A 5IT9E 1U4AA 2K22A 5DPTA 2IO1B 2JYTA 1HTPA 2CFMA 2RCNA 4XT1B 1G291 4TQUS 5CR3A 5CV7A 1DZ1A 1PUTA 3JVZX 4WWPA 5CHWA 3RNFC 2FIFA 4A3DH 1AZPA 3P4QB 3A1QB 3UE0A 3T1YQ 1HEZE 4J1MA 4DR5L 2KA7A 3TQYA 1K8OA 1CT1D 4Y52H 4QF4A 2LVPA 2SAKA 1TJEA 4MJSA 1NYQA 1SNMA 3MZ5A 1MHWC 4J6IA 2JA7B 3SXHA 1A3VA 4A75A 1Y8OB 3AFQA 3J80E 1DGJA 3BY4B 4LF8Q 2HJ1A 4HSPA 2UYZB 1B44D 2B2TA 4RHSA 1BKBA 5EKIA 3CQZH 4YWMA 3C2PA 4FF4A 3CMAA 4B3RL 1S5BD 1CM9A 1PHJA 1EU3A 2UXBQ 2E74C 1EQVA 3DWAA 2G45B 2QDFA 3N32A 4F87A 4EX5A 3AI5A 3Q0AA 2RD0A 2LXAA 2JWUA 2HHHL 1AW7A 4CDFC 4G57A 1EY6A 5FR6A 4DUZL 3S16H 3A0JA 4YSZB 2DENB 4X3SA 3GTLB 1RTOA 1TXYA 2OJWA 2PQAA 1L4DB 2PW5A 4IO9A 3PGEA 3NBIA 1OXVA 4IWOA 1K3BC 4IUPA 3SR1A 5KNBA 5M5XB 1GHJA 1PV4A 3T56B 2JK8A 2Q2HA 1S5CD 3M9BA 2YYZA 1N8RC 2XK5B 2UUCQ 2DZKA 4DDID 2XN9C 1N61A 1YJNA 3IAYA 5IT9c 1ESFA 1E22A 1PH7A 2WXMA 4JI7Q 1Q3LA 2MCNB 1KD1C 4JW0A 4KI0A 4S0RA 3S24A 4HN7A 5ELEA 1MI0A 4K81A 3H7SA 1X3PA 2C7MB 4NNJB 2JA5H 2M8SA 1SYDA 3MTSA 4IUNA 2RQXA 4DK3C 1WTVA 2QSDA 2VZKD 3AECB 3PLVA 2D0OA 2MLBA 2MH7A 2PVGC 1J8CA 2NB0A 4JI2Q 1A62A 2YU9H 3PS6A 4MH8A 4I6LB 1PXUA 2EMSA 3K7AH 2LHDA 2Z1CA 3K0YA 2Z8LA 3J80c 4DR3L 2JYEA 2L32A 4JI4L 2K75A 2CH4W 3K0XA 3BIID 1VQLA 1EQTA 1ZXIA 3S1MH 4A6QA 3T1HL 1R4MI 1WGYA 1VDVA 1JJGA 2BYVE 3RLNA 3S15B 2DAJA 1VQIA 4XYQA 3S1QH 3S2HH 4FF3A 2NBVB 1LM0A 2L0FA 1L2NA 1XF5L 3ZGZA 3GV3A 1EQRA 4RM8A 4DV0L 3IAS1 2B2WA 1FXIA 1RIPA 2WXQA 1CHPD 1VQEA 1J19A 1YN5A 2ZPNA 1NTGA 4LF6Q 1YHQA 3PF4A 2JX5A 2ZCBA 4DHJB 3BDCA 1NYRA 5DCNA 1VF7A 5IT9L 2EJFC 5J17A 2JRHA 1ONLA 1CKNA 4JI5L 2A8VA 3N20C 1QKZA 4ANUA 2PQEA 4LF5Q 2AMCB 4W9JA 4NXNQ 4OO1H 1LTID 2K5WA 3R3OA 3CC2A 1P3QU 2GLSA 2UU7A 1H8CA 4GKJQ 1MSGA 2KN4A 5BN3A 4LK0M 4MM3B 3F2CA 2K05A 4ME5A 2QILA 2KQSA 3M3YH 3FILA 3ZO5B 1TR5A 3R7RA 1S5ED 1TWCB 3K5MA 4OX9L 2ZW0A 3L10B 3APDA 1P1AA 4LNNA 5C44B 1WH3A 3GTQH 5CYUA 4CBVA 1D4BA 3AULA 1CA6A 1GPXA 3UIOB 4IUTA 1VQJA 4A93G 4RCNA 3J80L 5K36G 3ML9A 2LSSA 3A9JB 2EE1A 1L1OA 2XRSD 1D5MC 3TP7A 2WS3B 4F8MA 1OGWA 4XQJA 2KMCA 2PNHA 4KY6A 4NY0A 2R92H 3TEZA 2E5LL 5M5WH 3NOBA 1P7EA 4AYBB 1O7YA 4IKGA 4E74A 2Q2UA 1HZCA 2JA8G 1WF9A 4A3MG 5D94A 2NBWB 5T1GA 5EDSA 2B8FA 1YJ9A 1DOIA 1I50H 1MSHA 5IYBG 1QVFA 4S17A 1KQSA 4W9EA 1EYCA 1YJJA 1IP9A 1U4RA 4JX1C 1P8LA 2VW9A 1G51A 4YY3Q 3CQZB 5G5GA 1L0VB 2XWJB 2L55A 1PA6A 2KEDA 4I6PA 1FPYA 4KVGB 1STHA 5K5PA 2KDEB 1V97A 3TEWA 4DAYB 3TSSA 2LRUA 1DOXA 4EQOA 1WYWB 2VUMH 4KJOA 4FADA 4EVOA 5C6AA 2D0PA 3E9HA 4JI3L 3NQIA 3WOEA 1GJXA 2A69D 3KBXA 4CO7A 2FE8A 1BBWA 1FYCA 5TSSA 2D3BA 2CW0C 5ELDA 4AQYL 3AFPA 1WJJA 4I65A 1HR0Q 3K81C 3VA5A 1ML0D 3CPFA 3NTIA 4JIOU 1WFQA 1RTNA 3B1LX 1ESRA 4IFDH 4IWQA 2EMTA 3NBHB 5IWAQ 1BNZA 4QMGA 5AJ3L 1PFBA 3TRZA 5DM63 1SLJA 4URKA 1JOOA 2CJOA 1NUCA 2DLBA 3G48A 3J81E 2QEXA 2MBEA 1HZBA 1E2WA 4LF8L 1D2BA 1EU4A 1KRHA 1WM2A 1HJPA 5IN7A 1EOVA 3DMUA 2J7QB 3N30A 1SAPA 1SE8A 2L8JA 1WTPA 4KKJA 2ZXPA 2VQEL 4R9WA 1YITA 3Q14C 2JA5B 4K3CA 4OVVA 3ZJUA 1QOBA 4RG1A 3FAHA 3NZUA 2DNCA 4LF7L 2E76C 3V60A 4LMQD 3KYDD 2DYMA 2YU9B 3S1NH 1STBA 3R8BA 3VR3A 1A15A 1LTTD 4GN4B 3M4YA 3PO3G 5DPWA 3W1SA 1XJVA 1PH9A 4JI0L 5M5YB 1E8YA 1GUAB 1A5RA 4HIKA 3OIQA 3GDEA 1JQYD 3TZUA 4IPDA 3MC9A 1VR9A 3KF6B 1SNOA 3S1MB 3I63C 3M4QA 3RD4A 5C4XB 3DM3A 1IW7D 1WXVA 4YWKA 4G4KA 4PG3A 2V3PA 1K9MC 3RZWC 3S1QB 1K51A 4H7BA 3S2HB 2F1MA 4GOPA 2VY3A 4G3XB 1QE6A 4MSQB 1SYEA 3GB1A 3N6RA 5IYDH 1RFAA 1N5WA 4IC7B 2QIEB 4GNXC 4AUQC 4C3IB 1E1TA 4FLHA 4BBRB 2VZKB 3T4AC 1Z5SB 4HWIB 2BS4B 4XGAB 1WWTA 2JE6I 2QJLA 3T51B 2JSOA 4HJ5A 1D5ZC 2OOBB 2E2HH 1Q81C 1SE9A 1SSOA 4ARIA 4QGUA 2JPHA 5DPSA 1EF1A 1ICWA 4HSVA 3SK5A 5CORA 3CIRB 4FVMA 4WIPA 4BKTA 4E71A 2KC2A 5FO8B 4LFCQ 2NN6G 4JI2L 4K5WA 4XYCA 4V190 3J81c 4BY1H 1YJWA 1IBLL 1N32Q 4K8IA 1FD7D 2ENBA 4C3JH 1IBML 2KXJA 2WXJA 2TSSA 1CMXB 1B3AA 2F0HA 3PMFA 1N36L 2KOXA 4CHTB 3GTQB 3RNGC 2RA4A 4HMJA 2W3RA 3RULA 2FINB 5FJ8H 2R7ZG 4FA6A 1B50A 3PRMB 5C4ZA 2NVQB 5JH5C 4JWUC 1V1PA 3B0AA 3QG1A 5GMVA 1ZKOA 5M5WB 1XNQQ 4HEA1 2KJ6A 2KDFB 2IJ0A 1PFSA 1AN8A 1GC7A 3P2BA 3H15A 1I50B 4CDDC 2O6VD 2KWVB 2F0FA 3W9CB 1F2RC 4DFAA 4HIDA 1PH1A 4CKBA 3ITPA 4Z9CB 1WXMA 2GBRA 2KK8A 3EFUA 3PV1A 1FCLA 4EEWA 1V1QA 3Q3OC 3V62A 1EQQA 2KOLA 1S4ZA 3T8MA 2EY1A 4NKLA 1K8GA 1WR1A 3VUYA 1JRPA 2MRPA 3PV0A 2EJMA 4DV2L 3ZDTA 4IURA 3B9JA 3V6EB 5FLXE 3H3VI 2BBCA 4ICVA 2FCSA 3VH4B 2VUMB 4ZHPA 1DCZA 4P2CB 4A76A 5C2TB 2V0GA 3A1QA 2EY5A 3OMCA 2EY2A 1GUTA 3J81L 1GUGA 4POGA 3PZDA 1TKWB 4AWJA 1HTOA 2I1KA 1AWDA 1YMHE 3OMGA 2F0VA 3I9V1 2RMMA 5F2DA 1RM6C 3QWNA 1K83H 2BS3B 4LUOA 2HDLA 5C3EH 1E24A 1P7FA 1W6KA 4DR2Q 2UUBQ 2DGYA 4MJSB 1F52A 3DBHI 4DHZB 2D5DA 1YN4A 2DX5B 3DBRB 1H95A 2ATWA 4IJHA 2XIWA 2B2TC 4HMIA 4JC0A 4N8FA 2HQLA 2KECA 1G91A 1VCBA 3HOYG 3GTKH 1L0WA 1PZID 5IGDA 3QQ8B 5C4JH 1ZDXA 3VYTA 2B3AA 4AYBE 1WJUA 3TJPA 2KC1A 2V1CC 2EXZA 2RF4A 4CDEC 2L12A 3RMHA 1V8CA 4YTPB 5I2YA 3R93A 4HCSA 4RGTA 5JEAH 1XYIA 1HNXL 2OHFA 4JLCA 1AZQA 1LT4D 3VUXA 4GLAC 1IBKL 1G6PA 1VF5C 4FXKC 2ZM6Q 2L52A 2X6LA 4RF0A 1QOFA 1EWIA 3IKJA 3H94A 1D8LA 1UE5A 3HUIA 3S1NB 4X3UA 2MEKA 2R7FA 2HCIA 5EKLA 2LXCA 3HKZB 4IM0A 3UQAA 3SVMA 2FMCA 3MWYW 1WZ3A 3H8HA 2FCMA 2C5LC 4X66L 5BO4B 1SYCA 5M3FG 3V6CB 4C80A 5KEEA 4O2DA 3V96A 1BUIC 2D3GA 3AV8A 1I35A 4ANXA 1SN8A 4G7HC 4A3JG 2ZEQA 4YXDB 4X65L 2F3VA 4DF7A 2DZIA 2R93H 1EF5A 5FLXc 4AOFA 3U50C 4DAMA 2RSOA 4LFBL 4YT0B 5IWAL 1RF2D 1VS0A 3S9WA 4KDIC 1WCMG 1LQBA 1UE7A 4K5XA 1ENFA 1J8IA 4MGYE 3ZNID 1XCTL 5LHY1 1KIXA 4ZLTF 2N4FA 2ZZPB 1VQ8A 4FBJB 1NI3A 4HDOA 5C5LA 1C0AA 1S5FD 2PPBC 1TWFB 2BQQA 4DXAB 4JI1Q 5M3MG 2XGTA 2L9HA 4IJLA 2GRIA 2E2DC 2MNAA 1OTCA 1WGDA 3VFKA 2IO0B 2E2HB 4JE3B 1EOTA 1EUVB 2F4VQ 5BMGA 3AE2B 1T9HA 3MFYA 4J15A 3ZNHB 1Y1WB 2NVTH 1W6JA 2F0GA 3Q24A 5KHOA 3HOZH 1IL2A 3VR8B 4H44C 3FC4A 1Z9FA 3FKIB 2BE5C 4LNQA 1XT9B 1WVLA 4BY1B 3QK0A 4C3JB 4USAA 4MHEA 2KT7A 1NR2A 2A68C 4Q5VA 2RPQA 4AIMA 5IOCA 5KNDA 1KFYB 1FXTB 3STBD 3PTFC 2XWBB 4JI8Q 3WANA 3QARA 3X23A 2A5UA 5JHAA 1ASZA 3HZXA 3U4ZA 1LTRD 4OZBA 4XDCA 4DV5L 1QG7A 2B2WC 2QMTA 3TP8A 4XXEA 1VZ6A 3K59A 3PF5A 3PZ7A 3O65B 1EY4A 4A3CG 1C3TA 2LJ5A 1NMFA 5FKAC 3J81i 3KUDB 3MP9A 1PRTF 4A3FH 2KFKB 1UEBA 4HPMB 1WX9A 3ZJYC 5FLXL 4WORA 1CQFA 3I91A 4OZAA 1IKLA 3NHHA 1HQRD 4ZAIA 4MM3A 3TEHB 4BKSA 1T0YA 3SU8X 2QHOA 4JBKA 4P75A 1SIJA 1T5XD 3MEFA 2UXDL 1ILQA 2KQ4X 2VQFQ 2A5HA 4C1NK 2JXMB 4HJ8A 1YNJD 3FILB 3H6MA 3NXWA 1L5PA 1PZKD 2B2VA 1LTBD 2K8HA 1EWCA 1N33L 2W3SA 3A9JA 2ALYB 4WAAA 1C1YB 3IG3A 4DR5Q 4K8JA 3CMMB 3NELA 1L1OC 4H0LC 2JEAI 3GS2A 3ULLA 2D07B 3K5OA 4BBNF 4PMBA 1T3QA 1TY2A 3W5VB 1NAPA 1K0RA 2EYJA 1I94L 2EDGA 2KDBA 3TL5A 1SBBB 2KANA 1KRSA 3EROA 2IY1B 4ARCA 1VZ8A 2CQOA 4R8IA 2MX2A 1IBXA 1SNCA 2O2LD 1WJ4A 3PCOB 3F1ZA 4FHJA 3ZXVA 3KUZA 4FULA 2F0JA 2O6VB 5C3EB 3EJIA 3LWEA 5E7NA 4B3RQ 4KY7A 1CSPA 3TS0A 1Y1VG 3D4WA 2IO2B 4W9FA 3P75A 2FUG1 5CX3A 3SHQA 3LWUA 4ITKA 3AH7A 1WD0A 2W54A 5EAYA 2XVSA 5C4JB 3I3TB 2HHHQ 3SD5A 3HOVG 4L23A 5AUKA 3IFDA 1JCKB 1EY8A 2JU6X 5ELCA 4DAYA 5BN4A 4DUZQ 4DR6L 4N9TA 2QCPX 2I1JA 4LJOB 3EIVA 5E4WC 4A3IH 1E9MA 3A55A 4FF2A 4M8NA 1SE3A 1JWSD 3JSVB 2C35B 4HVBA 3BU2A 2L00B 3F2BA 5C23A 4PS7A 1JOKA 3I4NG 1DOYA 1JWAD 2KJHB 3PUVA 2K33A 1OTRB 1PH2A 1YIWA 4TSSA 4E3CA 3QC8B 1VQPA 2DY7A 2AUJD 2K9XA 3AE8B 4DV4L 3DWGC 4C3HG 1B2TA 1A70A 1WIAA 3A9KB 4RAUC 3NBHA 2RDFA 3WIMA 3L54A 3E0JA 4BA1I 3C8YA 2OF1A 3KJPA 3ZRCA 4QJFA 1GAQB 1DXMA 1GC6A 2LUMA 4KZ0A 2R93B 3M7GA 4UP8A 4KGSA 4RH6A 3KVFB 2BKFA 4JBMA 4OIKA 1KABA 1SDFA 2K5NA 1NR4A 1RDPD 4NAMA 4HTHA 3NTKA 4R4QA 3ZYYX 4DHZE 2WXPA 1FXAA 2PMVA 4EQ5A 2JA7G 1B70B 1E6EB 5BYSA 4ZQ3A 4DR3Q 3FEWX 3HOXG 4DWFA 1PH6A 4JI4Q 3HP3A 2XSCA 1SYGA 2V4IB 4ACFA 4AP4C 2EJGC 1EEID 3DUZA 3NE5B 3QHTA 3A7LA 4DBGA 1RCVD 2F0NA 2PYKA 4R4IA 3CP0A 1XMOL 3AEDB 4K1RB 4ZKBB 3T1HQ 3CF5A 3U4EG 2J42A 4YCWA 3N52A 2JP1A 3QOLA 1V43A 4IUUA 5M5XH 1M4VA 3G7LA 1PH8A 2WXOA 3KF6A 3HOZB 2DYOA 4NPNA 3VUWA 4OGQC 4QIWB 5D6JB 2GI9A 1X3GA 2IHEA 2WB1G 4PV1C 4BAXA 2XTIA 3C1FA 5IP7G 2MW5A 4DV0Q 3X0WA 4O42A 4US8A 4MN3A 5CBAE 4NJCA 1YNXA 1BBXC 3HKZE 1GUOA 3PIPA 1BT0A 1BO0A 1BF4A 1XTDA 3I4MG 5KRUA 5AEKB 1ROEA 2WKDA 1ZKHA 3DDCB 4W9GA 4QUFA 4GOPB 4HCNB 4LNIA 1TVXA 4A90A 2L1BA 2K7VA 1R7SA 1ET9A 1I4XA 2AUKA 1IKMA 4A3KB 4W9DA 5ELOA 2A6ED 3ZXRA 1V80A 1RLFA 1HXYD 1E8WA 4JI1L 3L2PA 3HM3A 3MVVA 4DK6C 1S1QB 1XPUA 4OX9Q 3AE4B 2WAQG 1K53A 4A3EG 4W9IA 5IP4D 1JJCB 5E6PA 1TQOA 1OQRA 2Z59B 3T3NA 5IP9G 5C5MA 1YNNC 3Q3JA 4W9CA 5T8IA 5C0XH 5KHQA 1X32A 4IZ8A 1TWGB 5ELBA 2F0UA 3S15H 4A3LG 1LACA 1Q1BA 2WP8J 1OQYA 3RNBC 3KOJA 3X3MA 4B9XA 4ZUIA 2JY6A 2E5LQ 2OEOA 4MZ9A 2B63G 4XE0A 1PGBA 3ERSX 3DWMA 3VAWA 2B3GA 2V4LA 1VLBA 1B1ZA 4XT3B 1HFGA 1SJHD 4MDKE 1ISNA 2LRWA 1GXDC 2ZNVB 3DHHC 4HJAA 1FFUA 3H1UA 3K57A 1VQFA 4I7AA 1CKMA 1QZHA 1WGRA 2PEAA 3BZKA 3TCAA 4EQPA 2L11A 1V6EA 4RWSC 4RNAA 1UZXB 2JQRB 2DJFC 4KHPL 2MBBB 4K2KA 4L6TB 1RAXA 1SGHA 2IZVB 1B8AA 1WGKA 4HROA 4DV6Q 5D2MB 2HIXA 4B08A 2A6HC 1GM5A 1TWCH 4BY7G 1V5OA 1KJTA 1HR0W 1I42A 1FJGQ 2M1MA 5C44H 1RKNA 4JI3Q 4DV1Q 4WWNA 5AZFA 2Y0SG 4HCEA 1X54A 5KYIA 3CF6E 3PRZA 2VQFL 4A3IB 1SSNA 1KLGD 3DBLI 2E6XA 3H0GB 4IM3A 2BA0A 3AEBB 4MGZE 4TQ0A 1O78A 4AQYQ 2KAJA 5KYLA 4JG2A 1EUJA 3KYHC 1XD3B 1WD1A 4HDQA 4C7YA 3I56A 1XMQL 1E0ZA 4RHRA 4GS3A 3L16A 2WU5B 5AJ3Q 2KVMA 3UDFA 2ZPYA 4HPPA 1QZGA 1PYSB 5DEHA 3A56A 1L0XB 4L5TA 4A3DG 3MJ5A 2WQYB 2PLPA 2JA6G 2VQEQ 4P6VF 2KHJA 3QCAA 4FJZA 3PIOA 3CCQA 2BF8B 4AYBG 1S40A 4LF7Q 1L4ZB 3ZW3A 1LT3D 2K52A 1BCPC 1E2ZA 3BVGA 1V2YA 3RNUA 4RGMA 3B2FA 3AE9B 1B9NA 3KK7A 5FK9C 4JI0Q 4FJYA 1YZ6A 3UDXA 1FNVA 1RWSA 3QIAA 5HY6A 1K52A 4L2YA 2LEKA 2RHSB 1QVCA 5KIXA 1Q86C 2N1WA 1EL0A 3QX1A 1HUNA 3CD6A 3HHMA 2NTTA 2FCNA 1C4QA 3HK0A 3QWZB 5LMNQ 3IBEA 3I4LA 1PTOF 4IM2A 3P4SB 3I70A 3D32A 4NMZA 1VQBA 2W82A 3EUB2 4B9WA 3GE8C 2K0PA 3E0EA 3QB3A 4LWCA 1C4PA 4PZ8A 4B6WA 4WRDA 4LW1A 4WJ4A 3KYCD 4POFA 2REXA 4FXCA 2KCCA 3ONSA 1L6UA 4HKZE 3AE7B 1I3QH 1A0IA 1YX6B 4A3OA 4GLVB 4A3BB 4I6NB 3FMCA 2M17A 1PMRA 4M8AA 4A3GG 3OJ4B 5LL6X 4RKBA 2L5TA 1NNXA 3PZ8A 4IUQA 5A35A 2LY7A 2HTHA 1IBLQ 3MC0B 1IBMQ 2G4DB 1EZ8A 4BBSG 5M5YH 2WXNA 3VRBB 1LABA 3A74A 2WXKA 1SMYD 3U7ZA 1N36Q 4XZ4A 1AH9A 4IG7B 1B4OA 3KW5B 4JBJA 4KKUA 1PH5A 5C4XH 3T53B 5M9OA 3E6ZX 4QCLA 2EIFA 1CKOA 1OXTA 2EZVA 3S2AA 4AQ7A 4ASWC 1SB3C 4XYOA 1R4MB 4LUVA 2CVRA 3NQTA 2L0CA 3MAQA 3AB5A 1RD9D 1BOSA 1I6HH 4EUTA 1ZYRC 4C3IH 1HTQA 4FXGC 4QIWE 4BBRH 3VR9B 4OIJA 2KFKA 4UP7A 3A4RA 1EM7A 4MGKE 1AFPA 1EEFD 3ZQ4A 1JORA 2O5JC 2RDBC 1PFNA 3N3KB 4IDIA 3U9OA 1EYGA 1I4GA 4XDXA 2B2YA 2GVAA 3CC7A 2PZUA 2ACZB 1P9DU 4GDKB 1J0GA 1K28A 4DV2Q 1NDDA 4EKUA 1TT5B 2R2OA 3HRDD 1SXTA 5TR5A 3UGBB 4RFBA 1UBIA 2X8XX 1FEHA 1QT9A 2KLGA 4LLGM 3Q22A 2GB1A 2B2VC 2ZJRA 2OCEA 1ZXTA 1TKYA 1C7YA 4TMAB 1AE2A 5GADC 2DBYA 4LAAA 4KSKC 3IXSA 3RT3B 2X6GA 4AH6A 4OO1G 1X1MA 1MD2D 1M8AA 1HPCA 2HCCA 1D6EC 1EYAA 2NVQH 2PIAA 3H7PB 4XWTA 3AN1A 2WINB 5IKCM 4ULLA 4P72A 1NENB 4WJ3M 4G7OC 3L17A 3NZ3A 1DYQA 1XLQA 2F3WA 1FCCC 2O6VA 1MG4A 3I3CA 1JWMD 1IBXB 2Z0EB 4CKCA 2ZXRA 1HQMC 3RLFA 4ZUJA 4GMVA 3ONAB 4DV3Q 3TREA 5J39A 1LT5D 2QGQA 2LGDA 3MTNB 4KJNA 1XPOA 1Q0WB 1WY8A 2CS4A 3LDZE 1N5XA 3W2DA 3DM1A 1HNXQ 3WCQA 2R92G 2V9HA 1HH2P 1EYDA 2NVXB 1IBKQ 1P0RA 2AWTA 4DV6L 2UU9L 2BDOA 2ICEC 3CSTA 3PHXB 1E0BA 3NWSA 4UDUC 4D2KA 3JSVA 3NVWA 5IGEA 4L63B 2K6DB 1E90A 3EGRA 3NZSA 1KXLA 1FJGL 2ICIA 4K7UA 1YQBA 2K8CA 4DV1L 4X66Q 1JOQA 2EYMA 1WGHA 3DPDA 1CQVA 4KK7A 3F8TA 3S2DB 4OVUA 2FHTA 1UWXA 4MELA 1EY7A 1K3RA 1JICA 3B2GA 3A9KA 4X65Q 1JALA 4MNOA 4XQQA 3OPOA 2BWFA 2F0LA 3A54A 1JJ2A 2VNUD 2DZJA 1SJED 1HE8A 2ZJQA 2PNRC 2QCZA 1LM8B 2Z6BA 4LFBQ 2WLBA 4WAFA 5G3LF 2C7HA 1LYLA 5E4XA 1M90C 1PH4A 1D1KA 2IGHA 2XEWA 3NHEB 2D10A 1H9SB 4PMCA 2LKVA 1WMHA 1LTAD 4B0EA 4US9A 2OQKA 1C9FA 2WV6D 4IFDJ 1I3QB 1Q12A 4ZYSA 1MI2A 3DHGC 1JROA 1TTNA 4M01A 2DY8A 2FUHB 4IFDG 1PRTD 2Q8RE 3ND8A 3BK1A 5C3XA 3VDYA 3TBIB 1OXXK 1X3FA 4A55A 2ES2A 1TWAB 3NTHA 4KKIA 4BXXH 1VDZA 2FJ2A 5CV9A 2FXQA 2CKHB 1IGCA 4UAIA 1E8ZA 4GDLB 2UUAQ 3UQBA 2CWAA 3PUXA 3E9SA 4GLSC 3HKSA 2WYQA 3VYRA 2DN8A 3R66C 4DV5Q 4B3SL 2M56B 1WX8A 5IE8A 2K1BA 2YTVA 5LMNL 2INNE 3BDOA 3OTOL 4TKOB 1QF6A 1WZ0A 4PQXA 4JL9A
chains in the Genus database with same CATH topology
3CU7A 2R6GA 1RJTA 3FRPB 1I6HB 4PMWA 2Y5PA 1N60A 5EPLA 5ISRA 2I38A 2RBMA 2F0WA 2PW7A 1F2ZA 4ZRQA 2BE5D 1SE2A 1UNSA 2YEPF 4C7ZA 1II3A 1IYUA 2NN6H 4ABNA 2DNEA 3MXUA 1WRIA 1ZDVA 5BYQA 1QWYA 1UAPA 4ILWA 4OO1I 2E2JB 5FR3A 2F0SA 2F0PA 5A2QE 2EYHA 3Q8EA 1FRDA 4A93B 4C3JG 1RHPA 2Y3AA 3OSOA 4S3SA 1C8CA 4WFN3 3CWIA 4XQNA 2J4XA 3QJYA 3OIPA 1DD2A 1WTWA 2JA8B 4A3MB 1I7HA 3BVZA 1FRRA 3P4PB 4KKTA 4HKQA 2K5QA 2WXLA 1OO9B 3GD7A 1NCVA 4HRSA 3A8KE 5I6WA 5EBDA 1HTLD 2C5CA 4GZYC 1AYFA 3URYA 1F2RI 2O5IC 5D3IB 2H4OA 3SK4A 3HVDA 3S17B 2SDFA 1L0YB 2ZW1A 4XIGS 4N6EB 1C4AA 1IYVA 2MP1A 3KLSX 3AE6B 2LMCB 2MJ8A 1FO4A 2R61A 2PKOA 2IX0A 1I4HA 2EVBA 1WTQA 1TS4A 4MT5A 3ABVB 3U52E 2Y5CA 1CFMA 5EGTA 4IFDI 2A69C 1O7LA 4QUCA 3T16A 1KAAA 3C3LA 2MJDA 3DWQA 4K2LA 3KBGA 2N9KA 1A3UA 1BXTA 5JEAJ 2WP9B 1WXQA 1Y8NB 4DU9A 3M85A 3PO3B 3K5NA 3I90A 1XTCD 2AQ1B 3ERQA 3F2UA 4HAEA 3HGBA 4ZRZA 2BCOA 2EYPA 4RKLA 2EYFA 1EIGA 2QF7A 5EKKA 5KNCA 1PRTB 3V3XA 4E6IA 1KF6B 2ON8A 5J1ZA 1XLNA 1HZ5A 4C1NI 2KCNA 3VYSA 3AEAB 5GXGB 3L9AX 3TZDA 1JWBD 1I6VC 2F0TA 5A2QL 1XO3A 1ZXHA 4KD3A 1K8MA 4KY5A 4RCOA 2SEBD 5D65A 1OXUA 2BOSA 4KMUC 1F9QA 4J8QA 3MXGA 2IGGA 4ZKCB 1PGAA 2R7ZB 4DK1A 2OXPA 3LYYA 3MEHA 1HCZA 3CRLC 5I9PA 1MGSA 4JK1C 2BTEA 4KD4A 2K6AA 4A9AA 2M9VA 5JJZA 1KNAA 1YQ3B 1NSNS 2B2YC 4HR7B 2BA1A 5EJWA 2KMMA 4WQMA 4LJZC 2NWGA 3AE3B 2N0SB 3T13A 3AMZA 4KX6B 3MXPA 3VYUA 4K5VA 5FO7B 1FGBD 4RGNA 5CGKA 1ZP0B 1CZWA 3AE1B 5EE1A 5LNK1 1CHQD 3FPPA 1ZE3D 5ELFA 1RFKA 5NUCA 4G7ZC 3RUZA 2WNMA 4H13C 2WDQB 1UEAB 1SEBD 3DXJC 4J6HA 1C76A 1C78A 1XXGA 1OQQA 2DWQA 1CK1A 1PTOD 3AU7A 2A6HD 2M19A 1TY0A 5EE0A 2PW9A 2WXFA 1XEEA 1QCBD 3NK9A 2J52A 3VR5A 4ZRPA 3K5LA 5IGFA 1C77A 3HOYB 2WU2B 1JB3A 4HEDA 2ONQA 1SYBA 1QOAA 5IODA 2INPE 4DAVA 2GA4B 1TKEA 1QNKA 3ZJVA 1FIQA 3WOFA 3KWLA 1GHKA 2V3NA 1YQ4B 3PUWA 1AEXA 3AM9A 3P1MA 1FD6A 1YN3A 2NVYB 1FNUA 4J3OD 2F4IA 3W5UB 5AFWA 3P7JA 3KLRA 2RPVA 1R9TB 5IGCA 3PO0A 5M3FB 3U9SA 2KJXA 2W55A 5COYA 4KN7C 1H9SA 4A3JB 1WTXA 1BCPD 3QOJA 1O80A 1JC7A 4N59A 4JWSC 3AMUA 3E56A 1QB5D 1V8QA 1JR0D 1F77A 4PNYA 2VXWA 1WCMB 1IHZA 2KWDA 5HI1A 3NWTA 5M3MB 3L7ZC 5D3DA 5CV4A 1R4QB 3GTGB 2IX1A 2E75C 4C2MB 1F9PA 2G1EA 1WSPA 4DXFA 4O1NA 3P4RB 3M7NA 2IDYA 1ENAA 1IL8A 1STEA 3RPFC 2H89B 3L3OC 4M0WA 2WDVB 3HOUB 3KF8A 3N9YC 1O7ZA 3KUPA 4REZA 1LTGD 5I6YA 2KEEA 3NUHB 3P20A 5H92C 3MFGA 3D6CA 3SR6A 5IGBA 2AQ3B 2KACA 2IWHA 1HRJA 2JSVX 1UGJA 1EIHA 3LXFA 5MPOA 4MACA 2AQ2B 3UI2A 1EZ6A 2B76B 2XNAC 1XWEA 2E3TA 3V05A 3V2TA 3KWVA 5HHDG 1Y56A 1TS2A 3TP5A 4OHJA 1J9OA 5C0XJ 3GQBA 4FP5D 3Q69A 2F0IA 2Q8TA 5D14A 1C48A 1E2VA 1EWHA 5G3LD 5FOBB 4NW2A 2M2LA 4M1UB 1CTMA 1VJKA 3L4PA 1UUPA 1Y1VB 1TZOA 3OHXC 3JAME 2ID0A 3NVZA 5JOBA 4RA8A 2V4DA 3HOVB 2F0KA 3NP8A 1FNWA 1KDCA 2L1AA 4QB4A 2PO4A 2N88A 2LJIA 1KH0A 1CZGA 3GV6A 1OFFA 1RODA 2F0QA 3I4NB 2BYTA 2K04A 2NYZD 2WXGA 3D8GA 2LMCA 1PTOB 2MHVA 1EY5A 5EQ0A 4C3HB 3VQIA 4K6LA 2CJNA 3H09A 3AB9A 3TP6A 2X69A 3BYYB 1TIID 1N62A 3Q8AA 4V0BA 2CW0D 1NVID 4CGYB 2K03A 5DNFA 3HOXB 5D7GA 3OOCA 2L83A 5BN5A 3J7YW 3J7AF 4L8JA 2J0TD 1C79A 1SNQA 5C4HA 1KTKA 1BCPB 1ZEQX 3RZDB 2WB1B 4P16A 3A8IE 3VR6A 4FNFA 4FF1A 5IIFA 3I4MB 3RZOB 1BQQT 1C4CA 4JBWA 4IALA 1J7BA 1LO5D 4TRDA 2WXRA 5C3JB 3HEJA 3SK8A 1V1OA 2K5PA 1PFMA 3VR2A 3BVMA 2WAQB 4A3EB 3I72A 1QLBB 5G5HA 2JEBI 4ODGA 5C3WA 1BCPF 1ZUD2 4WH4A 2M00A 4NZLB 2OT2A 2K5DA 2M0AA 3GTJB 2A6EC 2N7JA 5C0XI 2B63B 3JAML 2N9LA 1H9KA 1K50A 2LFIA 3TMEA 2E2IB 1J7AA 2K28A 5EE9A 3CHBD 3FDTA 1ZPSA 3M4OB 4C3IG 2KQ3A 5CC4A 3GO5A 4DAPA 3FVQA 4BY7B 3S14B 1F2YA 5CBEE 3K6OA 2RKSA 2Y0SB 2G9DA 1PDXA 1GB4A 5K36H 1XLPA 1SFOB 4Q2JA 1U4MA 5KGUA 3ETRA 2H1EA 3EA6A 4DNRB 4ZHOA 3MA2B 3NPPA 5CV5A 2PMZB 4DNTB 1QNUA 1KLUD 3P1HA 2EYLA 2BS2B 1G2SA 2L4NA 4YTNB 4ZK9B 4OL7A 3E5SA 4U68A 4A3DB 2JA6B 1TS5A 1S5DD 1DOMA 2EELA 1PZJD 3EFXD 1F9SA 1FM0D 1KDAA 3T3OA 3VR4A 1B9RA 1NEKB 5I4DA 3FPUB 1GUWA 3BS1A 2MUYA 3IL8A 2RVLA 1GOZA 5E3FA 3O13A 3D31A 2F0DA 5H8YE 2HUGA 3BK2A 1A6XA 4BWGB 1QJOA 4DXGA 3S1RB 3S16B 2JXTA 1BUVT 3BDLA 1Q10A 1MHHE 1XX8A 4IUVA 3Q8BA 4R8NA 2B2UA 1WYGA 4NDXA 4I7ZC 4DA2A 3ND9A 2WDRB 4EQNA 1HA5A 1STYA 4KHVA 4X3KA 4A3GB 4FYDA 1KDBA 2YEPB 4XDDA 4RGOS 3WDNA 1U4PA 4BBSB 2WXHA 3HRZC 2AWOA 2MPMA 1KNEA 2Z4IA 1FR3A 2NMQA 3K58A 2SOBA 2FFKB 2IX3A 2NZ1D 1TU2B 4F7XA 3K7AB 3TN2A 2HDEA 3DEOA 1STAA 2PCFB 1STNA 3P42A 4HJGE 2G9HD 4C56C 2NUCA 2MJ3A 1SMYC 3G6JB 1XCQL 1N63A 4YSYB 2BB6A 2A68D 1PDQA 5LL6S 3GTPB 3SEBA 3SK6A 1G2TA 2X38A 1A3TA 4YIJA 4WWMA 1LTSD 2J7ZA 1I4QA 3P63A 4BA2I 3HVZA 1DM0B 1SE4A 1A2TA 4Q0FA 3OWEB 1Q1EA 1WTRA 3GP7A 1I4PA 1CI3M 2RDHA 4U673 2J53A 4YWGG 4LK1C 3EQLC 3SHLA 1VCIA 2D9UA 4CKEA 3M3YB 2NTSA 5HGTA 5I9OA 3PUYA 3EVQA 1H9RA 4XTCS 3I73A 3PIP3 3NUCA 5JVG3 1F0ZA 1F2LA 3LB8C 4DGZA 1MVKA 4WJWA 3DHQA 1UWMA 3BG3A 4F88A 1T5EA 3HG9A 2D62A 1VZ7A 2R92B 4IQZA 1FFVA 1D1IA 1SNPA 3H3VC 1Y69U 2RSNA 2QDBA 5DM73 2AWNA 2Q8IB 3AEGB 4XWWA 2F0MA 4DK0A 2EPBA 2I2YA 1SNDA 1H9JA 4L1BA 4CJ0B 3HS0C 1CA5A 2MJEA 4OVZA 1LV9A 3DEPA 1LT6D 2D2CC 1QOHA 1CJEA 1SF0A 1HA6A 3NVVA 2F03A 1EWYC 4IN3A 5JPMC 4K6DA 4NP5A 2AX5A 2LFNA 4KHZA 1STGA 3KLSA 3J9CA 5EPKA 4CJ1B 1G6ZA 1JE4A 1DJRD 1BMLC 3TUOA 3Q6SA 2EYOA 3SE0A 2JZPA 5BMIA 5JEAG 1YJIA 1X3QA 1IGDA 4CJ2C 2BDNA 1YNTE 1HUMA 3OW7A 4KV6A 4DN4M 5HURA 3CKIB 3NS1A 2PZTA 5I2XA 1D5XC 1PRTC 2JYOA 1PYWD 3Q8FA 1GUSA 2CQAA 1OXSC 2LS01 1AP0A 3KQ4A 1TKGA 1HZ6A 1QQRA 1FMAD 3D4RA 1PGXA 5JVH3 4N58A 3I57A 2PVOD 3LX0A 1WTOA 5E1FA 4IOIE 2KUMA 3PIO3 1IW7C 2A73B 1J7CA 1EY0A 2MGSA 1PLFA 3D4DA 4KGRA 1T6BX 1I4RA 1JQ4A 3QO2A 3VRAB 1U9RA 4X3TA 2VB2X 4OZCA 2BT6A 3W3AA 2FBWB 2FMMA 2EKIA 2NN6I 5BMHA 1F9RA 1U4LA 3OWFA 2RDGA 1VRAB 2CU3A 3BZDB 3NSWA 2R3ZA 1Q8IA 2Z4HA 5DAUA 1YNND 1RYJA 5HG2A 3C1EA 2F0OA 3J7AV 1QOGA 3PUZA 1Z6HA 2IL8A 1JMLA 1E10A 5J22A 4ZOHC 2BB5A 1VMCA 1EY9A 2IGDA 4TQ1A 5EE3A 2SNSA 3R2TA 3RFZB 1E7PB 2OEDA 3UI3A 2KHSA 2XRQD 3U2SC 1DOLA 4WURA 2O4XA 3TEXA 5EBCA 2K01A 3IFTA 3TDQA 3SDZA 5HFYA 3D6WA 1B53A 1XLOA 3CRKC 1ET6A 4EGVA 5JAVA 1ILPA 3H91A 5EPJA 3IT6B 1ACCA 2BW2A 3MHZA 5JXVA 3IAM1 5CMDA 2IW3A 2HQEA 2IT1A 4KN4C 1B9MA 4YTMB 5IGGA 2LGIA 1K83B 1Z47A 1TWHB 4K14A 3SFDB 3MXNA 3SFEB 1MBYA 2WACA 1JW9D 2LHEA 4KKSA 2WIIB 2QEJC 2N55A 4NAWB 5E6JA 5AUIA 1MHXA 3Q23A 2I07B 3GTKB 4BS9A 1PTOH 3C46A 5JPNC 2B8GA 5BYRA 2A74C 2Q5WD 4ID6A 1MPEA 4OW0A 4LTUA 3GTOB 2TMPA 3MHBA 2HDMA 2KDMA 4JPSA 1DONA 3IT4B 1EFID 2K32A 4A8XC 1LLRD 2B2UC 1PFDA 3AE5B 1JWUD 1BR9A 1L6VA 1TS3A 1QILA 2EY6A 5FO9B 4B0MA 1CZPA 3GTMB 2ZXOA 2B39A 3Q8CA 1F2MA 1Z7TA 2F0EA 2WXIA 1Y8PB 4MIUA 1HHVA 1TYGB 3BWUD 3D3RA 3R2IA 1IUEA 1GB1A 2C9OA 2H88B 1GUNA 3DWPA 2NVTB 4KGTA 4Y7NB 1ZOYB 1Q90A 2I46A 4H2AA 4RF1A 3BYTB 5CV8A 3I8ZA 4AS1A 2PZWA 2WKCA 2K3UA 2VB3X 1DOKA 4R3DA 2D5GA 1ZYRD 4A3FB 1VMPA 3PO2B 4YSXB 3ZJTA 3AEEB 2ZT9C 4FO2A 2NBFA 3VA7A 1R4PB 2HTME 5C0XG 3LNNA 3X3NA 1H9MA 2QKIC 4DQOC 3HOWB 4FXDA 1YNJC 3NRZA 1G8ZD 2SNMA 1TT2A 5CV6A 3A8JE 2PTLA 1V1PB 3A7AB 3NVYA 2IPKD 5T1IA 2CHBD 1SYFA 1A2UA 3AEFB 3TEYA 4PT5A 1ENCA 1PTOC 1BDOA 2EOTA 1HFNA 4KTAA 4N9PA 4CQNA 4EE2A 5IT9E 2K22A 2JYTA 1HTPA 4XT1B 1G291 4TQUS 5CR3A 5CV7A 1DZ1A 1PUTA 1AZPA 3P4QB 1HEZE 4J1MA 2KA7A 1K8OA 1CT1D 4QF4A 2SAKA 1TJEA 1NYQA 1SNMA 3MZ5A 2JA7B 3SXHA 1A3VA 1Y8OB 3J80E 1DGJA 4HSPA 1B44D 2B2TA 4RHSA 5EKIA 3C2PA 4FF4A 1S5BD 1CM9A 1EU3A 2E74C 1EQVA 3DWAA 4F87A 3Q0AA 2JWUA 1AW7A 4G57A 1EY6A 4YSZB 4X3SA 3GTLB 1RTOA 1L4DB 2PW5A 3NBIA 1OXVA 3SR1A 4IUPA 5KNBA 5M5XB 1GHJA 3T56B 1S5CD 2YYZA 2XN9C 1N61A 3IAYA 1ESFA 2WXMA 1Q3LA 4KI0A 4HN7A 5ELEA 1MI0A 1X3PA 1SYDA 3MTSA 4IUNA 2RQXA 1WTVA 2QSDA 2VZKD 3AECB 2PVGC 2MH7A 2NB0A 4MH8A 1PXUA 2LHDA 2Z1CA 3K0YA 2Z8LA 2JYEA 2L32A 3BIID 1EQTA 1ZXIA 4A6QA 1VDVA 3S15B 4XYQA 4FF3A 1XF5L 3ZGZA 3GV3A 3IAS1 2B2WA 1FXIA 2WXQA 1CHPD 1YN5A 2JX5A 3BDCA 1NYRA 1VF7A 5IT9L 2EJFC 1ONLA 1QKZA 2PQEA 4OO1H 1LTID 2K5WA 3R3OA 1MSGA 2KN4A 5BN3A 4LK0M 4MM3B 2K05A 4ME5A 2QILA 3FILA 1TR5A 1S5ED 1TWCB 3K5MA 2ZW0A 5C44B 5CYUA 4CBVA 1D4BA 1GPXA 1CA6A 4IUTA 4RCNA 3J80L 5K36G 2EE1A 2XRSD 1D5MC 3TP7A 2WS3B 4F8MA 4XQJA 4KY6A 3TEZA 1P7EA 4AYBB 1O7YA 4IKGA 5T1GA 2B8FA 1DOIA 1MSHA 1EYCA 1YJJA 1U4RA 4JX1C 3CQZB 5G5GA 1L0VB 2XWJB 2L55A 2KEDA 1STHA 5K5PA 1V97A 3TEWA 3TSSA 1DOXA 4EQOA 4KJOA 4EVOA 5C6AA 3WOEA 3NQIA 1GJXA 2A69D 3KBXA 2FE8A 1FYCA 5TSSA 2CW0C 5ELDA 4I65A 3VA5A 1ML0D 3NTIA 1RTNA 1ESRA 4IFDH 1BNZA 4QMGA 1PFBA 5DM63 1JOOA 2CJOA 1NUCA 2DLBA 3J81E 1E2WA 1D2BA 1EU4A 1KRHA 3DMUA 1SAPA 4KKJA 1WTPA 2ZXPA 4R9WA 2JA5B 3ZJUA 1QOBA 3FAHA 2DNCA 2E76C 4LMQD 2DYMA 2YU9B 1STBA 3R8BA 3VR3A 1A15A 1LTTD 3M4YA 3W1SA 5M5YB 3OIQA 1JQYD 3TZUA 1VR9A 1SNOA 3S1MB 3RD4A 5C4XB 1IW7D 4G4KA 2V3PA 3S1QB 1K51A 4H7BA 3S2HB 2F1MA 1QE6A 1SYEA 3GB1A 3N6RA 1N5WA 2QIEB 4C3IB 4BBRB 2VZKB 3T4AC 2BS4B 1WWTA 2JE6I 2QJLA 3T51B 2JSOA 1D5ZC 1SSOA 4ARIA 1ICWA 4HSVA 3SK5A 5CORA 3CIRB 4FVMA 4WIPA 5FO8B 2NN6G 4K5WA 4V190 4K8IA 1FD7D 2ENBA 2WXJA 2TSSA 1B3AA 2F0HA 3PMFA 4CHTB 3GTQB 2RA4A 4HMJA 2W3RA 2FINB 1B50A 5C4ZA 2NVQB 4JWUC 1V1PA 3QG1A 1ZKOA 5M5WB 4HEA1 2IJ0A 1AN8A 1I50B 2F0FA 3W9CB 1F2RC 4DFAA 1FCLA 4CKBA 3ITPA 4Z9CB 2KOLA 1S4ZA 2EY1A 4NKLA 1JRPA 3PV0A 2EJMA 4IURA 3B9JA 5FLXE 2BBCA 2VUMB 4ZHPA 1DCZA 4P2CB 2V0GA 5C2TB 2EY5A 3OMCA 2EY2A 1GUTA 3J81L 1GUGA 1TKWB 1AWDA 1YMHE 3OMGA 2F0VA 3I9V1 2RMMA 5F2DA 1RM6C 3QWNA 2BS3B 2HDLA 1P7FA 1W6KA 2D5DA 1YN4A 2XIWA 2B2TC 4HMIA 1G91A 2KECA 1PZID 5IGDA 1ZDXA 3VYTA 2EXZA 2L12A 3RMHA 1V8CA 4YTPB 5I2YA 3R93A 4HCSA 4RGTA 5JEAH 1XYIA 2OHFA 1AZQA 1LT4D 1VF5C 4FXKC 2L52A 2X6LA 4RF0A 1QOFA 3IKJA 3H94A 3HUIA 3S1NB 4X3UA 2MEKA 2HCIA 5EKLA 3HKZB 3SVMA 2FMCA 3MWYW 3H8HA 1SYCA 4C80A 5KEEA 3V96A 1BUIC 3AV8A 4G7HC 4YXDB 2F3VA 4DF7A 2RSOA 4YT0B 1RF2D 3S9WA 4K5XA 1J8IA 1ENFA 1XCTL 5LHY1 4ZLTF 1NI3A 5C5LA 1S5FD 2PPBC 1TWFB 2L9HA 2GRIA 2E2DC 2E2HB 4JE3B 1EOTA 5BMGA 3AE2B 3MFYA 1Y1WB 1W6JA 2F0GA 3Q24A 3VR8B 4H44C 3FC4A 3FKIB 2BE5C 1WVLA 4BY1B 4C3JB 4USAA 4MHEA 1NR2A 2A68C 4Q5VA 5KNDA 5IOCA 1KFYB 2XWBB 3HZXA 1LTRD 4OZBA 4XDCA 1QG7A 2B2WC 2QMTA 3TP8A 4XXEA 1VZ6A 3K59A 3PZ7A 1EY4A 5FKAC 3MP9A 1PRTF 5FLXL 4WORA 1CQFA 3I91A 4OZAA 1IKLA 3NHHA 1HQRD 4ZAIA 1SIJA 1T5XD 1ILQA 2KQ4X 2A5HA 4C1NK 2JXMB 1YNJD 3FILB 3H6MA 3NXWA 1L5PA 1PZKD 2B2VA 1LTBD 1EWCA 2W3SA 4K8JA 3GS2A 4H0LC 2JEAI 3K5OA 4PMBA 1T3QA 1TY2A 3W5VB 1NAPA 2EYJA 2EDGA 1SBBB 4ARCA 3EROA 1VZ8A 4R8IA 1IBXA 1SNCA 2O2LD 2F0JA 5C3EB 3EJIA 3LWEA 4KY7A 3D4WA 3P75A 2FUG1 3LWUA 4ITKA 3AH7A 1WD0A 2W54A 2XVSA 5C4JB 4L23A 5AUKA 3IFDA 1JCKB 1EY8A 2JU6X 5ELCA 4DAYA 5BN4A 4N9TA 2QCPX 5E4WC 1E9MA 3A55A 4FF2A 1SE3A 1JWSD 1JOKA 1DOYA 1JWAD 2K33A 3PUVA 4TSSA 2DY7A 2AUJD 2K9XA 3AE8B 3DWGC 4C3HG 1B2TA 1A70A 4RAUC 3NBHA 2RDFA 3E0JA 4BA1I 3C8YA 2OF1A 1GAQB 1DXMA 2LUMA 2R93B 3M7GA 4KGSA 4RH6A 4OIKA 1KABA 1SDFA 1NR4A 1RDPD 4NAMA 4HTHA 3NTKA 3ZYYX 2WXPA 1FXAA 2PMVA 1E6EB 5BYSA 4ZQ3A 3FEWX 3HP3A 2XSCA 1SYGA 2V4IB 2EJGC 1EEID 3DUZA 3NE5B 3A7LA 1RCVD 2F0NA 2PYKA 3AEDB 4ZKBB 3U4EG 2J42A 3N52A 2JP1A 3QOLA 1V43A 4IUUA 2WXOA 1M4VA 3G7LA 3HOZB 2DYOA 4OGQC 4QIWB 2GI9A 4PV1C 3C1FA 4O42A 4US8A 4MN3A 5CBAE 4NJCA 1BBXC 1GUOA 1BO0A 1BF4A 5KRUA 1ROEA 2WKDA 4QUFA 1TVXA 4A90A 2L1BA 2K7VA 1R7SA 1ET9A 1I4XA 2AUKA 1IKMA 4A3KB 2A6ED 1HXYD 3MVVA 3AE4B 1K53A 1TQOA 1OQRA 3T3NA 5C5MA 1YNNC 5T8IA 5C0XH 1X32A 4IZ8A 1TWGB 5ELBA 2F0UA 1LACA 1Q1BA 2WP8J 3X3MA 4B9XA 4ZUIA 2OEOA 4XE0A 1PGBA 3DWMA 1VLBA 1B1ZA 4XT3B 1HFGA 1SJHD 1GXDC 1FFUA 3K57A 4EQPA 2L11A 4RWSC 4RNAA 2JQRB 4K2KA 4L6TB 4HROA 1WGKA 4B08A 2A6HC 1RKNA 4HCEA 5KYIA 4A3IB 1SSNA 1KLGD 2E6XA 3H0GB 4TQ0A 2BA0A 3AEBB 1O78A 2KAJA 5KYLA 1WD1A 4C7YA 1E0ZA 4RHRA 2WU5B 2KVMA 5DEHA 3A56A 1L0XB 3MJ5A 2WQYB 2PLPA 4P6VF 1L4ZB 1LT3D 3BVGA 1BCPC 1E2ZA 4RGMA 3B2FA 3AE9B 1B9NA 3KK7A 5FK9C 1FNVA 1RWSA 3QIAA 1K52A 4L2YA 2LEKA 5KIXA 1EL0A 1HUNA 2NTTA 1C4QA 3I4LA 1PTOF 3P4SB 3I70A 4NMZA 2W82A 3EUB2 4B9WA 2K0PA 3QB3A 1C4PA 4WRDA 4FXCA 2KCCA 1L6UA 4HKZE 3AE7B 4A3BB 3FMCA 1PMRA 4M8AA 5LL6X 4RKBA 2L5TA 3PZ8A 4IUQA 5A35A 2LY7A 3MC0B 1EZ8A 2WXNA 3VRBB 1LABA 2WXKA 1SMYD 3U7ZA 1B4OA 4KKUA 3T53B 5M9OA 3E6ZX 4QCLA 2EZVA 1OXTA 4AQ7A 1SB3C 4XYOA 2CVRA 2L0CA 3NQTA 3MAQA 3AB5A 1RD9D 1BOSA 1ZYRC 4FXGC 3VR9B 4OIJA 1EM7A 1AFPA 1EEFD 3ZQ4A 1JORA 2O5JC 1PFNA 4IDIA 3U9OA 1I4GA 4XDXA 2B2YA 2PZUA 2ACZB 4GDKB 3HRDD 1SXTA 4RFBA 1FEHA 1QT9A 4LLGM 3Q22A 2GB1A 2B2VC 4TMAB 1TKYA 1ZXTA 2DBYA 4LAAA 3IXSA 2X6GA 4OO1G 1MD2D 1M8AA 1HPCA 2HCCA 1D6EC 1EYAA 2PIAA 4XWTA 3AN1A 2WINB 4ULLA 1NENB 4G7OC 3NZ3A 1DYQA 1XLQA 2F3WA 1FCCC 3I3CA 1JWMD 1IBXB 4CKCA 2ZXRA 1HQMC 3RLFA 4ZUJA 3ONAB 5J39A 1LT5D 4KJNA 1N5XA 3W2DA 3DM1A 3WCQA 2NVXB 1EYDA 2BDOA 2ICEC 1E0BA 3NWSA 4UDUC 4D2KA 3NVWA 5IGEA 4L63B 3EGRA 2ICIA 1JOQA