4ZYTA

Human gar transformylase in complex with gar and n-{4-[4-(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)benzyl]benzoyl}-l-glutamic acid (agf23)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trifunctional purine biosynthetic protein adenosine-3
publication title Structural and Enzymatic Analysis of Tumor-Targeted Antifolates That Inhibit Glycinamide Ribonucleotide Formyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 67
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4zytA00
1RBYA 4S1NA 1ZGHA 3NRBA 4NV1A 1JKXA 3N0VA 4EW1A 3OBIA 1RBMA 1GARA 4IQFA 1NJSA 4R8VA 4TT8A 3R8XA 1RBQA 1FMTA 4TTSA 3P9XA 1RBZA 2CFIA 3GARA 1ZLXA 2GARA 3TQRA 4ZYYA 3W7BA 3TQQA 4ZYWA 3AUFA 1YRWA 3DCJA 4ZZ3A 1C3EA 3AV3A 1GRCA 1RC1A 1MENA 3DA8A 3Q0IA 4YFYA 5CJJA 4PZUA 3LOUA 4TS4A 4QPDA 3KCQA 4ZYZA 2BLNA 4EW3A 1S3IA 1C2TA 1MEOA 4ZZ0A 4ZYUA 1CDDA 1CDEA 4ZYVA 1ZLYA 2BW0A 1MEJA 4QPCA 1RC0A 2YWRA 4Q12A 4ZYXA 5J63A 4DS3A 5J9FA 4YFVA 4ZYTA 4EW2A 3O1LA 2FMTA 4ZZ2A 4ZZ1A
chains in the Genus database with same CATH superfamily
3UQZA 3FPBA 1T2VA 1Z7WA 1CNFA 3CWZA 3GC6A 5T67A 3DMPA 5TS3A 1WUKS 4BO3A 2FP3A 1CEEA 5DM0A 1E58A 4FFBB 2Q9BA 3HVJA 4LF5B 1AK1A 2PJDA 2XZDA 3ABSB 4C0BA 1KO7A 4ITUA 4EL5A 4KQEA 3WLMA 4OI0A 1XK7A 2QENA 4IXMA 4BO7A 1TM5E 4E3WA 4IPTA 1QAQA 2VBGA 2SKEA 5JWOA 4MWTA 4U7JA 3CNOA 2O2HA 3IDAA 3S27A 3TTVA 1EJ6A 5KNDD 3DZCA 2ONKA 2KLBA 1VMEA 2E4VA 1EQUA 1N8KA 3QG5A 1UPBA 2RIRA 2CXOA 3ZTWA 3WGUA 5IJZA 1ODTC 1TVEA 2YOHA 1JALA 1FYEA 1U9ZA 2OAEA 4D9EA 4MVCA 1RBQA 2Y1EA 2BFDB 1AKMA 1I4EB 1XO1A 2GJ8A 2ZIGA 3CRW1 4MP6A 2OY0A 5HJ5A 4DNQA 5SZHB 4B3XA 4CLRA 4PG7A 4DG5A 4NZMA 1A9XB 1G0NA 2HNKA 1CUXA 5AYVA 1J9GA 2X5XA 1J2UA 4YQZA 3AT1A 4JB2A 2C2HA 7REQA 2J07A 3TXAA 3MJRA 4CQLB 3BS4A 3BH6A 1DAMA 4MAMA 3RVBA 4DFDA 1PJZA 1KYWA 5CU7A 1X39A 5JZSA 2AN1A 2ZOSA 4XRRA 2BM8A 2ZTUA 1NW4A 1W44A 3I73A 3UF0A 5KC8A 3AF5A 4F97A 4OHZA 3HVIA 4KSCA 1NW3A 5IK2A 4HDKB 2V98A 4M7WA 1VI2A 2GJSA 1HT1E 4ZO7A 2YL2A 5FLYA 4D0LB 1YVPA 1X1QA 4RY8A 7MDHA 1HTWA 1Z2EA 5JY1A 4LY0A 3SZGA 5TGZA 2V5UA 3A32A 2QEQA 3JARB 4YRKA 3BXPA 5KVCA 4HDOB 2XZLA 1FUUA 2C03A 2O7QA 3R8FA 4LDZA 3DNPA 4QGBA 5FV4A 3RS8A 4ENVA 1QZXA 3H4TA 1GYPA 3LX6A 2R1TA 4AN4A 5KVQA 4Q4LA 1RQ2A 1OC2A 4K5QA 1D4FA 1ISFA 1ZHHA 4JUCA 2O14A 2GHTA 3AOGA 1W0CA 3TB6A 2P11A 2PRJA 2HA3A 3ON5A 1NBAA 3CFYA 3WMEA 3JATB 3L7BA 2QTVA 3BCUA 4BY9E 1PTJA 1JEEA 4DV7B 2QRHA 2O20A 3ZV3A 4N41A 4EECA 4JI0B 2D3WA 5F76A 4OLAA 3RHTA 2XCTB 4N0MA 1T15A 2I91A 4Z4FA 3EC7A 4ZAYA 4P36A 1JP7A 1P2TA 1A72A 3LS2A 5JASA 3R3ZA 3TBFA 1HMYA 4FHFA 4HMQA 4F93B 4C08A 4PR0A 3A2LA 2AI3A 4Y1RB 3P5SA 3QKTA 1NFRA 1Z25A 2V7TA 4ND6A 5ALEA 5CA1A 3FMGA 2CLOB 3RSLA 4QTYA 1QPZA 4O8CA 1F0NA 2GVNA 4CMBA 1OFTA 3PGVA 1S9HA 1WD5A 1E2UA 4TMVA 4BZWA 3IT1A 3NWJA 5EJFA 3W78A 4LSMA 5CK4A 2C4HA 5SICE 3T5GA 1YZVA 1DQYA 5AK0A 4UEOA 1CZNA 1CW2B 2CZGA 1JN0A 4J6EA 4I0WB 3EDYA 3MB8A 1AO0A 3S81A 3AGPA 1MMFB 2FY8A 3DOCA 3UZUA 2RHCA 3LLVA 5BW8A 3QBDA 5ERXA 5E0KB 4DLXA 5LZ4A 2VP9A 4BTVA 2I67A 1XYYA 2CJFA 1J4AA 2ZRDA 3ICPA 4C89A 3V3TA 4IH1A 2VJAA 4E32A 3GFSA 4L5JA 4G26A 2Q5JA 2TYSB 4HEA1 4J4BA 4MUXA 4TXJA 2XV1A 3VX3A 3OIGA 4NATA 3ZQKA 1TC2A 4TYMA 1A8HA 1BX3A 4LRUA 4B4WA 2I6XA 4U7DA 4CF3A 1KXZA 3DMFA 5E6RA 1V37A 1KJQA 3ZU3A 4KPFC 4W8OA 4URVR 1JDTA 1N0WA 4ZV4A 4P3XA 2Z09A 2F1JA 4UZEA 4WRRA 5BMVF 2V7PA 4BP1A 4DILA 1RLIA 2HIAA 1TIBA 1WZIA 2Y05A 4W7IA 1P60A 4X45A 1TF2A 2OA0A 1FJGB 1Z5OA 1Q5PA 1KI2A 1N1EA 2BHNA 1IXRC 2JIBA 3Q7RA 4OJYA 4IZ6A 3JYNA 4XUGB 1AS3A 4JNCA 4NZOA 3RAJA 5J4KA 5KYNA 4YRMA 1M1XB 1BSVA 1JQ3A 2JANA 3EXHC 4LRSB 4OHMA 5KMGB 2HR1A 1NHGA 4LFCB 3TVYA 3LBAA 1TU3A 2NU7B 4I5GA 1SUCA 5FORA 3EHDA 2DT8A 3AXSA 4KO1S 5MF6A 1ULBA 3LX4A 5F78A 6AT1A 3LLMA 5JECA 3K9LA 1EFDN 2ZSBA 4G86A 2PLNA 1QYWA 1QC5B 2QM3A 5CLHA 4AJHA 4CKEA 1XZCA 4IX1A 1VHJA 3O1HB 4MRVA 2EL7A 1K6MA 2CE2X 3L4SO 2JFVA 5GMOA 5LIPA 1IVSA 1XLVA 3PSAA 4ME6A 1KVQA 4MTCA 1UJ5A 1X86B 3IVRA 3LT1A 2P77A 3AUFA 1BE8A 4CV1A 2PFSA 3TNDA 1LX7A 1NQXA 1CP2A 1VRCA 3EIOA 3QY0A 1DEAA 1PK8A 2IYXA 2P62A 5CURA 1PR1A 2DWPA 4TQUS 1CYEA 3MQ4A 1VJGA 3N2ZB 2WJGA 1N5KA 4O63O 4CU5A 4B3BA 3I8SA 1GVHA 4LRYA 1OOEA 4C6RA 2NSDA 4B5LA 1U0EA 2PLFA 3U3JA 1XZHA 1E6WA 4LY9A 5MGNA 3H2ZA 4FMDB 4UU8A 2PUGA 4LCBA 2ILVA 2J33A 2QRGA 1A69A 3MWDA 1DFGA 2O2YA 4JZYA 2JGDA 1JMKC 1ZK3A 1QRDA 3S4YA 3DW1X 2CJWB 1SRRA 2DLDA 2R6HA 5B4UA 2ZE6A 3NW9A 2ZBGA 2D13A 2ZJ6A 3VTZA 4CV0A 1P3DA 1UPTA 2IFTA 2PVPA 2VAWA 1LSJA 1JH8A 1QMPA 2XLCA 2RDMA 4JJZA 4CEHA 2F6RA 1ZJJA 3O2JA 5K3FB 2QIPA 2O5VA 2BCEA 1NVDA 3HZRA 4AIRA 3ZCTA 2OB1A 3GOHA 3HWSA 5KKNB 4Q6BA 5DLQC 3NIFB 1GEGA 2P2GA 1GJRA 3G8DA 3OCYA 4JLJA 2A9KA 1KBQA 1L8OA 1IRIA 1JA1A 1VKZA 3IAAA 3OURA 3JVUA 5ADHA 4D3DA 4NXMB 4RE5A 1Y1QA 4MIYA 4XM0A 4OJMX 4QODA 3KVRA 2QAGB 2WYWA 3WSWA 1CS0A 4HGQA 3SM9A 1GAWA 1VPWA 3KSDO 4RPGA 3UW3A 4GI2A 4GSYA 4JQCA 4CCWA 3R1IA 2IUSA 3VH3A 3M3PA 5KVVA 3FI9A 2P2SA 3SD7A 1OZFA 2QD4A 3N2EA 3WLRA 3JRNA 3EPPA 3OQIA 2HA5A 4FX5A 4MV3A 3PXGA 3LYUA 5EZ5A 1J2YA 2X8JB 1E3WA 3H87A 4GF5A 1HT0A 2AUNA 1N2XA 2Q5IA 3DWGA 4OHVA 4YRQA 1ISGA 1TT7A 1YS1X 3S7ZA 4PM4A 1ZD2P 4CM6A 1V6CA 2AOUB 2JBAB 2YH2A 5HBGA 3W1EA 5A4FS 3FUTA 3A3OA 1N2IA 4PXYA 1VP3A 1RJDA 1ZK0A 4CL0A 5JALA 3L8DA 1L7BA 2IZ0A 1RE0A 3SF0A 1EQ2A 3A06A 1VKJA 3AYZB 3MJTA 2XW6A 4MV0A 3HKCA 3K05A 3HN6A 4HQRA 4YP7A 4XVUA 5ITZB 4IVQA 3FYUB 3PGKA 4PBRA 2YHUA 4Z9FA 4EGFA 2JGFA 5G0UA 4N49A 4BX8A 5L3SA 1H4SA 2JW5A 3A9UA 1AKQA 4QLAA 1GSOA 3HY4A 3HCEA 2HRBA 3EZFA 3FH0A 1P45A 3H2GA 4X6XA 2DWOA 3IP9A 3SJBA 1M8PA 3IMKA 2PG3A 4P0QB 1OI4A 1KOFA 1EP3B 1O9BA 2ATEA 3AUYA 4NE9A 2PGXA 3VA7A 1I4WA 3TGLA 1EXDA 4X41A 5TF4A 5IHPA 2A5DA 2JFYA 4G41A 2WINI 5AOCA 3A1CA 1UPFA 2NO4A 2D1YA 4C0JA 1S3GA 2ZJ7A 3CRNA 3N86A 4Q3OA 2FSSA 2I2CA 1R0YA 3E2MA 4DMHA 1B3RA 1K0FA 1RRPA 5C81A 4ER5A 5A04A 3VPXA 2C5SA 3QHAA 4BOYA 1S2MA 2LD4A 2AW5A 3EZLA 1U2ZA 1AT1A 2I2DA 3HBLA 1HZZA 4H0CA 3UMYA 1V47A 3CW2A 4V0OA 2LWIA 3NHPA 4U02A 5AUOB 5FPTA 1Z6ZA 2QU7A 4ZAFA 1XPJA 2FUG1 2PKWA 4DIOA 5CAEA 1NBOA 3B85A 3QMPA 1IEXA 1RM5A 4RVFA 1U2PA 3DKIA 4KUHA 4BYGA 3IEKA 3L7IA 4ZO6A 3ZK8A 4LF8B 1WUHS 2WSBA 4NYMR 3THXA 4X3OA 3GFTA 1NI3A 5G1NA 2Z6AA 5AHKA 3CCCA 2QAIA 4HX5A 3DC2A 1RJ9B 2ACEA 5CHYA 4OHOA 5B1DA 3Q6MA 3FFAA 3WXMA 4Q1CA 1P31A 1YZQA 2B8JA 5JCJD 2OPBA 3E9DA 1ZZEA 1XEXA 3LTEA 2GZRA 2SHKA 3WIDA 1U2DA 4CKWA 5DF1A 4IX9A 3E35A 3VO8A 3PVCA 1I2CA 3AEXA 3GLSA 3KO8A 1LZLA 1ONSA 3HADA 1SHZA 2JDIA 2ATXA 3DVQX 3AKZA 2GR9A 3A11A 2WVHA 3PJDA 1OR8A 2ZWMA 3KD2A 4RH1A 3W5SA 4DHEA 2DMRA 2D1FA 2JASA 4BTLA 2JIMA 4CTNA 1CULC 5C1IA 3THOA 3O8OA 3O90A 4F12A 1TD9A 1T1JA 2QG9A 5FQOA 1GPAA 5BN5B 4AG3A 2IYAA 4YMIA 3FLEA 4IMRA 3QX7A 1XG5A 1V5FA 2J46A 4RNCA 3N7AA 2IP1A 1QHYA 4MLDA 5AH0A 2Z2YA 5F2KA 3KJEA 2A1IA 1UBRS 3OLQA 2ZQZA 1R3UA 3F5FA 3X2EA 2FFBA 3FIJA 2GVDC 4KK4A 5AJTA 1NP3A 5BO5A 5JOQA 3C7AA 1IUKA 1F6DA 1GUDA 4QKQA 5KX5B 1ZR4A 2R7KA 2D0OB 3CF4A 4ZQHA 5E9QA 1IMJA 1JEAA 4B34A 1BE1A 2IHNA 2QS9A 5EC8A 1REQB 6CHYA 4XGNA 4NXNB 3EWAA 2B1QA 1LPSA 3PWKA 4GLJA 2M2IA 2H2FA 1XAGA 3S8EA 3WGNA 3EUEA 2GAOA 1SEPA 3BTUA 4CLOA 1BD3A 3BSSA 2GILA 4NE2A 3H04A 4I6EA 4OGGA 1QRRA 4MDYA 4BZQA 3JALB 4U2FA 4QEKA 3DKPA 4WXMA 3KXPA 1V96A 4EO7A 3HCOA 4Z4GA 3WS7A 4J0CA 4JBYA 3K73O 4C0XA 3ABQB 1W88A 3RRBA 2J6IA 3MD9A 2AUTA 4OM8A 2WTBA 1U1FA 2PLRA 4RD1A 4XJXA 3NCTA 4XIIA 3I9JA 4MS1A 4JYPA 3AFIA 3MPUA 3MS7A 4DQXA 2XUFA 4EHNA 4FB4A 2OO5C 1DPGA 3HCNA 3R40A 4LBVA 4LV6A 3T9EA 1J0DA 3N2YA 4E5MA 5ICSA 1RCTE 3I01A 1SD5A 2ES4A 1AC5A 4Q4AB 3UV6A 4AB1A 4CUZA 1ZKMA 1JJVA 4GXTA 2ZBRA 3N0RA 3PL5A 1DCKA 2FA9A 1QGOA 2IYNA 5ECYA 4LJ5A 2BPOA 3NAMA 2WM3A 4FNMA 4JC0A 3FMVA 1FDTA 1WBBA 4GYWA 3DL4A 4ENQA 1FRNA 3KQOA 5J2UF 1ZZGA 1DBIA 2GLTA 2NQTA 2VP2A 3F6EX 3AJRA 3MFYA 3G2OA 3OE4A 2QI9C 4R4JA 5CDSA 2CNNA 3HVUA 5EPUA 3BMQA 3BE6A 4IR7A 5HQ3A 5LUAA 1EBFA 1T1EA 1TCCA 4XTRA 5C8YB 4P9NA 3VJLA 2QL6A 4J7CA 3CA8A 1OI2A 6Q21A 2YZ2A 1B7GO 3JCZA 1E60A 2AKAB 3ABRB 5HFAA 1Z5WA 4D9MA 4WKGA 2W2LD 4B6QA 1N1DA 2F90A 2WNSA 1NNEA 2HQRA 4OGKA 3VGPA 1C3JA 1XHEA 1GQRA 1KP3A 1L3BA 1MAAA 1MORA 2RHTA 5ARBA 2DQSA 2RH5A 1GCAA 2VHWA 3QWBA 1MO6A 5H5JA 2YJTD 4RKQA 2EKQA 5BSUA 4PG8A 2C5AA 4NV0A 2CLIB 2MYPA 4FINA 3UXHA 4ZK6A 1BCRB 3LHFA 3QUAA 3WQHA 3QPDA 1GGKA 1UC9A 1ZH2A 2H59A 3G8BA 1YI1A 5GM1A 3U0BA 3ZQ6A 4ZZ1A 2WJIA 4PAMA 4LMRA 1DFHA 3G88A 3V1YA 4JD5A 1JSLA 4OHXA 4DUGA 4TLBA 4F2GA 4ZN6A 1KR2A 4HC4A 4NMLA 1QG2A 2AOWA 4Z1MD 3I6QA 4TMKA 1Z38A 1KBOA 1NMXA 1WQ3A 1JIKA 2QD2A 2V6BA 4CPDA 3E03A 3UB3A 1RQPA 3OE7D 4YALA 5EUQB 5AW2A 1XJQA 2JCVA 2JL1A 3OC6A 5FT9A 2R1VA 5B5SA 3P2KA 3FX2A 5K8TA 3LGSA 4WCFB 3LP8A 2DPLA 2C82A 2IEYA 4ZCIA 3RR2A 2ZRIA 1UDBA 2GYVA 5DLEA 1JH9A 3COYA 3SY8A 2OP0A 4IJUA 3WFJA 2E1RA 3DMGA 2UZ4A 2GWHA 2ZWVA 2IIBA 2QMQA 3LBIA 3LC1O 1V2GA 3ANTA 2J67A 2GCGA 1EFLA 4JOCA 5EXPA 4RWZA 4YUWA 5LQNA 5AKJA 1W2HA 5CTJA 2J85A 3LMKA 3V4FA 4X1KB 1T9GR 1MUUA 1U94A 1D5CA 4YXWD 5BUCA 1UXOA 1WZNA 4IQFA 2X9LA 4KXNA 4QELA 4U3JA 4AKIA 4K2AA 3ORYA 3FROA 2H4ZA 4DV0B 1W8IA 4K6CA 3LDUA 2ZAYA 2P8SA 1NM5A 2IOYA 3AM1A 5J4HA 2B36A 1VA4A 2E2WA 4MR9B 1A71A 2FXIA 4BNZA 1XKLA 2O3JA 2PGOA 3TJRA 2JBWA 2WHPB 2A9JA 1HNNA 1T24A 1ZLXA 2V7QA 3QUBA 3VV2A 2P6UA 4EZEA 4RZUA 4EFLA 5D84A 3USES 3RGWS 4AZTA 3ENVA 2D3TA 3IDZA 3IUYA 1QYXA 4B4KA 3J7AC 2OBMA 1WO8A 1QV9A 4K9SA 2HJRA 2VATA 2AN4A 1J8YF 1XTJA 3A28A 3PJGA 3Q4GA 4CLDA 2E9SA 2YY5A 4YJGB 2PYIA 1T8TA 4X93A 2RGXA 1XU9A 1T3SA 4OHBA 4J0QA 4BBPA 3PLRA 5C7OO 1Z63A 1I4DD 2X8LA 2CLHB 2RB4A 4BQNA 2VI5A 3NHWA 3BSFA 4YFYA 1CQJB 5CVUA 4EPWA 1YTUA 1LSSA 1D2NA 1RC8A 3A4YA 1W96A 3R5SA 3O38A 3N8NA 1J70A 3EE6A 5B58C 5JBQA 4ISCA 1C3LA 2C5HA 1NQOA 2G77B 4YNBA 4BNVA 4NCBA 3N8DA 5LP1A 1IQRA 4UE2A 2FRDA 3RSCA 1WY5A 4TV9F 3VTFA 1F2DA 1QH8B 3EGEA 3S3TA 3P5BA 5JNTA 1EIZA 1RPZA 2PUEA 3WB0A 4DNXA 1W5AA 4NU0A 2BYTA 2BZ0A 5CP8A 4HQLA 1BEEA 5FHRA 4Z0HO 4C29A 4DMLA 3EB9A 2A6PA 2YN4A 2VYFA 4EQZA 2W83A 4D44A 2P3LA 2IV2X 2Q99A 3WQBA 4MWCA 2W6IA 3FFBA 1C4XA 4M0UA 5JSZB 2DLCX 1LW6E 5EESA 3NKFA 1ORVA 4E7PA 1N8TA 3CLUD 4MRPA 4R6XA 1TOAA 5BR8B 4IHJB 1S0UA 3N70A 5DM1A 1VKRA 3ZJVA 5I7VA 1IZYA 4ISBA 1BGWA 2IYFA 3CUEF 3K4QA 5EFZA 3RS4A 1OU4A 5E4FA 3CLTC 3EQ6A 1CQXA 4ZTZB 1FFGA 3PEUA 4JT8A 3MPOA 2ZVDA 3AI1A 3KBBA 2JGIA 1JE0A 4EMTA 3EUFA 3PC8C 2WY2D 2FMTA 2RGYA 2C1ZA 4H77A 5C8DA 5HHTA 1G8SA 2BHRA 1M2HA 1TUIA 1O1YA 4KN8A 4KWIA 5ECGC 4BKUA 2YC4C 4RELA 1QR6A 2XWSA 4JT4A 4XWYA 3P9QA 2P6RA 3D7LA 2ORWA 5EL0A 1ADGA 4X71A 4QYSA 3E9CA 1OLUB 3MLEA 4OJKA 1R5NA 3V4OA 4X8MA 4Z7QB 3RFTA 1SPXA 3QBVA 1L5WA 1GZDA 2B2NA 3NDBB 3E3AA 5JSFA 1U3VA 1NBEA 4BCDA 3C3JA 4X92A 3OQBA 2M1ZA 1Z5NA 3DE2X 1DX9A 5KIAA 4JJEA 4Y1GA 1RZRA 4PZEA 2AXEA 2JGJA 5IWCA 1Q3TA 2XVZA 2VQDA 3FOZA 4I1RA 3MTAA 2XUQA 4HK4A 3EQ8A 5AI6A 2A92A 3C6MA 3UUFA 2WWYA 3BDAA 3EVZA 4LZOA 2ZYTX 3JWPA 4EO4A 1VPLA 1X42A 1RHJA 3CRQA 5IYZB 4K2HA 1IN4A 2CC2A 1M5UA 2JFQA 2VK1A 3PC7A 4PAOA 1KETA 4ZKEA 4A6PA 4EY3A 3AF6A 4B4UA 3ZWKA 2FPIA 2X8BA 2MJLA 4JA2A 3PIRA 3O91A 3O2QB 3IQZA 3K5HA 3EIHA 4KQIA 5HKLA 1E3IA 4P58A 1Z6GA 3RB8A 4ZYLA 3BGWA 1Q22A 1XVLA 4LXUA 3TNLA 4HYQA 3CT4A 5A5GA 2JJ2A 2XBUA 3JQBC 2ON6A 2JHAA 2FN4A 3JWGA 3SXJA 4EEZA 4ZV9A 2G88A 3M4NA 4L4ZA 4FCCA 3ND9A 3TDNA 2YUIA 3DPUA 2XYPA 1WNTA 1T8UA 3DOFA 1WWKA 4WNYA 2AYXA 2FWBA 4MK4A 1N2SA 3DLPX 4DC9A 3K6KA 2P2ZA 5LQAA 1FVXA 2DVMA 2VEDA 1NLYA 1K97A 121PA 1A2KC 1UDCA 4QO7A 2PMBA 1L6RA 2GAAA 1S8FA 5JH7F 2OZKA 4RD4A 3OETA 4GPD1 4YJHA 2H2DA 1OGJA 4LW8A 4K9MA 3B5EA 3ZUPA 2J0UA 5BR7A 3CVYA 3LVBA 4I8IA 3R7WA 4AX4A 5KVSA 5BUZA 3GEEA 4JT2A 1G8MA 4MKGA 1PG5A 1R0KA 2PYZA 2VZLA 4R1LA 1E2PA 3GGSA 2CYCA 1GUZA 5KNBD 2O8BB 3MSXA 4QG7A 4UDXX 2CGEA 3H99A 2WVGA 3BWMA 3M5PA 3D8NA 4IWYA 1ZUHA 5KU7A 2H85A 2C42A 5I3CA 3QVJA 2VSNA 4KN9S 4EYGA 2WIKA 4FSXA 3I2YX 4I4TA 1GD1O 2NIPA 1RIIA 2O0JA 4M89A 3BXEA 5TQ2A 5G0VA 5JLAA 1C9NA 4YAIA 1DC6A 3IQFA 1U5CA 1I2BA 2VJQA 3K0EA 4EG3A 5K51A 3UG7A 1SKBA 2CXNA 2Q49A 1HQDA 2PKEA 1L4KA 1WKBA 1BX1A 1FSSA 2HSEA 2WZQA 2Z2XA 1J1ZA 2H1LA 3JWEA 1N6LA 3LUKA 4GECA 4IXWA 4G5HA 4WJZA 5H3HA 4B80A 3GLIA 3RC3A 3TUJC 4RMGA 5CB4A 1H42A 5KINB 4TVKA 2FTKE 3OPXA 3B3AA 1VE6A 4Y2QA 1Q19A 1GZVA 1G3RA 2VUSA 3TVDA 2IHYA 3DWFA 3M6XA 4JBLA 1Q1ZA 1UC4B 4QLOA 4Y9DA 5T5QA 5AK3A 2LCIA 2W2NA 1NJ5A 1U0GA 1QHFA 1VRWA 5TY0A 3WZ2A 2HRCA 3B5IA 3E2PA 3JWJA 3O4JA 5K0ZA 1VECA 2CV2A 5JNSA 1LI7A 1N2CA 3PGLA 1XZLA 4RCZA 2ZVQX 1ULSA 1VCHA 4FBGA 3EZ9A 2HADA 4UCWA 5T8KA 5TJ9A 3L82B 5I7SA 1C9YA 3FFTA 3WWDA 5LUBA 1FTQA 3KL4A 3ESBA 4OJNA 4XOIA 3TZQA 1EDZA 3DXXA 4NEGA 3E8SA 4O4LA 4J07A 4AWAA 1KS9A 1RI5A 2A9OA 2PFKA 3DV9A 3GMDA 3STVA 4CEIB 4M1YA 4YBZA 1IBMB 1QHHA 4BVEA 3ZBTA 4AMUA 3I39X 1IRXA 1TQ8A 3QU4A 1QQTA 2F64A 4KQXA 4L0DA 2NU6A 4QBTA 2G9QA 1PZGA 3GEHA 2AVNA 3LUPA 4MQMA 5ICEA 1O0CA 2DFLA 3DF9A 2IYZA 3I2KA 4EJ2A 1PFKA 1CJMA 3FNBA 2MSKA 5KQSA 3DV2A 2PMDA 1K5HA 4JP1A 1YQDA 5CD1A 4ZTUB 5KUTA 2DHEA 4A5OA 4B9EA 4G97A 2VCYA 3U3DA 1A8UA 5PGMA 3PHGA 4MJLA 3WGLA 4IQGA 1Z0UA 2LNDA 4L0CA 4N12A 4WVLA 4ZRMA 3UUWA 3WL8A 5LA6B 1OLXB 2OE2A 3OJFA 3SJUA 4G0VA 1E1MA 2EX4A 1ZN2A 3WGVA 1P81A 3OY7A 3C8DA 3HKEA 4TWZA 1FSPA 4BJHB 4P0TA 1BYIA 1DKRA 1KYQA 5ICFA 1WEKA 4JMPA 3WYBA 3U4GA 2NU8A 5IN5A 1HNWB 3I92A 3C1OA 2FDXA 4IG9A 4WKNA 4TGLA 3VYSB 3FUUA 4EX7A 1PQYA 3UW1A 1DC4A 4N82A 2FSIA 1XKXA 1Y6FA 4XDYA 3COSA 3A6EA 3OTGA 2XPCA 3LF1A 4IMIB 4JLOA 1UFRA 1SD2A 1FSZA 4AULA 2XQGA 4PC7A 3N7TA 1DTWB 1KTIA 1U0BB 5FCDA 4FNAA 2CXQA 4JUDX 1QQ5A 1RAIA 2YN0A 3HXPA 4WJLA 4MYDA 2LZ0A 3RLIA 2FH5B 2QAGC 1ZNXA 4B32A 1XZAA 2WM9B 3I45A 3KPUA 3G2NA 1U3WA 3R5TA 4J0GA 4QRHA 5AM0A 3RWMB 5JZOA 1AKUA 2WYOA 4FGJA 4NOJA 3ETNA 3OD5A 1BA3A 4MVJF 3ABIA 3DDUA 4OV6B 2A33A 1RYYA 1ODFA 1DI0A 2BF7A 3HNOA 1GRQA 1T5BA 1BIFA 2VP5A 1EFVB 4Y67A 3E2IA 1MOZA 3VNRA 4ESOA 3VZRA 2R7LA 3GRRA 4OP2A 4KL8S 4BLTA 4BKOA 2GOYA 3ZXSA 2C59A 5ALMA 2QPLA 1PTJC 1XUOA 2D7DA 2HPAA 1K06A 1JZTA 3HGQA 1HMPA 2BEUA 3RQIA 1WUTA 1UKZA 1SO8A 4IIEA 1JS1X 4L51A 5DN6A 1KIMA 2X3UA 4YACA 5FJJA 3F7TA 3V6LA 4MUBA 3JQRA 1T6ZA 1PLLA 1P1JA 1PEDA 4OYYA 5AVYA 3OQ6A 4LJ9A 1WPGA 1G5PA 2P4UA 3PI6A 3RVQA 4F4HA 1B0UA 2C4VA 2QHXA 1X1RA 4F9GA 2XE7A 3M1YA 5IVPA 4BPBA 3NI2A 5ELLA 5IT5A 3DMHA 1C9JA 3ZI7A 3GEMA 1X92A 4RPJA 1LS1A 1G7RA 2F3SA 4FOSA 2ZWIA 4H9GA 3QBTA 1IU9A 4KACA 5C4GB 3D3NA 4AD8A 4Z53A 3I3SR 3NT2A 4BLQA 1YZFA 3QV2A 4N9QA 4P98A 1A7JA 3TEMA 1Y37A 2ZQYA 4OMFG 2QM7A 4K9NA 4A73A 3OO0A 5L6LB 2HLDA 4OXQA 1NE7A 4V0RA 2Z58A 1CY0A 1HY3A 2AYZA 3EYWA 3MOGA 4IH4A 4J2TA 4EHLA 2DAPA 3BAZA 2AV6A 3GT7A 4PR3A 1Y4DE 4AY2A 1YUMA 2PRZA 1R8SA 2ZRAA 3DPSA 1T8SA 2IF2A 1OE0A 2BHLA 4EYEA 2Z1DA 1T13A 4F1JA 3AESB 4CT5A 1P0CA 2J9RA 1LJUA 1U3UA 1R8YA 3KPJA 4I1PA 5ALJA 1MH1A 5LMZA 1X38A 1W2GA 2O0MA 3MCZA 4JX8A 3TQCA 5U4XA 4V38A 1BXKA 1QKIA 1ZM7A 1VI6A 3DF7A 3OCCA 4L22A 4N9WA 4NNOA 5EJ5A 4C7OB 3DM5A 3PITA 1EUCA 3VDNB 5GONB 4WECA 2YY6A 1KJ9A 5JJIA 1W4AA 4EW6A 1JG4A 4HWTA 2TMGA 2ZT7A 3FY4A 2RH9B 1O96A 2B30A 1PDVA 1P5HA 3LBNA 4QQ8A 1KJJA 1LVGA 3BDIA 3SYMA 3IFSA 4L16A 2V7GA 1Z4MA 2VDMB 1L3IA 3GD5A 1UXIA 4EKYA 4GMFA 1MPXA 1S1MA 2V1XA 3G2IA 2BN4A 3R5FA 1SB8A 5IASA 1SH7A 4Q1DA 1PVOA 4R01A 1WY7A 5CH8A 1EYZA 3I58A 1D6JA 2OTCA 1XT6A 3MVEA 2CD9A 4NENA 3KYIB 1PK9A 4BB5A 5J4YA 8LDHA 1XMOB 1RI3A 1H23A 2AXPA 2OAGA 1FYXA 1DP4A 2C29D 3LKBA 3NC1C 4MR8A 1G3MA 4YMSA 2XGJA 5FEUA 5KTNA 1T1GA 3MJDA 2CVFA 5TPZA 1OCEA 3OMLA 3GDFA 4YEDA 3FSEA 2UYQA 1ESNA 4H3KB 4D5EA 2CEKA 3B2EA 2HMYB 2DC1A 4MIEA 3RSHA 4RD6A 4CLXA 1EXVA 1FUYB 4DQDA 4M55A 4INOA 4C3OB 1X8KA 5FFFA 5TMPA 4ZQIA 4NFLA 2AFHB 1QQBA 3I1YA 1NNUA 5IT9A 1T26A 2IY8A 2EFEB 2E3JA 3AHGA 1XAJA 3FNHA 4IDQA 4QDTA 5H81A 4AK9A 4RZXA 5H4GA 3PX3A 1OAAA 1U1CA 3R5XA 1L5YA 1P2FA 4XB6B 3T5TA 4WDRA 4YAKA 5HYVA 3WGIA 1MEEA 3GLGE 1ZGBA 3AY6A 3KYBA 1O2DA 5CUQA 5A3VA 2JA1A 1LC3A 3NHSA 3MJFA 4WY5A 2ADFA 3PUKA 1JHXA 2WKRA 2YJNA 2HMVA 4MW7A 2W8BB 4PYLA 4QPCA 1P6UA 4NK5A 2ODNA 2PX3A 2V7XA 3CTPA 1M1ZA 3HHEA 3AJEA 3FJYA 4N5DA 1M83A 1RM4A 2IBMA 2QR2A 2VT3A 1DWUA 1MABB 3L92A 3OHMA 5E2BA 5A71A 1J24A 1VBKA 2Q5CA 4LJ7A 4MWGA 1EDOA 2YRXA 4RIFA 3UMBA 1I94B 3M4ZA 1Z6TA 5CRIA 4JQYA 1FNDA 4DBZA 2VJDA 1C8LA 3RWBA 3T94A 4B7CA 4LN1A 1QTNA 4G5RA 2V5VA 4TWIA 2ZPTX 3KYCA 4LRTB 5HGXA 4L5CA 2WJJA 1G64A 1TVKB 1YDHA 4I4CA 4ZKDA 4MPDA 5FNZA 2WUGA 3BB1A 3KKNA 4B6GA 4BE9A 1MR3F 4KYUA 4RDXA 1Z5PA 3LX5A 3S68A 4X1IB 1SK8A 2H18A 3Q8MA 1TLTA 3AWDA 3K6SB 1UBKS 2PT5A 5IXYA 1Q0QA 4HV4A 1ORDA 3P8ZA 2O5EA 2GD6A 3R6DA 3MHPA 3F49S 2J6BA 1JTEA 3TLGA 2WSIA 4NV1A 5F1OA 3MWGA 4BE7B 2JVIA 5ED4A 1RWQA 4RIHA 3OTOB 1NFQA 1NI4A 4OKIA 4CM8A 1YS4A 5EZSA 3II6X 4WLNA 4DIEA 3QVWA 4K9PA 4XIGS 1M2WA 3E9NA 3FYTA 3QMVA 1FCJA 4OH7A 4LI0A 3O4IA 4KVGA 3QGMA 2JAXA 2UYOA 4JR1A 1YBMA 1QG0A 1QK5A 3Q2KA 1FMLA 3WWCA 5J59A 3SCZA 2FLVA 3GJ5A 1RSZA 3F1LA 4YDSA 5HTKA 1P4AA 5GOTA 3G0BA 3GRUA 4IIJF 3ENWA 5JVDF 4I1YA 4IXTA 5CIYA 4AJLA 3OECA 4GX5A 5EIHA 3TR0A 1SQSA 2OILA 1FPMA 3RROA 3OSUA 3ZWDA 3GDWA 5F35A 3MNFA 3VO1A 1EWKA 4LWOA 4PCVA 3SK0A 3TQQA 1SOWA 3KSBC 3TOVA 4TSFA 1STOA 3HS3A 1PFQA 2WMOB 5EIBC 4YCSA 3STYA 1N0VC 2FMHA 1OFHA 3PXUA 1G21A 2RGWA 2LBPA 4YIKA 2ZTMA 5IN4A 4QNRA 3PHCA 4H7FA 2R6R1 5DYWA 1JDZA 2VPZA 1X7YB 2DPMA 3W5HA 3RC1A 1NC1A 1XA3A 3A58B 1QDUA 1HZZC 4FFLA 4MYTA 3AR3A 2RHJA 3A2MA 5EQTA 4GP9A 2GCOB 2PO5A 4YRCA 2XMSA 5AWFC 4ALIA 3TECE 4KR0A 2A94A 3OD1A 2LXNA 3SKYA 4AMVA 1NUPA 4Q3LA 1S8AA 1SCUA 2DULA 4X1YB 5GJVC 5K8VA 5LYJF 2CSXA 1PUIA 1XTUA 3D3QA 2YICA 3EZ2A 2X0RA 1T0JB 2ZS8A 1GA1A 2Y0DA 4NOMA 3LXUX 1H6DA 1NIJA 1ZWKA 4EY4A 2HH9A 2AI2A 3DYIA 2H57A 2XUHA 1CQWA 3NIDB 4LY3A 4Q4JA 2QGFA 4IEEA 4FMPA 5AFSA 3OUTA 1GFWA 3R5KA 5AT1A 1F5SA 4J2OA 2VRBA 2Y1XA 4NU5A 4V3BA 4CMEA 2Y1DA 4L73A 4K8OA 4UNPA 3T3IA 1NJ8A 2ERCA 1TEZA 4A36A 1UDAA 2EKDA 2ODPA 5EJ2A 4WCFC 1U2DC 2Q21A 5ESXA 3IQDB 3NT4A 4FGUA 2CBZA 3ZE7A 2XE6A 4RLSA 3K30A 1TJ4A 5AKEA 1FYFA 4D9CA 1VL0A 2II6A 3NWPA 3EDOA 3LQYA 3NC4A 3R0IA 2RHLA 1ULHA 4A2PA 1WXQA 3H8WA 5E1DA 3QE0A 4I7EA 4PVCA 5JISA 2VXYA 3IIMA 1U80A 3KKLA 3OZ7A 4URHA 1IBKB 2VSOA 3OQJA 1XZJA 2WLTA 3NWOA 2JIOA 2IYPA 2R8ZA 3I30X 4UBKA 2F43A 1AKNA 4OHRA 5HF6A 3OF3A 3N59A 1J7JA 2D5LA 4GR9A 5IEJA 2FF5A 1YQQA 5IANA 1Z0DA 1RWPA 5DTRA 2H1HA 4DJJA 4BX0A 1F8GA 1MIOB 3GJ6A 4P7KA 5AKXA 4P4LA 4O4JF 3RU9A 1GUAA 4FJ0A 4BLOA 3IE2A 4LMPA 4D4IA 1SB9A 3D6NB 1GUFA 1I1HA 3MT0A 3FTCA 1BWQA 3O3OB 5ALQA 1OXBB 3SSNA 1AVTA 1Q6YA 1OGYA 1YL5A 3A10A 3FNFA 1RYHA 4CGZA 4LYDA 3LTNC 2DQZA 3ZHTA 1YC2A 1P1FA 1O4WA 2WWIA 4Y2TA 4AZ3B 1C3XA 2Y1KA 2AC7A 2NZWA 7ABPA 1YA6A 2XB2A 4N8DA 3UFXB 1V7CA 2GS9A 3GGOA 4LOAA 3JSAA 3ISTA 4KFRA 2E49A 4W6ZA 4F8YA 1FTSA 1H9BA 1E2NA 1K7YA 2Y4NA 2ZSFA 2AFIB 4OYLA 1DAKA 5KNCH 4CRWB 4AYWA 3N87A 3IV6A 3K0HA 1XZKA 3A26A 4EPTA 3KOZA 2GBPA 1RLJA 4YHHB 1JV2B 4N0QA 1N75A 3B38A 2ZAMA 4CM5A 5BSEA 2IYYA 5D2CA 1ULUA 3OF5A 1F3OA 2JFGA 1FDUA 3OCWA 4UM7A 1D2EA 4ZVOA 4D92A 1ZAKA 5C80A 5D00A 1CRWG 1W85B 1J8QA 2GT1A 4NDAA 2ZYGA 1TUBA 2C3MA 3NETA 3H8VA 4IIBA 4MUKA 5IVIA 3AG6A 4H1HA 2OKCA 3F5DA 3FZNA 4I14A 5JDCA 5ALVA 1ZUIA 3OCVA 2NYVA 3CUWA 3MM4A 5JJCA 1WVIA 1D07A 1I4OA 1TIKA 1RAFA 5FL3A 2HA6A 1X9HA 1G4HA 1OVGA 3BL8A 3C5WP 1ECCA 2ONZA 2XY4A 3E0QA 3HBFA 5DB4A 3UMCA 4EGSA 3S44A 3BBPA 3I09A 1QF6A 2QTTA 3QWFA 1C9KA 2ZRQA 3CZMA 3KVYA 3MERA 5GAJA 4BJ1A 1R8XA 4URUR 4CE6A 3BREA 4F60A 1KAGA 2G07A 2P4EA 4R2MA 4G0MA 1ILEA 5JFTA 2G36A 3B6JA 3KIPA 4DDKA 4EITA 1IBSA 1TZKA 3FHCB 3HKBB 3R9KA 3JQGB 1OIWA 4Z3DA 2H54A 3M6MD 1WF3A 3VM6A 1I7LA 2BFFB 3AERA 3H86A 3G1WA 5EWJA 3EGVA 3QJYA 1PRYA 1K7EB 4EEKA 1NXVA 1KMIY 1EGQA 2D2VA 1AGNA 3A31A 1Y3FE 4OGLA 3EWIA 3IUEA 1USUA 4UUBA 3FNGA 5LQDA 3O9ZA 5HTOA 3R3UA 1C0PA 1R66A 2P9ZA 4P31A 4BVJA 4MP8A 4P92A 5DTJA 1DAEA 3GP5A 3H4IA 3H6KA 4ETWA 2YXEA 3DBLB 2BKVA 1XX6A 2XMCA 3BGVA 4BLPA 4J43A 4F5WA 2OBBA 1X7GA 3T1QA 3AKYA 3C3PA 3HP4A 2O07A 5J3JA 1G20B 5I9SA 1V71A 1P0IA 2YYYA 2BMDA 3Q1LA 3AEQA 1MGPA 3GH3A 2BMVA 2ZIXB 2FEWB 1F38A 2AJBA 1SUBA 2Q46A 2R4UA 3I37X 4MA5A 4YRAA 5A5DA 4RIGA 1A4UA 3FGNA 1PJ4A 4NFSA 3LQQA 1NUTA 4ZU1X 5GJBA 2MSLA 3AVXA 1EVQA 1IZZA 1FFHA 3RSFA 4L6AA 2E18A 2ORED 2X4GA 2AX3A 2MYUA 2VDNB 3ZE8A 5CJPA 2H7XA 2D00A 3LQ2A 2EOAA 1QH0A 1WCIA 3D6UA 3GZNA 4M1EA 4RXMA 1AUVA 1CRLA 3TM5A 3R75A 3VH1A 5JSYA 1JPNA 1D09A 1P4SA 4K6FA 3TR5A 4AS2A 3ETEA 3O7WA 1D03A 1G7CA 3RPEA 3T6KA 1R6VA 1PGPA 3OOHA 3M9XA 4KH1A 4GZMA 4C1BA 2WHXA 1BVUA 3VFDA 3RARA 3ZD6A 1E6MA 5EGNA 1JA0A 2I1QA 4NONA 1MP0A 2VVTA 2NLOA 4S0ZA 1LCIA 3VR3A 4UAJA 5DTMA 3THWA 4FFRA 4NRDA 5I48A 2BFPA 4F86A 3V8EA 2FOXA 1VIYA 2QMYA 2FDCA 3BCHA 1X7ZA 3O82A 3Q7IA 2FHPA 3U3OA 1MX5A 3ZZTA 2A9RA 3DXFA 2X40A 5FH9A 5F7JA 3KQKA 1TYAE 2AC2A 3DTVD 4L5AA 2F9MA 4ESEA 1TE2A 2DX7A 3DFKA 1JLSA 1LPNA 3I6IA 4C4RA 3EGWA 2CDRA 3C98A 1V8BA 4Y6PA 3Q8KA 3ZWCA 3QLJA 3ZV6A 4Z4CA 4MDEA 1NM5C 1PJRA 2QUKA 1GWNA 1BD4A 1NQVA 2PXHA 1TYDE 4J1SA 1KP2A 1TO2E 2JLSA 4RK6A 5T6MA 4CHGA 2GA8A 3SEAA 1T2NA 3VRHA 4B85A 3ZJTA 3T7EA 1UCFA 2P40A 4OGFA 1G7SA 2D2XA 1QBKC 1KEWA 2XMZA 3LVFO 4S1OA 4JSYA 4RDHA 4N47A 1GKIA 3IA2A 4PYIA 5EP4A 2CBXA 2W2PA 5DI3B 1II9A 1BMTA 3BTOA 2GPNA 4BO9A 2NTNA 4PAWA 3EEBA 2Q1UA 2PLAA 2WT8A 5A5VA 3ZX4A 4AROA 2HCTA 1WPQA 3CLTD 4FSHA 4S1VA 7GPBA 5ERYA 3FOBA 3CR3C 1A9SA 2PKRA 1MJNA 1LX6A 3ND6A 3RVJA 1O9GA 5K0TA 1YA4A 3C4JA 1U9YA 4HNAA 1LVHA 4HZUA 3RBVA 4F96A 2I4OA 4PYQA 5CVEA 2C8VA 1JXMA 3U40A 1R0ZA 1LLDA 3JR3A 4BUCA 3D3KA 4JGGA 1V25A 3EVEA 3L6RA 1EM8B 5IJXA 3HU3A 4Q7QA 1PL8A 1EM6A 5DMHA 1U5BA 2G04A 2I2WA 2I3GA 4I36A 1RXEA 4JNKA 1YS6A 3NHFA 5LCXA 2O0HA 1E1YA 3RU2A 4F2HA 5LMNB 2FRDC 1UBLS 1HDGO 3DCNA 3GFVA 1PZNA 4H3VA 5HMLA 3UAXA 5HCUA 4LHYA 3ZGYA 5E3JA 5A4AA 1HE8B 3P9PA 4UNIA 5MFPA 1MVNA 2O7RA 3F47A 4JEUA 2NV2B 5F9MA 3ERCA 1E2JA 4MW5A 1OI7A 4UAUA 4NJEB 2I29A 4TLCA 2WE8A 2K2QB 3R4VA 1ZRHA 4RS4A 4XPZA 4D4KA 4Q18A 4J1QA 2OLJA 3V7UA 5JIBA 1FEZA 2NZYA 3EXFA 3ETJA 4ZQBA 1ZGZA 2V7WA 3KKZA 1OAKA 3DLHA 4EDFA 4PBTA 1MQ8B 4D8TA 3ANNA 3GA7A 3B2NA 4LZAA 4R3NA 3ZW7A 4RADA 4BQFA 1NT2A 2EKLA 2FUEA 1ZESA 3JVVA 5I7RA 2AT1A 3HJNA 4IJWA 4G5GA 4U1RA 1KI7A 3PKIA 5KOIA 2WWXA 4CN8A 1V6AA 5I7OA 3HNRA 1M2VA 3NTVA 2HI0A 3F98A 3M0EA 1M6HA 3GJXC 1PK7A 1TADA 2OGUA 2QV0A 4U2DA 2O6LA 5DMXA 5CFQA 1T36A 4O2AF 5KTSA 2R6ZA 2DJ5A 1G66A 2XMRA 3C3CA 4L5IA 1QRSA 3HC7A 1JBEA 1JLMA 3RYTC 2WD8A 1E5QA 2XNDA 3C1TA 4H4CA 4UVGA 4MRSA 1CUYA 1YS9A 1OIVA 3ROFA 1Y7LA 1GR1A 3IP8A 4PQGA 4Q9KA 1NVVR 2P2LA 3LNCA 2JLUA 4BVGA 5DOVA 5SY9A 4K46A 3HTXA 2QN2A 2ZRBA 3BQ9A 1YDMA 4MEBA 3ET5A 3H5RA 3EZNA 4EEXA 1LEHA 5K5EA 3WA7A 4PRYA 3U60B 1PSZA 3WLFA 2W2KA 2EIXA 4KWEA 4LDJA 5B3JA 3ISVA 3B3GA 1LF0A 1DIGA 3LLUA 3Q10A 1MZPA 5HF8A 3ET4A 3B82A 4GLOA 3AR5A 1NSTA 2FOLA 5KSWB 2YZNA 3ID6C 3QENA 3TDKA 2PGDA 4JLPA 2OXTA 5HWSA 3UBTA 3KL2A 3NOQA 1ZUNA 1PHRA 2ONYA 2XIJA 2V55B 3B6MA 4JOBA 5HCNA 4BN4A 4LTDA 3HN2A 4TYPA 3L8MA 1LKZA 2VNAA 4V0QA 5IJAA 1W36B 3PUJA 4EY5A 2P75A 3PC6A 1PYDA 1WZEA 3UUEA 5ES3A 1ZVVA 5IDWA 2W6QA 4KE8A 4TRJA 2EV9A 4ZAWA 3VNSA 5BSFA 1U3GA 5DTQA 2I7XA 1I6LA 3U49A 4O4HA 4JJ7A 5DIZA 2C7OA 1RXVA 5DIFA 4JODA 3HXTA 3OPYI 3EVFA 3QPBA 4NYJQ 3N74A 2IUEA 2QVXX 1R2QA 4E7OA 1TGYA 3ZY3A 2P30A 3KM0A 4JBNA 4DCVA 1DQPA 4KI7A 1W4ZA 2W2QA 2JGLA 3KLBA 3EZ6A 2CCGA 3RAFC 4K0KB 3KKEA 3CX6A 1Z26A 4CEJB 1CU1A 4EUHA 1NBHA 4M0DA 2QRVA 3AINA 3EVGA 2GFQA 5JPCA 1G1MA 4BVAA 2C97A 2BL4A 2QRLA 5FV7A 1J1UA 2IXBA 3IAUA 4KQHA 4AWXA 3PDCA 1ISIA 4HWOA 4O4IA 4YMLA 3C6KA 2VH2A 3SQMA 3D6HA 2OG2A 4DV4B 4ZHQB 4RK5A 2NTYC 2R0QC 3DLBA 5JQGB 1JSCA 4DAEA 2BI7A 3R3JA 1P80A 1TM4E 3JPWA 2QD3A 3BJMA 3HBJA 1TCUA 4M0KA 4MRMB 1MT0A 2XT6A 3F3YA 1YDFA 2JZCA 4FI3C 4HTFA 1DIRA 4JYMA 5AO9A 2A0XA 1ZK1A 3KR2A 2HGSA 4DBLC 4HB4A 1GGFA 2JAPA 4KVZA 1M6YA 4L15A 5LVAA 2ST1A 8GPBA 1I6WA 1GQ2A 4JGIA 1AV6A 3MT8A 4X8LA 3ND7A 3B12A 4TX1A 2FSVA 1U0JA 5BYAA 4KQ9A 2KMLA 1PNTA 4P54A 1R7RA 1ESZA 2J9FB 3DQPA 3E7DA 3A9WA 3IBFA 3QEKA 3R44A 2A5YB 2XIQA 4REOA 4X20B 3PDWA 2IBTA 1CRPA 1QB7A 4Y9SA 2Q1TA 1ZXLA 2VTVA 4IFIA 2C4WA 4WY8A 4NZPA 5ITSA 4OA8A 2AEEA 4W1RA 5IVHA 3B9RA 2M6LA 3U1BA 4I9HA 4ONEA 3PKJA 4B7XA 4D3YA 2XSZA 3RAGA 2OO7A 5A03A 2DY0A 1DRVA 4IUYA 1VLVA 2Q6VA 1QO0A 2J09A 3OQHA 4ZALA 4FDAA 2H00A 4WJKB 1SUWA 2XUIA 2BMFA 3KQMA 4DNFA 3P27A 2HTEA 4RNDB 3WGTA 1TFUA 1MC8A 5FEMA 3ZZ1A 2PGLA 1QX4A 3OCUA 4KUEA 5EIOA 3PPYA 2ECQA 1ONNA 3GBVA 4ZGBA 3R5HA 4O1HA 1E8DA 1QK3A 2I3DA 2P41A 5CLLA 1XF1A 4KXYA 2X23A 2WTUA 1F9AA 2D7CA 2AZMA 4Q7KA 1OT3A 1XRLA 2QR3A 3G2LA 5I9MA 2QK4A 4G9GA 3K5PA 5IK2D 4KR6A 5T8KC 5ENZA 1Q7TA 2JHFA 2P91A 2X1MA 3FOCA 4GR5A 4TS3A 4O6VA 4XARA 5KWIA 1XCOA 3DFMA 4JJKA 3DQQA 2ODBA 2V6JA 4B3IA 4N03A 4R83A 1PO7A 3T41A 4DB2A 1Q0LA 4TV8B 2PRIA 2E5WA 3QPWA 4GPAA 5A4IS 4H4DA 2IV7A 5DHSA 2G9NA 1OW3B 2G9ZA 1U7WA 3HI4A 1PZXA 1ITZA 4KE7A 3PFWO 3SFZA 1QIKA 4KMOA 5JZVA 5CXQA 1XMSA 1C3EA 2G80A 2FZEA 1X1BA 3FPJA 4Q82A 4R0NA 4Q4HB 1MRSA 4L57A 4LX0A 1RXIA 3N6VA 2D5AA 2WYUA 3TWOA 4B75A 2DUMA 2D1SA 1FYDA 4GEKA 1C8KA 1E77A 1Y1PA 4IV8A 5CLFA 5H02A 5H70A 1SIOA 1MNQA 2FYTA 4Q9HA 5JQWA 1ZGCA 2FGJA 2H92A 3OT4A 2XVYA 5JCPA 1LFAA 1XLTA 3IQGX 3JAKB 4WIAA 3CIOA 4C4AA 1WETA 3AHEA 2ZSKA 1JF8A 4I2NA 2BGTA 2BGWA 3HUEA 5FIUA 4JELA 1SD1A 2I66A 5DBHX 3QELA 2OCGA 2HJVA 1MXFA 2IPLA 4X1OA 4XR9A 3DM9B 5JNRA 5E2AA 3VTAA 1PVVA 1JR3E 1VLLA 1XRMA 2QTMA 2A58A 2B1RA 2G5CA 2VYNA 3AHIA 4LRXA 4NECA 1KHTA 4QQRA 4ZOEA 1J06A 1ZSYA 3O21A 3ZWOA 5KTMA 1AQJA 1F7VA 5EFOA 5BN4A 4YQYA 1ZNQO 3RJ9A 1QZTA 2VDWA 3AP3A 1YC5A 2CHFA 3CB2A 4OBEA 4A9AA 5AVZA 4GNKA 2XZOA 3CZCA 4Z8YA 2R8EA 4A16A 4UCXA 1KJZA 2SNIE 1TK2A 3EXIA 4B2YA 3EC1A 4B6FA 3GNLA 1C0LA 5JHHB 1OF1A 2XR1A 3GUYA 1ZQ1A 3E18A 4IY1A 4B6RA 2EP7A 5ALNA 1KKLA 3A9VA 3VOBA 2IEIA 3S7TA 4HVCA 3VHLB 1U8TA 1W76A 3IMGA 1EK0A 2KJQA 5DYGA 4ZYTA 3KSAC 2IZZA 4HUQA 3OZWA 1B76A 3I05A 3GK3A 2BCJQ 4MJ3A 3GJRA 5CX1A 1S3FA 4IDBA 3HRHA 3PR3A 1RPJA 3MGAA 1Z22A 1E0KA 4GOND 4HFJA 5FNVB 5LDGA 1QU3A 3WFZA 1E0SA 3G89A 1TMOA 3O9VA 5TE9A 4DLTA 5I45A 2P9FA 4FFVA 3DZKA 5K0BA 4DM3A 2DKOA 2ID9A 3JVDA 4NPCA 1CR4A 3RRFA 3BHJA 3DKRA 2EBHX 2FSHA 4EQ6A 5L3RA 4JBWA 3GHYA 2L18A 3N0VA 4FEYA 4KC0A 4Z49A 4OPMA 2GK4A 2A84A 5C3UA 1AF7A 2DBQA 1ISPA 2R8RA 1EA7A 5CMLA 3WFIA 3ZS8A 4NR0A 4ZAZA 1IN1A 5I8WA 2HU2A 2CMFA 1YUBA 3AONB 4HADA 3BAFA 5KHLB 3B1ZA 2VO1A 3DNFA 4BNTA 4RE6A 2CXXA 2IOHA 4LZJA 3SQNA 1NR5A 4QARA 3NBYC 2R8PA 1VJRA 1SBNE 1JPUA 4P7BA 5FP0A 4CLHA 5K1ZA 1JBQA 4HNRA 1SHTX 3LT0A 3AR9A 2PUCA 4KZKA 4K0RA 4IYJA 4Q15A 4E30A 1GQFA 1ECGA 1JVNA 3USZA 5ALLA 5JAZA 2BP7B 2N0SA 3GAMA 4PC2A 5LIRA 1VHQA 3C70A 3JS5A 3P0RA 3R6WA 4K7JA 1H9CA 3O1IC 1CUJA 4BVLA 1PEYA 1RAHA 1YMVA 2GN0A 5IKEA 4M83A 1L7NA 2XTZA 2NUBA 2B0CA 4HVTA 4QXRA 2PCLA 4YJ2B 4RJ2A 2HIHA 3UV7A 3WRYC 1L4UA 4KGXA 3GCWA 2EDCA 1WX1A 2OGSA 3U3ZA 4TYQA 2XOEA 4LRWA 2CLDX 4QJ5A 1MRZA 4ENSA 4MICA 1D7AA 5HVNA 2QTHA 4XJVA 4YK7A 1MC1A 2PKQP 1JMVA 3HA7A 3OU6A 4P83A 1WXXA 1IMOA 4W63A 3KQNA 1ZH0A 1PX2A 3MTJA 3T5CA 1FLAA 3AM3A 1E89A 1Q7CA 3CF6R 4FVTA 4LJKA 4B0OA 4ER7A 1W0KA 3ZG6A 4NS1A 4RVNA 3ONEA 2OYSA 1N6OA 4XB1A 4IDPA 2KX7A 2XYGA 3FCEA 1MH9A 5EJ4A 4M7RA 2C7RA 3BD7A 3WV5A 3IOYA 5FA6A 1KL7A 1FVOA 3AKDA 1UAYA 3JQCA 2IHZA 1CZRA 1UPUA 4KNVA 4JXZA 4RAQA 1JU9A 4HGPA 2QUJA 1CUBA 4EUFA 3JQ7A 3K0AB 3NTUA 4IOMA 4LOKA 4F45A 3BXZA 4C7BA 2PD3A 1NF9A 4Q19A 5K0NA 3C5EA 3UICA 1QV7A 2IUFA 4FDVA 4CM3A 5DXFA 4PINA 2QDKA 2UDPA 1R0WA 4NBRA 2VXOA 1KFKB 2EX0A 3GZTB 1PF7E 2YYAA 3KTAB 4B87A 4EG6A 4GWKA 3UCXA 1Y1KE 3UYLA 5GIOE 4DWJA 2YINC 3ZCUA 1K2VN 4EF4A 1JDJA 3ZVKA 3DXYA 3WGHA 1YJAA 1UINA 4UD6A 5G3ZA 3PT9A 3A1TA 4X00A 521PA 1MFPA 1C2YA 1P2SA 4O2RA 4EGQA 4AJ4A 1YB2A 1Z8FA 5LXTA 4UOZA 3TXXA 2VJMA 3UJDA 2AQ8A 4ZI7A 5HRUA 4KREA 3NOOA 1IQPA 3AIOA 3KVOA 1DXOA 1WB4A 4KO4S 1XK6A 2QX9A 3N75A 4KPUB 4QBIA 5F1KA 2GHIA 2FW7A 3R0VA 5A6SA 2XTJA 4GM4A 3AEYA 3HB0A 1YDWA 2X19A 3I42A 2JAHA 5COQA 4F84A 4IFBA 3GIDA 2X76A 1E98A 4GWLA 1SCDA 4YRDA 2I3AA 1KQ3A 1OHHD 3HJRA 3T1YB 5JFOA 3ANLA 2JARA 5HNKA 1LTKA 3MSCA 5KPJA 3E3MA 2Z9DA 4KE6A 2L0XA 1YIDA 1KYXA 1KNXA 4NX2A 3SSAA 3HFSA 1FU8A 3BIFA 5EIBD 1EFPA 3VKFA 3WSTA 1ARZA 1I14A 1SWWA 2GXUA 4LJ6A 5TT0A 4BLSA 2XH8A 4YV1A 3U9LA 3BJIC 2GZ1A 5GGXA 3E7FA 4M54A 3DFUA 5KJFA 2ATVA 1CF9A 2XF8A 3AXTA 4G9BA 2IF0A 3ED5A 4HGZA 1P18A 4FYPA 1SA0B 5CR9A 4IGEA 3UAOA 3UK6A 3VDRA 4YCMA 2P2CA 1FFAA 4QXOA 4F6CA 2F1IA 1LXCA 4B0PA 1RQRA 1DCFA 3UAWA 4CKZA 3WNBA 2ZFUA 3I23A 4ZXPA 2XDQA 3QE3A 4H3SA 3I72A 4LV5B 4DR3B 1ENYA 2QLLA 1HEIA 4AAYA 4DGQA 2OUKA 4YP9A 2V6MA 2P68A 3WIOA 1G6HA 4AKGA 1GRNA 2RKWA 4OG2A 5H9VA 3C48A 1A7AA 4DG8A 3FTFA 3EUAA 1C5KA 1NR7A 3Q12A 5CDFE 1C4OA 4II7A 5F2OA 3H9GA 1U6IA 2VFAA 3ZQ4A 4MPJA 4DZTA 5ARCA 3HB1A 2BONA 2ODWA 3TUIC 3U7FB 2GTPA 2OQ2A 2R65A 3OEHA 4E5UA 1SHLA 3HL0A 1XEWX 3ICVA 1Y8CA 3RD5A 5DLDA 4CQJA 1CUIA 2J8ZA 1MHPA 1YR1A 4JLMA 4M87A 3FVQA 4RSMA 1NP7A 1G6OA 4Y7DA 1U2GA 1PJ8A 2QT9A 1QGUB 2D1QA 4I46A 3ZDYB 5JS7A 3DMYA 5KJ6A 1C8BA 4EDHA 1G8PA 1XF9A 4JI4B 2Q2WA 2WHEA 1A4RA 3E4DA 3GLRA 5TGDA 3WHIA 4HPJB 3KAJA 2PWPA 3HLKA 1RWOA 1OWLA 2H9IA 2Q6KA 3ESCA 3U4HA 2OV6A 1MJGM 1SVNA 4HY3A 1SU6A 5CEEA 3GP8A 2NTEA 1AUPA 3ZHRA 3QFSA 4KOEC 4HKTA 2NU9B 1TJ3A 1N33B 2ODQA 2Z9CA 3QF4B 4FW8A 1MEOA 4EJSA 3RRNA 3OP1A 2QVLA 3GLTA 3ZJYA 4RESA 3R6LA 2V9ZA 4G1BA 4GOMD 4UPVA 3AU9A 3K96A 2BJHA 1CDDA 1UWVA 2WNHA 5E7QA 4F8JA 2QZ9A 4YRPA 1J09A 4XVCA 1ZM2A 2YRFA 2JIRA 3I5AA 2ZUFA 1XRPA 2UYHA 4E5VA 3ADBA 4KBFA 3PFIA 4Q1EA 2MSDB 3GF4A 1QQ6A 4N5NA 4DC1A 1C1HA 2WMNB 3HEMA 3PP8A 3UK0A 5FOQA 3AVWA 5REQB 4ZCMA 1CQPA 3OT5A 4EJ0A 1U9CA 4RXUA 4YRGA 1T9GS 4G0OA 1P29A 1H94A 4GPTA 4BLUA 3OQVA 4RJIA 3T1VA 4CMEC 1I10A 3FCAA 4RTQA 2XQIA 3HFGA 1FP2A 1TGVA 1Y8QA 2HFKA 2YHBA 4U6QA 1HLDA 3VH4A 4AY4A 4OHKA 2K87A 3A14A 3QVOA 3IALA 5HIIA 3UNXA 3BFJA 4FMDF 3GAFA 1FRZA 4KIWA 4YMGA 2H63A 5IHXA 4B35A 3RYIB 5LPNA 2XYRA 4HT3B 1PUJA 3P2EA 1EX9A 3L0YA 3Q41A 1D1TA 1EBBA 3PRYA 1HDXA 2ZXFA 2F17A 3B2QA 4FDUA 3E5RA 4G4IA 4B33A 3WJ7A 4PXSA 2FPOA 1A9PA 1H3FA 3LXXA 3UQYS 2AE1A 4IV0A 4ARIA 1SHKA 4XFJA 2FZVA 2R751 4NL4H 4PYJA 1SKAA 1U0FA 1VYUA 3UEOA 2ZANA 3CHYA 5CFOA 4OB6A 1L7VC 1OX6A 4YP0A 3REQB 3ZU2A 2XWJI 4NNPA 4G6ZA 1IUPA 1CEQA 1Q1NA 3EASA 3PDUA 3F6CA 1SJ9A 3R4CA 5K0LA 4ABTA 1NVGA 1UEIA 4HYYA 1T2AA 4PWYA 4IUDS 1VSVA 3RHFA 1XMJA 3F78A 1P7WA 5F7XA 3KWJA 1K7XB 1EHYA 2WAAA 1XWFA 1XI2A 1KE2A 3DOEA 4HXFB 3LU1A 2ORVA 3LCCA 3OWHA 3QRWA 4JR0A 3SIRA 3REGA 3GP3A 3GLVA 2O0LA 5I3ZA 1NOIA 3TIFA 2AR9A 1G98A 3ITDA 1Z3CA 2VRNA 2H2IA 1N32B 4DWWA 5FULA 4HHEA 1USIA 4JZKA 1XTZA 1YCFA 4BP8A 3ICOA 1BXGB 1KH1A 4JKIA 1I2AA 3JZIA 4N6GA 5GM2A 2YVQA 3ENKA 3SIPA 4HG2A 3EIQA 1X7XB 3VNQA 3K20A 5KWJA 4RVGA 1HSOA 1L5HB 4BGEA 2B7LA 3R7LA 1SEVA 4OTZA 1O57A 1NHWA 1B16A 1JQDA 1KEUA 3VC1A 5LQCA 2O8FB 4YX9A 2VPTA 3EOBI 1ICIA 1FXSA 3N07A 1U7TA 1T0BA 3IVAA 3GFBA 2BEJA 4CFSA 4IMPA 5DX0A 1ZA1A 1DG3A 2BKAA 1PQPA 4ZT5A 4GBMA 3W5BA 1ISSA 1K8ZB 4MMYB 5JDCC 3IR5A 1R0LA 1WBJB 2BTOA 2OCXA 5IDVA 5KNCA 2JIPA 2V3VA 2V6IA 4JCCA 4AYXA 1IATA 1N2ZA 4Y98A 2ZR9A 3EMBA 3FB4A 4HQFA 3K8ZA 3SHOA 3OLYA 1YH3A 3O8CA 3I6BA 3N3AC 4HL6A 2EZTA 4CCAA 4XUEA 4XRGA 1C7QA 2WQ7A 1JQEA 5BURA 2HHJA 4UREA 4LXHA 4TKVB 4FYXA 1W9HA 2EQ5A 3UHOA 4BKMA 1P4RA 5IC4A 2HHHB 4M99A 3GRYA 5C8XA 1TU0A 3IQEA 4MUFA 4O4HF 2NZXA 3PUVA 1ZBDA 4B7AA 4EKNB 2QX6A 2DKFA 1DPFA 4BRUA 3R0XA 1NATA 2I54A 4HNTA 3ASYA 1N6PA 5TXGA 2Q3LA 5IMSA 3FPSA 5TNXA 1QYVA 2F3PA 1GPJA 2WICA 3NASA 2ZCJA 2L17A 1TCBA 1IHXA 1EWYA 1XL0A 1RM0A 4Z99A 3D6JA 1R0XA 2Q0XA 2D59A 2D8MA 1P62B 1ZH8A 4GQBA 3LYLA 5AKZA 5K8IA 1B41A 2BV3A 4KTTE 3S1SA 4O2BA 3ZY6A 5J2TA 4K40A 2QTAA 1YQXA 2I9PA 2OBXA 1OTYA 1E9AA 2OAP1 1ZNWA 4UUAA 5LMCA 2GCEA 2ZU0C 5JADA 3O7MA 3VSCA 3AU8A 4JENA 2UZ0A 4XM1A 4DSOA 4OXIA 1G41A 1JLHA 1E7YA 3CH4B 2MSCB 4WACA 5F21A 1RQ7A 4DDMA 4EB0A 1GNVA 4ZJYA 4YY3B 1BC5A 3IJEB 1N4AA 3CN9A 5TQ0A 1I2ZA 1R9JA 3KEGA 2RAFA 1PNVA 1WQ4A 4LRQA 4EVIA 2PUAA 3MGKA 1Q0HA 1KIFA 1TT5A 1VSTA 2H08A 1E1CA 1HEYA 1P2UA 3EIEA 3G5MA 3QYJA 1EFUA 1G5HA 1ELOA 1IQ0A 5AKLA 4MV4A 4DF3A 4Q0MA 3V8QA 4IS2A 1YGPA 2B83A 2CJYA 1QOZA 1F0PA 2X3FA 2GASA 2V7QD 4OUDA 5EZQA 2VXCA 1E1RD 3ZN2A 3EK2A 2HD4A 2BFOA 3JSXA 2EFDB 1M73E 4EYQA 1NUQA 1NNLA 1ID8A 1LK0A 3ESYA 3BRSA 5IXJA 2Y67A 4EJFA 2PRKA 4XJTA 3KLMX 3GLHE 2Q4RA 3PNLA 2QT0A 3LPDA 3CNEA 2DFTA 2VNSA 4BZXA 4QYIB 4FDMA 5AW3A 1BDMA 3MCWA 1HE2A 2DF8A 4BQEA 4IGKA 4DV2B 2P9GA 1WULS 1U7DA 1JJIA 3EFOA 5FBKA 3JD2A 3C15C 3W7BA 3PDHA 4BFZA 4ZEVA 5JPDA 1R12A 1Z37A 2VP3A 5JZ9A 5EYPA 2M1XA 3M34A 4K9LA 3GQBA 5KX5F 1O94A 3DKKA 3M49A 3PVSA 1HX7A 1E4YA 3ROMA 2I9KA 1V0JA 1Y98A 2E0IA 2O0KA 4GSKA 4WKOA 4E46A 5BP7A 4CN9A 2JH3A 5L6MB 4F6RA 3TUZC 4FFNA 2Q3JA 3B52X 1JIXA 1JT9A 5KTPA 3HCCA 4Y0AA 4Z7JA 1WMSA 1J42A 3BL6A 1B8OA 4J0HA 4XM2A 3PYLA 2WR8A 3Q7SA 4OP3A 1JFVA 5ULLA 1IG3A 1Q57A 4YQFA 3M81A 3QKSB 4N7MA 4MIKA 4WUTA 2AR7A 2BC9A 5FI5A 4U7TB 1UJ4A 4WXRA 2GAFA 3IPRA 2REQB 2ATIA 3AETA 1SCNE 4WN9A 4WW0A 1GZ5A 3WR5A 3A1UA 5LWHA 3S0JA 1NIPA 1LF5A 1R6BX 2W70A 5IKMA 5JS8A 1EUDA 4DLZA 1K4YA 3F97A 4I5IA 3GLQA 4BKPA 2PZEA 3FDIA 1ZHFA 2BLNA 4N5HX 5KVAA 2YVKA 2C3UA 1AM4D 5GZ1A 4U7GA 4DT1A 3EN0A 4LX8A 4O8ZA 5DCLA 5DEIA 4N7RA 1XMPA 1Q92A 2GJKA 3JQFA 4YJ3A 4DM7A 1RRFA 2ZITA 3V9AA 3CVUA 3MCUA 2XEDA 3HYNA 2X4DA 4OYHA 1F4LA 1RHUA 4A0GA 1M8JA 1PT7A 4ZGGA 2PKYX 2GZDA 1IBRA 4RTMA 4W5TA 1TAHA 1LJLA 1KQNA 4RD0A 4DE5A 5DTEA 2MT9A 5C8YF 4QNNA 3IODA 4KGVA 1QKKA 1JJ7A 4NP6A 4YPFA 4CCYA 1FDIA 5HS4A 5EIWA 1E9RA 5CFMA 2XE8A 5DSXA 2FUKA 1O3YA 3K16A 5F64A 1DEXA 3UT5B 2VQSA 4LY6A 3NBFA 1L7RA 2C83A 1X9GA 4UHEA 1FQJA 2J08A 2B2XA 4DR7B 5TPWA 4MIOA 3TTYA 4MQ4A 4NBUA 3PQEA 2CHQA 3M70A 2R86A 1BFKA 1S2DA 4R7TA 4TT3A 5B53A 4MQ6A 2R25B 3WZLA 2RH8A 4QULA 1ZONA 3HJFA 1QHNA 4MI1A 3V55A 1QFYA 5KPDA 3WMWA 3CGWA 2OQRA 1R1DA 4F85A 2I62A 3QFHA 4RZIA 3O92A 2OKGA 4KE9A 4AXBA 3IHLA 1QFXA 3TM4A 1LPMA 1XLWA 1SXJE 2P9EA 2YDYA 3WBBA 5MDHA 5IUJC 1OILA 2XGMA 4QOGA 2X8AA 4CUJA 3R8XA 2FKAA 2D0PB 2HWUA 3I83A 2PA0A 1T1SA 3BPSA 5K3AA 2NQ8A 4NZZA 3MTDA 4H6VA 2A9FA 3JRXA 4D4JA 2HO5A 2Y76A 2J0EA 3CXUA 1L5NA 1LPOA 3KEMA 3WLIA 3UMRA 5DVZA 4MCAA 1ENZA 3FYSA 4LQCA 3STUA 2QL5A 3MEQA 3VOSA 1PX0A 1XTSA 4BLWA 4DMMA 5KYUA 3MINB 1V26A 2JCXA 1XCPA 3OMWA 3ZK9A 3IEMA 1D9XA 1AKWA 1U1GA 2R7NA 5FXMA 1XQ6A 1JIUA 1M6VA 2VDVE 2C77A 2GCPA 4Y0NA 4XSHA 2A4MA 1IOVA 5L3QB 2P9YA 4HVAA 2PSHA 4MKXA 4OBXA 4UU0A 2INGX 5TMDA 3HEAA 3CPHA 4ECAA 4OO3A 3LXRA 1ZG3A 4UHKA 1KDVA 5K8JB 3MHTA 1L4LA 2DM6A 4EZBA 1JSZA 2LE0A 1Y9JA 2WU1A 5BOSB 1UXGA 3A4IA 4DRZA 4KJXA 5C4MA 2GTHA 5L7YA 4RVOA 4QUEA 3W2HA 1RLUA 4UTVA 2Y0PA 4BX9A 4ZXFA 3WX0A 4OQEA 1DO2A 2HSDA 3OG9A 1NPTO 2OEPA 3VZDA 5L7TA 1SKUA 5AR1A 1X0VA 3C7KA 3NV9A 2FW9A 2Q41A 2X14A 3VH2A 1EHCA 2I2FA 2P1RA 2PL3A 3NV7A 4US1R 2W6MA 2B5WA 2QTCA 4KV9A 1V1JA 1TTPB 3KEFA 4GC9A 4M1OA 4CM4A 4QUJA 5CFNA 1MTOA 1A97A 5H9WA 3GGCA 2CYAA 4QJIA 1I7DA 4FDTA 5AKYA 2WWVD 1CQZA 2ZW9A 2C9OA 2BBTA 3ZW8A 4BNNA 3BJZA 1NV8A 4KAXA 2P3QA 2I6QA 5CLQA 5EEHA 1ONBA 4HATA 2VK4A 3FM9A 2KE5A 4QRDA 5J1SB 3ENZA 4RMJA 4RYDA 4KRYA 4MYUA 2D06A 2UZ1B 2W22A 1CUEA 2QTNA 5ALPA 1VFNA 3JQ6A 4D46A 1ZK4A 2YCBA 4KQ1A 1KI9A 2CXUA 2YWGA 3H5VA 5EWLB 3CX3A 5HMMA 3AI3A 3COZA 5CBPB 2IJGX 3C1AA 3NGLA 1BTOA 2LW7A 3OZDA 3T7JA 3EDCA 3WLLA 4EUKA 3T1NA 2NUPA 5EQJB 5CDUA 2ZULA 3I9MA 1H8HD 3O73A 1DINA 3M9LA 2FFQA 3RRYA 1XJWA 1KC3A 3OJLA 3ANMA 3GI1A 2DKNA 5AIBA 1JDBC 4DA0A 1PYGA 5CA0B 5AVSA 3EA4A 3NC0C 4YP5A 2NPFA 4F3CA 2ZATA 2HJHA 1LBHA 1M7GA 2H7VA 2V3WA 3GPIA 2HCFA 4WLFA 1GUBA 3GLGA 1B6GA 1E2KA 3CCBA 4D81A 4QEZA 5E7IA 2I22A 3M6IA 2UYGA 1GAEO 2FSVC 3THYB 4LXGA 4GKJB 5HPYB 5LOVA 4GL4A 3ORHA 3ZGLA 4CQMA 3FJOA 1HK7A 3A9RA 1QCYA 4BFUA 2EKBA 4G2NA 3FDXA 1KDYA 5HKAA 3GJYA 2IXTA 3W8NA 3SR4A 1T5TA 3QVGB 4EF5A 5CDFA 4ZFNA 3H0EA 4TMXA 4JV5B 2G0AA 2F8SA 3ER6A 1DDIA 4GZ6A 2EZ8A 5AJVB 3HY6A 1QTIA 4ZRDA 4F2PA 1Y9ZA 3VKWA 5KEIA 1I1QB 4H16A 5TSDA 3ZQUA 4ZI2A 4X61A 1ENOA 2W6PA 1MIOA 2O05A 5TQVA 2G76A 3ILHA 2RHGB 2UZ3A 4IHJF 5LP6A 2WF7A 5IP5A 1ACMA 2VRCD 2O8EB 1U7OA 5JATA 3PEVA 3ETGA 2FPPA 5JROA 4O0LA 1QIEA 4JAVC 1QSGA 2I6UA 3QUQA 3QX8A 4P35A 1V9SA 5TT1A 4XDZA 4KLNA 3I0ZA 2AYYA 1QG4A 3MB5A 1WLSA 2CMDA 1NAHA 1V1RA 2Z08A 3B9QA 3KB1A 5EEGA 3M6LA 4B2LA 3DPIA 3NHRA 4N54A 4I50A 1Q74A 2IEZA 1Q0PA 1U4NA 4PPQA 2ZSAA 1KI1A 4RTNA 1EWTA 1IY9A 1FMFA 1TTTA 1N77A 4OHFA 4ZQEA 3EBLA 5C1DA 5B55A 4JYAB 1NYRA 3S40A 3TEJA 2ZM6B 1V8FA 2OCIA 2X3YA 4YGYA 2QU8A 3SC3A 3PYMA 2VSFA 1T9CA 3H1BA 1TECE 3VJKA 4MVJI 4E14A 5JTTA 1SXIA 1OZGA 1DOZA 1GG9A 3EAFA 3J7TA 3DL7A 3IP6A 4FILA 3LQRA 4BU0A 2JIQA 2VCHA 2FSPA 1QVWA 1IPFA 1V1MB 3LDHA 2PEZA 5AVJA 2RCNA 1RJWA 4AUKA 3GRVA 5P21A 1V6SA 1QH1A 3PHHA 2VK8A 2GZ3A 1X15A 2A78A 5DN6D 3I62A 3T12A 4JSTA 4CVNA 1M1YB 4NG5A 1VCIA 1WUIS 1LUAA 2J7PD 1KZ4A 1XLTC 3MAGA 1ATZA 1JEQA 1I13A 2WFAA 1DIOB 4LPKA 1OREA 1K6XA 2GLUA 4WXEA 5EQDA 1J2EA 5IYZF 1SG6A 3HWRA 1FXWF 3OA0A 2A14A 3DXZA 3PUIA 1HM5A 4BEWA 5D8DA 4P82A 5DBFA 2QW0X 1JMYA 2RGUA 3HWWA 2GN1A 2WWFA 3BXFA 3PXDA 4PO8A 2HSJA 1FMJA 3H9JA 4IGAA 4LNUA 3STTA 3TIGA 4BQIA 1Q44A 3B51X 2UXDB 3EGDB 1F3LA 1Z62A 2HLDD 2Q2OA 3C24A 1NVAA 1SM4A 3LA8A 1CY7A 1B73A 4Y2SA 1RWNA 3OM0A 1PI3A 5JAPA 3IJPA 4QG3A 1CE8A 1UJ2A 2WFZA 1P4GA 2FI1A 1EGVB 1WVMA 1USWA 3PXAA 4LGCA 2ZJ2A 4HDMB 3S1AA 3CX4A 2G5TA 2VDJA 4RSHA 1B0PA 3DWIA 3HQ4O 3QI2A 4LZWA 2R97A 3INNA 4R2WA 5EWMA 5EE5B 4C6TB 3UATA 4YAGA 3A9TA 1ANKA 1JU4A 4F4UA 1LPBB 1WJGA 2J5KA 2W6ZA 1BAPA 3GDOA 3IIEA 5DK4A 2OK7A 3S5JA 4A8JA 4CTKA 4DYHA 3RF6A 2R68A 2WJZB 1QYIA 2IY7A 2QX4A 4BCCA 1KMMA 1EWRA 1ZD5A 4RHUA 3OCZA 3NNDA 5ILQA 2XLBA 1ZH4A 4BFWA 5F1YA 3CB4A 4PGAA 4YJFA 3KZKA 4ZCRA 1E3DA 1NZJA 2H2AA 2HXGA 2Z57A 1QDLB 2ZK7A 4A26A 3KQQA 2ONCA 4WLUA 5EG5A 1CBUA 2PQ2A 4OLBA 3AL3A 2X0EA 4F3YA 4GKVA 2PTHA 3GLFE 4IFTA 3A36A 4RCVA 3NH6A 5EHXA 4FE4A 4GMHA 3LCUA 1Q77A 3D7RA 1LBTA 1XJ5A 2AN3A 4P22A 2GHQA 4G56A 2VHTA 1QZZA 4FKBA 1H1LB 3D54D 1TJPB 2VYVA 3O1JC 4V1CI 1WMEA 1L4BA 3QVVA 3TSZA 1NUUA 3ZH2A 2QXTA 5LSAA 3T15A 2FHSA 5LLTA 2ZBEA 3IX7A 2NN3C 5EERA 5KYYA 2WJ3A 5K2OA 2I78A 4G89A 4OEHA 3X1YA 1X1TA 4NCJA 1R5OA 1Y7HA 3BK1A 5FBLB 4NICA 1XLUA 1ZK2A 2HK8A 2YIVX 4WZBE 4CDRA 3BULA 1UBOS 2UVQA 1F2TA 1PAUA 2PX4A 3RBAA 3WI7A 2QQEA 1H2AS 1WIWA 4OQXA 1UZLA 5EE9A 1LU9A 3LPNA 5CNJA 3RCBA 1KVTA 5F4ZA 2K2WA 1W1WA 3DGFC 2QQGA 5E1OA 2I4RA 4A8TA 4CIXA 4CT0A 4NH0A 1AKRA 2W93A 1ZKDA 1O58A 1RRKA 5FUYA 2E55A 4BMNA 2Q8QA 4LDRA 5TS2A 4XX0B 4JVLA 4ZZIA 2IYRA 5K05A 3LVRE 2X41A 4TUYA 3B3QA 1ETHA 4NOLA 1MG0A 2HU5A 3NKLA 4BGUA 5GPBA 4F3NA 4CG1A 1YZGA 4CL3A 2P5SA 2RJOA 3HR8A 4H1TA 2WAYA 3KFVA 3AI7A 2ANBA 3WL5A 3L4KA 5D7BA 4MARA 1X77A 4Z3OA 4Y7CA 4DIMA 4DVGA 1OKKA 2HDNB 3F9RA 3UA4A 1CJUC 3VKHA 1TQ6A 1JVBA 4MQFB 1XU7A 4V39A 2AJDA 5CXXA 5LZ7A 2FUCA 4DDWA 3DTTA 4X91A 3ZH9B 1JKJA 2DHQA 2JI6A 4IINA 5E4YA 1W0JD 1CR0A 4GI5A 3NRJA 3P32A 4PICA 2XKJE 2D0IA 2VG8A 2PR7A 2PHZA 5LA6F 3RTAA 4ZCLA 1FX1A 5TIIA 3W4JA 4Z0NA 5FTJA 4LSGA 1GTZA 2ZIVB 2HW8A 2AI1A 3K09C 2NP6A 1WW2A 3B3FA 2BY4A 2W4IA 2PPVA 3GNSA 4E31A 3OEEA 4LWPA 3HVRA 2Q6IA 5FADA 6ADHA 4DEXA 2PL9A 1WG8A 3W6ZA 2R48A 1SN7A 3PEYA 3KLOA 1NKSA 3D2BA 4LFAB 2WW8A 4OAQA 3U6KA 1KWGA 5LZ8A 4RC9A 2ODEA 4J3JA 4CLEA 1IY8A 3NHLA 2BH2A 3ZWYA 3U7QB 3G6WA 4X8HA 3PQ6A 3GROA 2WMDA 5DNDA 1GPBA 2FPKA 1E1DA 3EXG2 3N2KB 2P2DA 5DNUA 2CKMA 2JLZA 4CJXA 1U90A 3GJTA 3B89A 1ZAYA 1OX4B 2ECFA 4ZVKA 3UAYA 2IK8A 4OK3A 5AQEA 4D0GA 2RGRA 4TTQA 4BNUA 2DQ4A 4EPVA 5D5PA 5BVHA 4WK6A 5DFAA 1KFJB 4LBYA 2FMKA 1JLKA 1A9QA 3MELA 1L2TA 3GBSA 1SBIA 1XHFA 2GPYA 1UOOA 3BJRA 5EI5A 3BL5A 4HQ6A 4N65A 4GBED 1N5RA 3WWYA 2ZUCA 2LIVA 1Z33A 1ZSVA 3CBQA 3L1IA 4RF3A 4GOLD 1X7WA 4IDAA 3OOJA 1UXKA 3HP1A 4S1WA 5JJKA 3AP2A 4LYEA 3H9UA 2CMHA 1AK2A 3SXUA 2WZCA 3OT1A 2OGTA 3TF5A 3CIFA 4RGBA 1U2RA 2AS0A 1B23P 1W19A 4JL6A 3Q9UA 2IZOA 1YDGA 5HF5A 2FEOA 1PNQA 1DTSA 5E4TA 1N6RA 2X15A 1F1BA 4I19A 5A9TA 1ZI6A 5CCBA 4UW9A 4JLDA 2TECE 3K9WA 3R3XA 4JLBA 3NPMA 1BW9B 3W3AA 2IYTA 2BKUA 4G0QA 1M2NA 1CUWA 3N2NA 4G85A 2XA2A 5DYYA 4UTNA 4DSUA 2YFQA 1A1SA 4G9EA 1YAHA 3M6UA 4HAOA 4OL9A 1L0BA 3ECAA 3HNPA 3SR3A 1A50B 1N5DA 4PG5A 4WZBB 4YRLA 3SVZA 3ZDRA 4D26A 1COWA 3R9WA 1A82A 4IIXA 1L4FA 2P2NA 3R9XB 3A2NA 3EVAA 1YB5A 3UY4A 3REOA 3I2IA 4JXJA 4ZVSA 2C4NA 3C3WA 4MRRA 5EE1A 5L4SA 3PNOA 1E32A 1GZHB 2ZROA 3U3MA 4MA4A 2BIFA 4D3FA 1FP4A 3BORA 4G24A 4KWTA 1Q1BA 3QIAA 4MHOA 1T3ZA 3AW9A 2AJTA 4UZSA 4R8KA 3DCYA 3KQVA 3MLAA 2P0EA 1ZD4A 5TJHA 2PUDA 4CKXA 1ZM4A 4J6FA 4TZTA 4RULA 3I32A 3UV3A 5KWEA 4L76A 1NXWA 1M6EX 3RVDA 1NDUA 2C0QA 2VWPA 1F8UA 3PJEA 1C1DA 1U2GC 5EIEA 1O95D 3AEKA 2NM0A 3HXKA 4YRFA 3ADCA 2YXLA 3BMOB 4ZOLA 4LF9B 3PLAE 2B7BA 4HNSA 5GONF 3BEDA 4KRGA 3LPMA 3AHDA 3SLKA 1QHIA 5FBWB 2O1WA 3E22B 2G63A 3UWSA 4YIHA 3QSGA 2FEKA 4MJXA 4UFNA 4YJDA 4A0SA 4EPYA 1UBUS 4Y2JA 5KCZA 1JYFA 3M82A 2IXGA 2BSXA 4L8LA 1RCFA 1E1LA 2QN3A 2VIIA 3H2YA 1ZD3A 3N6RA 4PIPA 4X54A 1DZ3A 4YS6A 5E9AA 4D4GA 3OZGA 4EJSC 1OH7A 3V2GA 3PPIA 1QCCA 3W90A 3MWEB 2IYWA 5E7JA 4DCCA 1C1XB 4ZCSA 3BHNA 4KO8A 1TKCA 3NIWA 3CMMA 4PSKA 2F62A 2IY9A 5AVQA 3FHTA 3IDOA 4M0MA 1U3FA 2CSUA 2JJ8A 2R7MA 1YKGA 1CQIA 2WE7A 2VYCA 3IEIA 3HK2A 4IICA 1I6KA 3PHIA 2E1PA 4HWRA 1RBYA 3PTZA 1TAUA 2WHQA 4LWZA 2VUHB 3JQ8A 5BSHA 2ZYHA 5LNK1 1BXZA 1EFCA 4QREA 5DKFA