4ZYXA

Human gar transformylase in complex with gar and (s)-2-({4-[4-(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]-pyrimidin-6-yl)butyl]thiophene-2-carbonyl}amino)pentanedioic acid (agf117)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
200
Chain Sequence
b'ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trifunctional purine biosynthetic protein adenosine-3
publication title Structural and Enzymatic Analysis of Tumor-Targeted Antifolates That Inhibit Glycinamide Ribonucleotide Formyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 65
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4zyxA00
4ZYZA 1RBZA 4ZYYA 2GARA 3R8XA 1RC0A 4R8VA 3TQRA 4EW1A 4Q12A 1MENA 4ZYUA 4QPDA 5J9FA 1RBMA 4ZYVA 1GARA 3KCQA 1CDEA 1FMTA 1ZLXA 1GRCA 2BLNA 3P9XA 3N0VA 4QPCA 3DCJA 4YFYA 1RC1A 3W7BA 4DS3A 4EW3A 4IQFA 4TT8A 4ZZ0A 1ZLYA 3GARA 4NV1A 1S3IA 4S1NA 1ZGHA 1RBQA 3DA8A 3OBIA 4ZYWA 1C2TA 3AV3A 2CFIA 3TQQA 1RBYA 2FMTA 4PZUA 1NJSA 1C3EA 4ZZ1A 1MEOA 3O1LA 1CDDA 4EW2A 5J63A 4TTSA 4ZYTA 2YWRA 5CJJA 1JKXA 1MEJA 4ZYXA 4ZZ2A 4TS4A 1YRWA 3AUFA 3Q0IA 3NRBA 4YFVA 3LOUA 2BW0A 4ZZ3A
chains in the Genus database with same CATH superfamily
2JBWA 5LOVF 3JD1A 2VUIB 3ZV6A 5AR1A 2QD3A 2R8PA 3DYIA 4BPRA 1K89A 5ETJA 3DE6X 4FBMA 5FADA 2NNWB 4XSVA 4TTQA 4IG4A 1WPXA 1H22A 1T1IA 1H93A 2ZT5A 4ZQIA 1YFJA 2G77B 3LLVA 2FUG1 3HG7A 2HMTA 2V5UA 3RU2A 5CB4B 4L0DA 3GBSA 4UAJA 1OIVA 3CCFA 4AXBA 2J3DA 1WVIA 3R9IA 1IUOA 1XMSA 3O2NA 4UUPA 2NN3C 3ILVA 2ON6A 1PCXA 3FJ1A 1CERA 3DDHA 4JUCA 2R7AA 5LN1A 1P9LA 1LZKA 3T4UA 4R1LA 1WUYA 4X64B 3G3EA 1ES9A 1XJ0A 3VHLB 1E1RD 4AZ0B 1TADA 4MP8A 4O4JF 2FSUA 1T9AA 3BILA 3T61A 5C8YB 1OWPA 1OFUA 2QGNA 2FWJA 3RSSA 4ZAZA 3EVEA 4F11A 3QBEA 1H4SA 3IFSA 2E3JA 3EWIA 4ZYLA 1YZGA 4EHLA 5B1DA 1MABA 2FPRA 3USCS 2ZYVX 4HRVA 3L7KA 2CDNA 1GN9A 1XKLA 1NBHA 3GHHA 3MEQA 5BWLA 2KE5A 1N7IA 2PFGA 2AK2A 3NHFA 1R6DA 3KZVA 3KZNA 3NHRA 1L7AA 1OLUB 1VYVA 1KI7A 2DECA 1FTYA 1I2AA 1PG5A 2JJ2D 3LV8A 3MFYA 1SXIA 5JS8A 1X86B 2ZSFA 3UV6A 3SC3A 2VA9A 2P1DA 3IMCA 4MA0A 5CYPA 3GEPA 5BMOA 1O6CA 3FH0A 4EUFA 3R74A 5I47A 2OCKA 2Q7XA 2HQSA 4HLCA 1S1MA 2JC3A 1YASA 3R4CA 4OKIA 3FG9A 2EEPA 4B5KA 3NBKA 4QHSA 1JQJC 3MLEA 2FW0A 4JQSA 2VSFA 3FSRA 1YL5A 3OJEA 4CEIB 4CMEC 5CJ2A 4CF6A 2W2VA 2XRYA 3ZHBA 5A3QA 2CUNA 5I01A 4PLYA 1Z8NA 3N3AC 5D87A 1KC3A 2FSHA 4PC6A 2AUTA 3OZEA 4QTTB 3SMVA 3ZHCA 4CUJA 4EQ6B 5BNTA 1NW7A 1H8HD 1K7FB 2OXEA 3L7YA 3RJMA 2DLDA 2AW5A 1AKEA 2WUEA 4NS1A 5MGBA 5CXXA 1FDWA 3FOBA 5KKNB 1A9ZA 1PFWA 2ACVA 3RE1A 1D8AA 2J0UA 4EJSA 3DFFA 4YT2A 4YDQA 1DWUA 5LPNA 3LKBA 1HNNA 1EZ1A 5F4ZA 1I4EB 1OZFA 4NL4H 4MLPA 4FYMA 1CQJB 1SXQA 1U99A 3ROFA 2D0DA 1YNOA 3ZLJA 3JQAB 3CWZA 2NIPA 3ROGA 4NEQA 3U49A 3TTXA 1LFDB 2BFFB 1XU9A 2BGJA 4IFTA 1QGUB 4GMGA 2X0KA 1JEQB 2VKQA 1KQOA 3QYPA 4MB6A 2FZGA 4E31A 3KUXA 2B92A 1DIOB 2FX5A 3N9IA 3RS4A 5DNCA 4AX8A 3TOZA 2PXCA 3ZW7A 2JHGA 3U61B 5A4IS 3KAKA 1GRVA 1UMCB 3JAKA 5ALXA 3SBOA 4AMUA 5A5FA 1MO5A 2QUHA 4XB1A 4XIFA 4GPEA 4OMDA 3Q3VA 2JFUA 4OLFA 5JW6A 1WPRA 4IO1A 2G08A 1UXGA 1JDNA 1J7JA 4FSHA 4L5JA 3P8ZA 1QS0B 2R6CA 3P9YA 4RZ2A 3RABA 2GX6A 3UIEA 3UT0A 5FOUA 1ISHA 5L8VA 3G8AA 3LA6A 3JWIA 3N58A 1QUFA 2K2QB 1U4SA 2OILA 2CL0X 4FNOA 4ZO6A 4ZAYA 4FFSA 4L6IA 5ERYA 3T54A 2HNAA 3T5CA 3ZHZA 1N3YA 1WDKA 4JKOA 5COQA 3FOEC 3ZCTA 3M4JA 5JH7B 4UEJA 3E70C 4DADA 4ZYVA 2JEZA 1QTNA 2QPOA 2W2KA 3H6HA 1D4AA 2R68A 1EU1A 3HWWA 1KMIY 5EGNA 4D98A 4MHTA 5FPSA 1C1DB 3OM1A 4JFRA 3ICWA 2P9EA 1H5UA 1Z56C 4ZALA 3SXUB 2V9CA 1RRPA 4XWOA 5CIYA 2H9IA 3LKZA 1O58A 1Q6YA 3GT3A 1ZJ5A 4O08A 1JV2B 4OOFA 3CQ9A 1U9JA 2I2BA 3GAAA 1KZYC 1V5WA 2ESRA 4FXOA 4KACA 4D9EA 5BSKA 3QFFA 2VJKA 4A0GA 4ARCA 2HXYA 5K0LA 2AE1A 3TQTA 3BIWA 3HBNA 3D3WB 1VP3A 4KAAA 3LPNA 1ULSA 4D7AA 1MNQA 3RRMA 1QWOA 1QOZA 1C80A 4J75A 3ZHYA 1KFJB 4QNMA 1D6NA 1PZXA 3SK0A 4EDHA 3HRHA 4OQQA 2VTDA 3T3GA 3ZVRA 3J7AC 5JFGA 4II7A 3AETA 3JRNA 4G0WA 5GZ6A 1A7UA 5ILGA 3N2GB 1BW9B 1NC1A 4P7JA 1X77A 4V3BA 4BMOB 3PYMA 1HF3A 121PA 1SXHA 2DGDA 1ZIXA 3GIWA 2MYPA 4LZLA 2GF9A 4NDAA 4UHFA 4XQ0A 3SZMA 4WZBB 3GPLA 2W83A 5E3IA 3D81A 2ES4A 3JQ9A 5FWXB 5KYWA 4PLGA 3KKKA 3VBCA 3I5YA 2EFHB 3B6KA 3EIWA 2HK8A 3NDJA 5H70A 2XOKD 1JFFB 3UJ3X 5F23A 3SBDA 3E4DA 3OX4A 2OECA 4YJ2F 4YRPA 3REQA 3QOWA 3V4PB 1MGOA 1TEXA 5K3BA 4RSRA 2WKSA 2B1RA 3H3JA 2H1CA 2PH5A 1IIRA 3HRIA 3K6KA 3NHSA 2UZ1B 1Z75A 1AQYA 1MAAA 2IH5A 3UV7A 1SXGA 3JTEA 1IG0A 3OZBA 3BERA 1Q0SA 3NDIA 3U3RA 4BJ6A 2GO7A 5DMXA 5K0SA 2XWJI 4WZBE 4CMJA 2P90A 3TQHA 4UNIA 3PLAE 4M8NE 1M2NA 3J81k 1MTOA 1Z5NA 1CW2B 1Z0FA 3IDFA 4YB8A 5DRTA 4OJNA 3QFTA 3DDNA 1G5RA 3GJXC 4ESHA 2N47A 4NYIR 2I54A 5EFZA 5G0SA 2C0QA 4MUAA 2IXTA 5KVAA 1TC1A 5K0EA 4PQEA 3ZJUA 3KQHA 3UPUA 3QVLA 1ZD4A 2VDWA 4JEIA 1LDGA 2C8VA 2W4QA 4FGZA 1QO0D 3C7DB 4Q6WA 1M54A 4PLTA 4YJ3B 3FMFA 5BNZA 3L77A 2OLEA 1PJZA 2OGUA 5JXGA 3U7GA 3MAGA 4RZSA 1U0RA 2IS4A 1MIOB 3A6EA 2ONZA 1AA9A 3A32A 3GD5A 4NPCA 5AO9A 4ZI7A 1M1UA 5KSPA 1N4DA 2IEBA 4K5QA 5BYJA 3CBGA 3OE7A 1YR3A 4M9SA 4OP2A 4PLZA 4GW3A 4GYJA 3RKRA 5DXAA 2AN3A 2PA3A 1LNZA 5DTIA 1XT6A 3I0ZA 1DT3A 2Z98A 3AWIA 3FYUA 3MOGA 3WFZA 3O7WA 1KNXA 1MB2A 2ECQA 2HSZA 2ZR7A 3JQDA 3L8MA 4O4LF 3KS9A 3RVNA 4ZJYA 5JQGB 1JH8A 2DQYA 4RF3A 4KREA 1PLKA 1OX5A 3CN7A 4TYYA 4ZCPA 4QG7A 2GAJA 1FXSA 3R3HA 4TZKA 3ZXUB 3N2LA 5T8KA 2C7PA 1JLRA 4D25A 1QF9A 2GRUA 1AV7A 3GLIA 1XGKA 1WPGA 2XUQA 2E1RA 4C6RA 2VP3A 3D8TA 3KQTA 2E4XA 4ZYUA 1MB9A 2Q50A 3AUTA 3D31A 3GLFA 1DAGA 1TM1E 2AN4A 3GRRA 2CXSA 1BTOA 4H7DA 3WNCA 5B3JA 4DIUA 4CN8A 2Z4TA 1L9XA 2NU9B 3GGDA 3IKLA 3SS9X 1FQOA 1ELOA 3UATA 3RSCA 3DMNA 3VR6D 4MO2A 2BISA 3B7PA 2GOYA 4FHGA 1C3XA 2BFDA 2HSJA 4XSHA 4F6RB 2X4GA 2G72A 4HHEA 3D7MA 3UY4A 3O38A 2BEVA 3EIEA 1BSVA 3UEOA 3N2IA 3P0EA 3LO5A 1KMQA 1A9QA 3CO0S 1VGQA 3HU3A 1NZDA 4GLOA 2GERA 2Z56A 3EFOA 3MGBA 4I55F 4OTZA 4DT1A 3AF2A 1RLTA 3I01M 4PGGA 5K4GA 3WMEA 4J4HA 4B47A 4GZ5A 2WHXA 5LXTB 4HFMA 1AQ6A 1VBFA 5ALUA 1O0CA 1ZRMA 1YONA 3SC6A 2R3SA 2Q6OA 5DULA 4WY8A 2XOEA 3SS7X 1NG1A 4PM4A 4DB2A 4ZWNA 4J16C 4X8OA 2O8FB 3CXRA 4MV8A 1XO1A 4RAOA 4BUZA 4RTLA 1G0NA 1YRBA 3T7DA 1FX1A 2EIHA 4FK8A 3PE6A 4X94A 3TLAA 3TVTA 1ZL0A 3VNBA 3V48A 3COJA 3BWMA 1CUCA 1EFDN 3GDHA 2XYHA 4R16A 2PUTA 1NIJA 1L4KA 4Y1FA 3VZSA 2OYSA 3HRKA 4IMIB 4MS4B 2VL7A 4JFAA 3T7RA 3TUIC 4GPAA 3ZE1B 5LA6B 1NVTA 1ML4A 4QAJA 3EBLA 1LFAA 13PKA 1LLQA 1QLHA 1QQ5A 1Y9ZA 1Z74A 2Y0CA 2AQIA 3I6QA 5TF4A 4AUMA 4CTNA 2I7XA 4D4LA 1U9CA 5IKOA 1BFDA 2O7RA 3C7CB 3GELA 4URFA 2ZXUA 3DQZA 2Q4OA 1FUKA 3QX7A 4I55A 4MHSA 1LB1B 5MN6A 3LBIA 2GJSA 2IBSA 6REQB 3WL4A 1K7XB 1NASA 4IIJF 4D9JA 4TZ6A 1E1CA 2YIDA 2IKSA 5FHQA 2QX4A 4HDAA 4FYJA 1OU4A 3GFFA 4GP7A 3CLHA 2AZMA 1JVNA 4XJTA 1XQ9A 5EY5B 2IOFK 1QHHA 3H4MA 3N87A 5BRAA 5T6BA 1ZA1A 1TJYA 2AFIE 3Q7EA 3OE5A 5EZQA 3T7JA 3U48A 4UMEA 1NLYA 5FFNA 4PYJA 4TL8A 4YAGA 4MQFA 2IYXA 1L5LA 3V4ZA 1VHTA 1PR4A 3OLXA 3CZPA 1WJGA 2CE2X 1JIKA 2OAEA 1XXHB 5I9BA 2PUGA 2ILVA 3DBLB 1ZJJA 1OXUA 2ARKA 3PC7A 3QUTA 1U98A 2M2IA 5CX1B 2P9HA 4D0SA 3WIDA 3CO5A 4IIEA 5B1EA 2OZLA 2ABWA 1XMQB 4AB1A 1U7TA 2NUTA 1DO2A 3B85A 4ALNA 1ZUNB 3BJMA 1WBDA 4OK6A 2OFWA 1L8QA 4MITA 2FUEA 1QVRA 1J25A 4LW8A 4D8UA 2DFKB 5J58A 4HYQA 4ZVQA 4BFTA 5KU7A 1V6SA 1HE5A 3CINA 4AQYB 2B35A 4RBNA 1BXRB 1QYWA 1M6WA 1CLEA 1EEXB 1Z4IA 1CNFA 3CFYA 2QUJA 4BNUA 1XXHE 1Z35A 4B46A 2OFFA 4IIJA 2OESA 3JASA 1Q7BA 1M8KA 2QXYA 1YR2A 3F7MA 4GVXA 2X23A 3HGQA 1ANKA 2BLNA 4KFUA 4AU1A 3P0FA 3PUKA 5TGZA 5GADl 2BV3A 1I9GA 3B5JA 3EZFA 3I9OA 4MDHA 3FSGD 4NZOA 4OJYA 4NJEA 1YH3A 4B3XA 4NZZA 1H4TA 2RBEA 1JRLA 4M2LA 2FH5B 3RIHA 3AEKA 5A4DA 1XDWA 1XMIA 3D59A 3NKLA 3T1OA 1SJ9A 2VF5X 3IJPA 1L5YA 1ETHA 1CUUA 2FOXA 2IXBA 3K5PA 5AJWA 5AD1A 1USKA 3UOGA 5JJLA 5HKBA 3G1TA 1N5IA 4J76A 1OMOA 3ZEIA 4CQMB 1X19A 2GZSA 1HWYA 4LEIA 3ULKA 3NHMA 1EHIA 3P2MA 2SKDA 3GJ8A 4R9UC 4MR7A 5FIUA 1NT2A 5BP7A 5K3DA 1PR3A 2H08A 4Y2XA 2OXFA 4UREA 4C6TB 2BEJA 4KLRA 2B2NA 4JJ8A 1XEXA 3IUPA 2H1OA 4F1WA 1JG4A 1RRCA 1UDWA 1E3LA 1U8ZA 3WSTA 5E1DA 2CKDA 3SIWA 5J5VA 2CZQA 1H2WA 2NNLD 5DSTA 4ER7A 2FRDC 4Q7EA 4CLRA 3THWA 4IV8A 1OPXA 4YJFA 3V1MA 3BMOB 4UFOA 1XMOB 2IZZA 2MSCB 3EC2A 3NHZA 3S1LA 3U80A 2BGGA 7REQB 4A15A 2V74B 2PJZA 1TMOA 3IKMB 4RHXA 5GVSA 4P7BA 3OOSA 2GVNA 3AKDA 2IY8A 3UJ8A 2J3QA 4A9AA 1ECPA 4AJOA 3V8VA 2HEIA 5C3MA 2H18A 3MGCA 4DV3B 1C9NA 1YHNA 3QVXA 3I2HA 1JB9A 1W6RA 5JECA 3ADOA 1J8QA 3H16A 2QD2A 3TLXA 4D9IA 1IQUA 1PK9A 1PWZA 2P4EA 3AHHA 1Y8CA 2FZEA 4OFZA 2DKFA 4PV7A 5DI9A 4WECA 4DZZA 2I99A 4U2EA 2PBLA 4L50A 4FGUA 4PANA 1FA9A 3DV9A 1IWPB 1FSFA 1AN0A 2EW1A 2JEYA 5GMOA 2XE4A 4RDIA 1CF4A 4KK3A 4ZU1X 5C1PA 4MINA 2OXIA 2JLYA 3EAFA 4O25A 1SB9A 4FMBB 2HGZA 3AU8A 3NXKA 3CZ9A 5EEGA 3UB4A 4X84A 3T1YB 2BGLA 1YQ9A 4GU5A 2R86A 1BCSB 4IMPA 2G36A 1IQPA 2OD7A 2ZB7A 3PU6A 4DWWA 2I9PA 3RSQA 1O08A 1L1EA 5K7SA 2VP0A 1Q0PA 5CP8A 4MV3A 4MWOA 4RIFA 5C5CA 1K7CA 1XMXA 1FL9A 2EX4A 2FNAA 1HDXA 2ZS9A 3AHIA 4RK5A 4WNAA 3ER9A 1AN9A 1JXAA 4U6SA 1FXUA 3A2LA 5BV7A 1PGOA 2YJGA 3BDIA 2RGXA 3H75A 1XD8A 4KXWA 5L3QA 5EAIA 1YZTA 1JQBA 4IZIA 2OCPA 3OFNA 3SGLA 4CR7A 4CM8B 3B6JA 4HZUA 3G5UA 1RWKA 1XLUA 1OXVA 1OZHA 2WM8A 4KLCA 1ULUA 3LQ4A 4M54A 4D2IA 3U6KA 3O8LA 4HDQB 4Q1VA 1T3ZA 1XV5A 2NM0A 2HO4A 1GNPA 3J7TA 3L92A 3Q7SA 4L4XA 4O8CA 3L02A 4HL6A 4AN0A 1J97A 1Y8QA 2J4FA 3IVXA 3M2TA 3ZU6A 2NVUB 4S2EA 1DEOA 3WK9A 4D8YA 2PZMA 1P1IA 4ONEA 2OV6A 3D2CA 1HT3A 4CKCB 1DAFA 2QBYB 2G25A 5FO0A 1KZGB 3AI2A 1E3DA 2EFYA 1Z39A 1KDOA 3P9XA 5ARDA 2O57A 5EZYB 2R1VB 2QA5A 4UD6A 3W7VA 1P5HA 4JXXA 2AOTB 1LSOA 3HCFA 4KYVA 1SXPA 3NH6A 4LCEA 1FFYA 2OWDA 2VCYA 2H85A 2MMCA 4DARA 4AO7A 2ZRAA 4URUR 5LCXA 3RUAA 1BQEA 1CJMA 2OBMA 4TLAA 3CX4A 1VL0A 3WKDA 3B9RA 5IABA 2PKWA 1EUDA 1C3OB 2Z9CA 1RAHA 4QU8A 3B5IA 1WCWA 1RHMA 4BFLA 3F8TA 1YULA 3AIKA 1BDMA 2ODNA 4DWVA 2PD6A 4ZI2A 2QAGA 5EERA 2I1QA 4JBNA 4CODB 5C5DA 2ATVA 3ODGA 2CNLA 2IYSA 3E9EA 2DJ5A 2E2WA 1GKIA 1RHQA 1U5BB 2NU7B 4XQ9A 5D6OA 2JHPA 2Y1EA 3NIGB 4FDTA 4HY3A 2JFHA 4J7XA 4WY5A 1W88B 3E3LA 5JSFA 2EC5A 3OCZA 4N0EA 1V39A 3AV3A 3I12A 2FN9A 2Q3CA 3CLUD 5HM6A 1UFOA 4HMQA 1IB0A 4NBSA 2YUIA 2QM8A 1YHYA 3I09A 2C98A 2Y9PB 1U2EA 3OCUA 4RVSA 4UBOA 3WZ2A 2KJQA 3EW9A 3GEHA 3SM3A 4KIWA 4V0MA 3LVFO 3PP8A 4RY2A 4QBGB 1MA0A 1N6KA 1ORIA 2QQ5A 2QB5A 1RRKA 4KMOA 3L01A 3A6ZA 1ULZA 2GD1O 4YDRA 3QW4B 4IF4A 1GV1A 4OJMX 5M29A 5HRAA 3EVAA 3U0VA 1QR6A 4DWJA 4A2QA 4GMFA 1PG0A 2R96A 3KKEA 4UHJA 1EJ6A 3NAQA 1EWRA 5P21A 4C4PA 4P3NA 2BF4A 1UOEA 1Z0ZA 2W2LA 3HDQA 4DA0A 1I13A 1X7YB 3FDZB 2JGFA 1OAOC 3LUBA 1KJQA 2IU6A 4LOLA 5AHRA 5LP6F 1TM2A 3PHBE 2MJLA 2I6FA 4NU6A 2O8DA 2ZWMA 2DUUA 2BMVA 4EBFA 4HDMA 4NU5A 4WACA 1C29B 1JHMA 1CQZA 1Y48E 3M9XA 4Z9YA 3D6HA 1U8XX 1XRLA 3EDYA 5ENDA 5H3LA 4C7KA 2HCFA 2IH4A 1G98A 1FU7A 2Y1LA 3WGTA 4M89A 4N3NA 2QG6A 1NXOA 1VSTA 5E4TA 1AKWA 2FZCA 4W6ZA 2A0XA 2NOAA 4ZVNA 4OH7A 4AXXA 1VIDA 5FL7D 1Z2NX 2ANBA 1PEKE 3U1BA 5AW5A 3V3TA 3H8JA 4EVIA 2JJQA 2O8BB 4E08A 3LGAA 4CFYA 1HDEA 2Z3WA 1Q3TA 4DJJA 5LWHA 3GDWA 1ZHOA 4NULA 3T5PA 3RVMA 4IIGA 2D1YA 2A5LA 3EXFB 3EXHA 3NM5A 3DVQX 4FEYA 4G5HA 3OKCA 4GX1A 4OIFA 3FI9A 2CLDX 5CGZA 1FYFA 1LRJA 1JJFA 1CPYA 1Y1RA 2Z6VA 2IK8A 3L1UA 3RYHB 4HT3B 4NU0A 4KI0A 4X5OA 3EEOA 1SUIA 1O54A 2BJWA 4PAWA 1UKZA 1AZSC 1B1AA 5G1PA 1WLSA 4UEOA 3S2EA 2WR8A 4AF8A 2IEIA 1YL6A 4P98A 4NNJA 4WESB 2AMVA 4JL8A 1RI4A 1NI3A 4OJQA 3LG2A 1GUAA 5CH3A 3SJ7A 3PEWA 4JT2A 3E9ZA 1A9PA 3TFWA 1RJ9A 1UC4B 1I30A 1W47A 5GJCA 1H0HA 1E0KA 2Y0BA 2RHGB 3H2IA 4YWJA 4DIBA 4EBBA 3WA6A 3NAGA 4QXPA 3R7WA 4DW8A 1NN1A 2QLNA 4OB8A 3RG8A 4RDCA 3RT7A 1IH8A 5CB4A 3JATB 3OPQA 4TRRA 2RHTA 3JSXA 4UPDA 4YQYA 1T0HB 4B3IA 4DYVA 1VM6A 4DLYA 4G2TA 2G4CA 1VE6A 4JT4A 5MFPA 3LU1A 4WK2B 5LYJA 2CLIB 4RD3A 1K1EA 1Z4OA 2A3NA 4KZKA 4EG3A 2J3KA 1O5TA 4QJ5A 4F4DA 2BONA 4L57A 1YF3A 4LHSA 4CLXA 1TUBB 1DFIA 1K4KA 4LDAA 5JISA 5KAMA 2X6TA 3T7EA 1E4YA 4FE3A 2QENA 2H52A 1SCQA 4BMZA 1MB0A 2NTVA 3O8BA 5H16A 4G09A 4X1YB 3DGEC 1G18A 5LZ9A 4L7VA 1OE0A 1VOTA 5DM70 3EDMA 4P0TA 1Q74A 3KT8A 4WV3A 1Q1NA 1ZISA 4X7PA 3QU5A 3PGLA 1NQWA 2FX3A 3KSRA 4KAXA 4R4JA 1REQB 3C1TA 1QK3A 3CH7A 1ACLA 2QUAA 3OT1A 2GZAA 3K2EA 1DEHA 3B3GA 5M5BA 4HEHA 3NTLA 2X14A 4RPLA 3B8HA 1K3FA 1R9NA 3GP5A 4HDKB 4DAEA 1AT1A 3MWJA 4DLZA 4MGEA 3H3XA 4ITRC 2QW0X 3UC5A 3HN7A 1WPQA 2Y1FA 2P9ZA 3MB5A 3UYLA 3PNVA 2H2FA 5ED4A 2RC6A 1A1SA 1WMEA 1JR6A 2EGUA 4O3FA 3UFXA 7ABPA 2IHBA 4IHAA 4TMKA 1KERA 1GJRA 3F71A 4HDSA 1E2FA 1G20A 1KI2A 3BSYA 4U7TB 1AHPA 1Z2EA 3GA5A 1X80B 1U3GA 4CW7A 3RYCA 3GMDA 3NOQA 1GUBA 3EHDA 3CTPA 4FC6A 3TTTA 4DOMA 5HWSA 1GGJA 2BZ1A 4C7BA 3GEIA 3CRW1 3CEJA 3FTCA 4ZHQB 3ET4A 3GH1A 2A1UB 3O3MB 2B4KA 2WUFA 2PO7A 3DOJA 4ODIA 5HQJA 1LDYA 4DB4A 5DW3A 1F1JA 2W43A 3AXSA 3LUFA 1HDZA 1IATA 2WTMA 3QBTA 1W5AA 2XUDA 3IILA 4IFEA 3VHXA 2UUBB 3DEHA 3LIPA 3W8DA 1PLJA 3P20A 2ZBEA 1IPFA 3G5TA 4TRJA 4HB3A 4RVHA 4IYRA 1P2SA 3PHIA 4YRLA 5EZSA 3GIDA 5JUWA 3EFEA 3F73A 3DUFB 4OHUA 4LYHA 1J6UA 4AECA 4D9NA 5DYTA 5CVDA 1ZD3A 5LKAA 5J2TB 2YVQA 5DZSA 3M6AA 2QOEA 4LBWA 4TV9A 4DEYA 4BMXA 5E6UB 1NJ2A 4DPLA 4UTVA 3FOCA 5NULA 1SD2A 2AMLA 4H4EA 3HA7A 5DCWA 1UDXA 3BD6A 3EJ6A 2ODAA 4J0EA 4QQRA 4Z3DA 1X74A 4PBSA 4G67A 3ZWCA 1S2NA 1X87A 4B6EA 3HGTA 2CL5A 4GF5A 1IY9A 2QNBA 3S2UA 3PRJA 2BZSA 2A59A 2D5LA 4P4LA 2BDUA 2KX7A 3BXEA 3CRQA 4RIHA 4XYMA 3RPEA 3VR5D 4HVLA 5DYNA 3RVRA 4B3BA 1M1NA 2EX0A 4WLOA 3ZBUA 2QX6A 4UCFA 1NMQA 1Z12A 5KNBD 1G8GA 1HYBA 3D02A 5IAOA 3IQDB 4GG1A 2EATA 1BWRA 2FSPA 5FUQA 1IOVA 5ALRA 4HVAA 1P8JA 3BM5A 3MUOA 5KOHB 3IXQA 3HVIA 1HE1C 4UEQA 1X3LA 3CZCA 3FVTA 3WQRA 1WP9A 1DKOA 1ZOIA 2ZI3A 1HDIA 3JYPA 1F17A 2QX9A 1BDHA 1HDOA 1D2GA 5JADA 4RAQA 1Z18A 2QK4A 2GCOB 3AM5A 5E1BA 2AEJA 2DPLA 4E03A 2CV2A 1XCLA 4ZZIA 3BB4A 3ZLBA 3TQQA 4GM1A 2C59A 1P44A 3EC1A 2LP4Y 3TCKA 5DBGA 3KT6A 1DJOA 3LPAA 4RXTA 4G8JA 2B69A 3QNMA 4QEKA 3WJAA 2GF2A 3WXBA 4LYYA 1FP1D 4M1QA 1S2MA 6YASA 1H2BA 3DZGA 4NEHB 1V25A 3H4VA 2PMEA 2C8JA 3RR2A 2GBCA 1EDEA 4ZVUA 4DN6A 2ZTMA 5TQVA 1XTRA 2Z9BA 2IYWA 2IYNA 3ZWOA 2YHAA 2KBEA 1XDDA 3QKRA 1OWOA 1XHEA 5E6RA 4ZYTA 5BWNA 2DE0X 2PIAA 1CZRA 3EARA 3GLKA 4RKEA 1TO1E 4K2AA 1HT0A 3I2IA 2G40A 1FUUA 2F4NA 1B93A 2X2PA 2AB0A 3FZYA 4FYPA 2PDAA 1TTPB 1GG9A 1GQQA 1ZNYA 3MQ2A 2GBLA 4HDRA 5KYUB 4FMPA 4P5PA 4WLEA 1PG2A 1Y89A 4JQCA 3RTBA 4F04A 1H2YA 3SKYA 1SUBA 3HP7A 4KIFA 1USWA 1DU4A 2OGSA 2WT8A 5BV1A 1CR6A 1B8VA 2OQVA 1YS4A 3E22A 2WJIA 3KR0A 2P2YA 2W11A 3L1KA 3MCVA 3MXTA 3O9ZA 3PQ6A 2BFEA 3VSCA 2FEAA 3DKIA 3QY0A 2O48X 3HDGA 4OXIA 1V43A 4RKYA 3M81A 4M1YA 4DL9A 3Q41A 1N34B 2X0RA 3UW1A 3N6RA 1HURA 1M6YA 3VX3A 1N0VC 2EZUA 3RYIB 1LX6A 2V0GA 1U3UA 1A97A 3NS7A 4RO0A 2YZKA 1SM4A 2I6XA 3E7PA 2G83A 3THOA 1DPFA 1H2FA 4TTVA 1UZMA 4HKTA 4GKBA 4BFSA 3LT0A 1O8BA 3TOCA 5KYXA 3HEBA 1P4RA 3X2FA 3BL8A 3D3KA 4B17A 3NTUA 4JYAB 5CFNA 3E5NA 5EPEA 1ISMA 2OFXA 4KLNA 4CPDA 4PSAA 4KWTA 5ESRA 5IKMA 2GZRA 4NJMA 2C9DA 3T7AA 2ZIZA 1JR3A 1T9DA 2O0MA 3I92A 1QO9A 4NYMQ 1L3CA 3DBVO 3BUSA 1ZJZA 1W7AA 4HTFA 3A6DA 3DLHA 2B7CA 2C31A 4E5SA 4WKBA 1UM9A 4G63A 3A4YA 2WSSD 1SIOA 3BWYA 3LY5A 1MOPA 4KWHA 3SSOA 3VTZA 1JAHA 2IUYA 2YR0A 4LCBA 4QEDA 5ELLA 2JF0A 5EGSA 1T1SA 3ASUA 4DJTA 3U16A 4ZK2A 1SVOA 4URVR 1Q0RA 1XJ5A 4G0OA 3HU2A 1Y82A 4YP5A 4YR7A 3HZHA 5K6AA 3VMMA 2A0UA 4HLDA 4LQCA 3LC2O 5EE1A 2W6MA 4NV1A 3ZKAA 5J4VA 3G8YA 1HV8A 3G2KA 3C8HA 1BA3A 1ZGHA 3HN2A 3IP8A 4JJZA 4Y2TA 5G02A 5KHLB 1TTTA 3BGVA 5ENZA 3VKGA 3PDJA 3KVNA 4FIZA 4CWAA 1PEAA 3PVZA 4JR2A 3KQNA 7MHTA 3ZWVA 4EKYA 5HZMA 1Z38A 5E6SB 1EI9A 3A9UA 3HV0A 3PIIA 5DK4A 1NYTA 2DSNA 4MGIR 1ZN9A 3LXXA 3NIBA 1YR8A 2FF5A 4BNTA 3KZ1E 3VNSA 1C1HA 4PFJA 5IVIA 3UQZA 4K6FA 4H7KA 1JIQA 3NWPA 3B6EA 4YCSA 1L7DA 5AKJA 2XE6A 4CKEB 1KAHA 3CSUA 1W76A 1DLIA 2TRSB 3I62A 4YALA 1Y4AE 1QKIA 3JPYA 3NBAA 3RFVA 5FP0A 3FE2A 3HJNA 4ZVSA 2QMYA 3U4CA 4XJSA 1Z2PX 3QPBA 4LJKA 5TLSA 3AVXA 3TX6A 4WN9A 3FBGA 3DP9A 3B2QA 3GB9A 1VE1A 2XX3A 4BTLA 3DZFA 4QXQA 4DSOA 2XTAA 1KWKA 5CTJA 3LQ1A 3L4EA 4MUYA 1MEJA 2J6BA 2X1VA 5FHRA 3RVSA 5GONF 2JI9A 1VHJA 4JX9A 1EFUA 1WB4A 1ZMOA 4Q9NA 4XQCA 1L5MA 2D1RA 3QPCA 3KD3A 5I7FA 5G1OA 4IW3B 2GA9A 2HD4A 3PSAA 3VYUB 5JCXA 2XT6A 5L40A 2DFDA 4BXOB 5EA2A 1FP7A 5AK3A 2XA1A 5C7YA 1NLZA 1KEEA 1WHSA 3M1IA 1VMDA 1BEUB 4K9NA 3R3XA 4YRBA 3EF3A 1AQUA 2B9EA 3ESBA 2PO5A 3MF4A 4BFWA 9LDTA 3VQTA 1N7JA 2KM1A 3KL2A 1GPDG 1PYGA 4ISBA 4UKDA 1ZKDA 1ZVJA 4OHXA 4P3OA 3LWBA 1F2DA 1JXQA 2HRCA 5F77A 4H60A 5IK2D 1GDTA 3PC3A 4I6JA 2A9FA 2VTBB 1A5SB 2Z8XA 2IHUA 5JMPA 4BFZA 1QZXA 4QJ3A 2ZANA 3A27A 3IE2A 1QVZA 3PKIA 2YJ6A 1LPOA 5JNVA 4DV2B 2PWYA 1F0PA 2XCUA 2MWMA 1M1YE 2RH5A 2WBLC 3BZBA 1YMUA 2ZM6B 3PUVA 1EWQA 5EUQB 3IX7A 4FIDA 3ZHTA 4UAVA 5K8JB 3UFBA 3ECAA 4LIPD 4PZYA 2QMZA 4D81A 3PC2A 3VHQA 5BSEA 4KUHA 1ZJ4A 4XWWA 3E0XA 3LX4A 4O5OA 1OIXA 5AW0A 2B37A 2W8BB 4J3FA 2WWYA 1QF7A 2FK8A 3FZQA 3MM4A 1TT5A 3MWEB 4D46A 2IZ5A 3CA8A 1VJDA 4ZKEA 1DIAA 2PQ2A 4YP0A 2LUOA 4V3CA 4BEVA 2EJVA 3TH5A 3CNNA 4P81A 3AM3A 3ANMA 1QCZA 1IRXA 4OQLA 5ALMA 3CVWA 3X0DA 5JG7A 1PI3A 5KEIA 4N1AA 1AUPA 1T5SA 4RSGA 3HK2A 1T2CA 5IEBA 4TMYA 1YKSA 3KEGA 4R9SA 4YYEA 5A6VA 1MQ9A 3LLMA 3DL4A 3E05A 5A4KA 5FUVA 3JYQA 4ZYWA 5EP3A 1UBSB 2FEPA 2UYGA 4LS3A 4UM7A 4EOGA 2QORA 4DLAA 2P78A 3D7RA 2B5VA 1Z16A 1YQEA 2I29A 4MPPA 2VPQA 1L7EA 2R60A 2WSBA 2XUPA 4MDYA 4M1MA 3D64A 4XCQA 5LMNB 1E4EA 2V6IA 2HY7A 1FSZA 2LRHA 1SXJD 1YFZA 2POQX 2GA8A 1ISFA 1UFRA 3AX6A 3DTVB 3DDSA 3KEQA 4MWDA 1GG5A 3UAXA 4PHGA 3W2IA 3PDIA 1QV7A 1N8NA 4RX1A 4JDPA 4MVJM 2YVAA 1P29A 3UPDA 4CUKA 2TMGA 2PL9A 1CV2A 2NTYC 1E61A 5LKRA 1E3JA 2WZCA 4MP6A 2VAMA 3SKVA 4EJFA 4YCLA 1JKJA 3OMLA 2VHEA 2J9FA 2E0IA 3ONNA 3O90A 4BS9A 2JFQA 2V3CC 4RKWA 1JAZA 1UWCA 2EWMA 3GDGA 2YMLA 1RYFA 3I28A 5DOZA 4EY3A 1RZ3A 4TKUA 3U26A 1FUEA 3OZRA 4MV0A 1D7AA 1E7YA 5TXGA 4KGZA 4YPFA 1JSCA 4M4SA 3NEPX 1OZAA 2XLBA 3MC1A 5F7JA 4DVGA 4E51A 4EO9A 5EMNA 4KB5A 3U5ZB 1CVLA 1BO6A 1SD5A 1X8KA 2A0WA 5B2EA 4YP7A 1TKBA 3UXEA 1PV2A 4XGNA 1XZJA 3TL6A 3R9XB 3GZNA 3N39C 1O9BA 2Q2OA 1PX2A 3BJRA 2XGJA 4E88A 2ZYTX 1GL6A 1MHPA 1HTWA 2C3OA 4OSOA 4R1MA 3ZU2A 1XF1A 1JLLA 2JARA 1YRLA 3H04A 3IEKA 4FGSA 1DIGA 2A6PA 3ISJA 4MRPA 3ZZUA 1RYEA 2QHXA 4M8SA 4BEBA 2DHEA 4EHNA 4ES6A 2AOUA 3TM4A 3JQGA 4IKOA 1YK1A 3L46A 4P34A 3TR5A 1WF6A 4KFTA 4B6GA 4PLCA 4E5DA 1BGVA 4DA4A 1DKPA 2GJKA 3C7AA 4HEA1 5E2BA 4V1CA 1WNTA 2H57A 3KPUA 3PNBA 1C0KA 1U2GA 1VE3A 3R4VA 2CVQA 4R2MA 4BNFA 5IDXA 3AF3A 4R81A 1U1FA 3WRYC 2JDID 3QY9A 2F9FA 3KOYA 2H2GA 3TF5A 1UZNA 2AYXA 3WWYA 4BNIA 4UHCA 2BDEA 4LBYA 1BXKA 2I6QA 2VSQA 1E2UA 2O19A 3WFIA 3WHPA 4DR1B 1S8AA 2EWVA 1QYXA 2WVGA 3AVUA 2PX4A 3QMWA 1T6NA 4XEHA 1DOAA 4BB5A 2HU5A 3X1DA 4OXYA 1NRIA 3DFMA 5ESDA 5TNXA 1PNVA 4YXWD 4A2WA 1GUDA 2LDXA 3R3YA 5IT0A 1UWVA 3H2SA 3LCMA 5C37A 2C2OA 2LCQA 3WGGA 2FXIA 3FMGA 3W5DA 4TL6A 1G8AA 2FVYA 4MRRA 2ZJ3A 3X3HA 3GRKA 3DEAA 2QUZA 2VQ3A 3PFCA 5I7WA 4G0VA 4BVBA 2O2XA 3C6XA 4MPJA 2G7MC 5ANRB 3EOAI 4H1VA 1E7SA 4U5QA 2RH8A 3O4VA 1QIMA 2DPXA 3CEPB 1DXOA 4M9ZA 3UANA 1T3HA 3LECA 4PO3X 3WL3A 1JU4A 1IHXA 3UWMA 1UBTS 4YMVA 2XB2A 3CX8A 5LOVB 1T2FA 1ZG3A 1ZGCA 3OWOA 4LE2A 1NUPA 1FDVA 4CM9A 4O4HF 3RRNA 1UPXA 3S7ZA 4FYVA 3WBBA 1KDTA 3LHSA 1Z0IA 2GO1A 1KMCA 1RR6A 3VGJA 3BWXA 2G8LA 4K8OA 3OPYB 4LRTB 5TS2A 1KYTA 4XASA 2VUTA 2GMWA 5E1MA 1TMKA 5CH5A 5DGXA 2VO1A 4HX9A 1RM4A 2ZZMA 5GM2A 4U2FA 3RVKA 3KT3A 2NZXA 1YZVA 2IL1A 4EGQA 4KVGA 2ZB3A 4ZZ1A 5KDOA 5LU8A 3AB3A 5SZHB 2Q9AA 1HTTA 4TSKA 5LM3A 1JR2A 4GR9A 3EMVA 4OYYA 4O4JB 2IQ5A 3VYRB 3FPLA 3AU9A 4WKNA 1DBWA 2D1QA 5CJJA 2WKRA 5AT1A 1W44A 2OB1A 4A2PA 1AV6A 1MUUA 5BNIA 2H00A 3ECSA 4NZMA 2OKGA 3A10A 1VIVA 1XR3A 2V6FA 3IDAA 3QVGA 4OQDA 4TVBA 4P7GA 1WUIS 3FUCA 3RIMA 2H5IA 2XECA 4ECEA 1RVV1 3TLMA 4I5FA 1LDMA 4I4TF 5IAAA 4AKGA 4WN3A 3ND8A 2W6OA 1WULS 4G0MA 4D0LB 4H9GA 3A14A 3NBYC 5DHQA 1EGMB 2QTZA 3T06B 4C3UA 2P35A 4DRZA 4PYIA 5GJBA 5F1KA 2G70A 4PS0A 4IFBA 3WIEA 1WCV1 4MDFA 3WHLA 2C1EA 3VOAA 3KV3O 1YKFA 2I3BA 5F9MA 3QWIA 3OAAA 1KEWA 1UKVY 1LBTA 3L7CA 1K9SA 3AQ4A 3C4QA 3L8CA 1IZYA 1U0LA 3QELA 3UN1A 3INGA 4QPJC 3SWWA 1P31A 3FNFA 4D3SA 3QOYA 1WHTB 2VDVE 1BHQ1 3IVAA 2RB4A 2PM8A 4PIPA 2VC2B 3OA2A 4YBZA 3SFTA 4NK5A 4KSBA 2F3TA 1DBPA 1EVZA 2BMDA 5L3RA 2G71A 3SX4A 4Z2AA 4EW1A 5BRJA 1GITA 1MV8A 2ADMA 1RP1A 1YRQA 2CWWA 3Q9SA 3RSZA 3GOHA 5HIMA 4EEZA 2UYCA 2EF1A 4G5RA 1Y6JA 5IARA 2FA9A 5JT1A 1OROA 3A4IA 3FAZA 1YJAA 3KDSE 4ZVVA 1QFYA 5JWRA 1RMQA 4QGSA 2YH2A 4I4TA 4QUGA 2EJWA 3CWCA 1PR0A 1KOLA 1YD7A 2P0EA 2HT1A 4CM4B 5C9ZA 4D3XA 1SHKA 4AMBA 5C34B 5B6IA 1GNRA 4BTEA 2FZKA 2OXTA 3BXGA 2MSLA 3OF2A 1T4GA 3G17A 3TKAA 3ZS8A 4BAUA 4DLRA 4HAUA 1X7WB 4NYJQ 4K9OA 3UB3A 5DLPA 2FWIA 4LKRA 1CUVA 3VR2A 5KSYA 2JLXA 1PR1A 3D5QA 3GEGA 1RI2A 1FDSA 2VYND 2X5JO 2O8VA 4UVHA 2YWFA 5ICEA 1IHDA 1JDPA 4W5JA 2COUA 2CLMB 1GCAA 3DE3X 3M49A 3O4IA 1VG1A 3ZZTA 4BO1A 4E5KA 1DEXA 3DEYX 2WWIA 2GEBA 2ADFA 3FKJA 3LZ6A 4ZJZA 4KUGA 3AEYA 4CF4A 3ABSB 1IN1A 4IFIA 5BNFA 4D80A 3V1KA 1IY1A 5A7FA 1OTYA 2OZPA 4JJEA 2X1HA 5KYWB 2H5EA 3MS7A 5DDIP 3X1JA 2H2IA 1QTQA 3GJQA 3ZR4B 4KW7A 1A7JA 1JJVA 1FMJA 5AVRA 3OEWA 1NJSA 2Q45A 4BWGA 3K1TA 2RKOA 2C5FA 4KBFA 3OUZA 3SVZA 3FY4A 4PPQA 2VXOA 3MJCA 1ZZGA 4YUYA 2PK3A 1CRWG 3PX7A 2C9BA 2IPMA 4JXJA 4PSDA 3E3NA 2ZI5A 3HEMA 4A82A 4JC0A 3B51X 3C8ZA 2WJ6A 3HL0A 1GG2A 4NOMA 4K2HA 4L6CA 5DOVA 1DC4A 3TPFA 3GFRA 1D04A 4GGOA 4REOA 4YDHB 3S6JA 1OH5A 1QHIA 3BIFA 2CXTA 3MIIA 2CXPA 2Q5QA 3F3KA 4B73A 4ZT2A 6Q21A 3CRRA 5KTPA 3RWBA 1R37A 2J9XB 2R6ZA 2VAWA 2YWJA 1EFKA 3V7YA 3BQ9A 3T7TA 4MUIA 2BKAA 2ATXA 3AL3A 4ZCRA 4KQWA 1P1JA 5AQEA 1ZUIA 2VPYA 1RXEA 1D2RA 1YB1A 4KYTA 2F8SA 1J42A 4I9GA 3KZXA 1TYEB 5AI0A 4ER3A 2V7EA 4D41A 4IZOA 2R6AA 2OY0A 3S2ZA 1XZQA 5DGTA 1AKTA 1QE0A 3JQBA 5EJ8A 4LFCB 5FYQA 5KJ6A 1PDWA 2B4TO 2EKDA 5L7YA 5DGIA 2NSYA 5K0TA 2QVYX 4PXYA 3ZCPA 5CNIA 3Q3IA 4I5EA 1RI1A 3ASYA 3MAJA 3KB2A 3PFKA 4RD0A 5LB2A 3HNRA 5CCDA 3R7LA 3RUDA 3E2PA 4F9FA 1OX6A 3L7LA 4GBJA 3AJAA 4YJ2B 5DGDA 5F3RA 1I7DA 2WVAA 3OKAA 4X7RA 5ULLA 3L7BA 3FYUB 4UUOA 4V0LA 3PCRB 4DCVA 4B1FA 2JKYA 3CR7A 5EHNA 1VKOA 2K6GA 1N0IA 4NCBA 1WKVA 3ZCXA 1X13A 2NTJA 3DE7X 5A06A 5IDWA 3G59A 1ND6A 5F1YA 1KK3A 5A7GA 2BR3A 2H0RA 1UBRS 1KZHA 1K2WA 4PGAA 3F7TA 5KDLA 1R4NA 3NT4A 3RKSA 3SLKA 3IQGX 3UAWA 1T29A 4D9GA 4F3NA 2VHXA 3GLIB 4EKGA 2M6SA 2B2XA 1UPUA 3RSGA 3U7QA 3ZHQA 1YS2X 3T7SA 5JCZA 5FWYB 3GLFB 4WBNF 3VYVA 2ZZKA 4M87A 2O1SA 1T1EA 2X19A 3NVDA 4KUEA 4E46A 2HJSA 5IMBA 5TVKA 4ZDJA 1XFAA 2D00A 2OORA 3WVNA 3TO5A 1GVHA 2CL6X 4LI3X 4FHFA 4PYRA 4LV6A 1E0SA 1O96A 1M8PA 2BFDB 2X3YA 3Q72A 1E1QA 4EF4A 1I2MA 1TU0A 4LRYA 3AR2A 4O0MA 4W5TA 2WMNB 3A1UA 4GXNA 5SY6A 1UKYA 3DNFA 3WGVA 2C95A 2OUIA 3FWZA 3C5CA 3V9PA 5KQLA 3EFOB 4J1TA 3SR0A 1B16A 1ORTA 3CKYA 1RCTE 1DKNA 3P0RA 1R0RE 3NAMA 4KQFA 2GTPA 1LVGA 3Q7PA 1UJ4A 1F5NA 3SU8A 3J81A 3GDOA 1JIIA 2CXRA 1OC2A 1Q14A 1PKXA 3R76A 3RARA 5IZCC 3W8RA 4Y3UA 4H0FA 4B74A 1TECE 3DW1X 4O4LB 2UAGA 3G68A 2C77A 4P2GA 1KPIA 3WRWA 4HEQA 4C04A 2ZUSA 4G01B 4IVQA 4NESA 1DL5A 1AZWA 2HQRA 3LYHA 4RELA 3W2HA 4DMRA 3O9VA 2AHOA 2BFNA 2FQYA 2HHLA 1E3MA 3STVA 5IJAA 3RT1A 3M1LA 2XTMA 1V5FA 2QYOA 3VZCA 5IG2A 4MQLA 3MCWA 4WINA 4L9SA 3NANA 1XJCA 3A70A 3CURA 1TA0A 4QE3A 3QXHA 2LPMA 1DJNA 1SK9A 3ZQJA 1DC7A 1W29A 2JATA 2ACEA 3BORA 3KHKA 4ML3A 4MV7A 4O2RA 3RFCA 4EI9A 4K6CA 1K5HA 2HU7A 3I04A 4L0MA 2VATA 3Q5DA 4MLCA 4RWZA 3WTCA 4AG3A 1P4JA 2C3PA 5BQ5A 1X1RA 2AWOA 5EXDA 3PQEA 1MFZA 1J9GA 3DL0A 4C7VA 4N12A 4I55B 2UZIR 1V37A 1FC0A 3F4LA 2WAYA 4A6EA 4YHHB 1CQPA 3M9WA 3LX5A 3R5KA 2G1KA 1HL3A 3PLRA 4LE1A 4M49A 1YE5A 1O6ZA 2PXHA 4CBVA 5CD1A 1QFJA 1K4YA 2IFTA 3T1NA 1GT91 3IUEA 1Y9JA 1AOXA 1R1DA 1DV1A 1YVPA 1GZDA 1KVQA 1QHHB 2G76A 1E6UA 5BMVF 1GPWB 2QTFA 1EAYA 1N8TA 3DE2X 2QRLA 3K4PA 4H7IA 3ORHA 2DH5A 1JEYA 1J0CA 1NKVA 1WQ4A 2Z5VA 1RMYA 2ZRPA 3JD3A 1Y3AA 3NDRA 3STWA 3UV3A 3C98A 1M2VA 1M6HA 1AF4A 1Q0HA 4HAXA 3KSDO 1C8LA 3PUIA 3TTVA 3FA2A 3PPIA 4IH1A 5ITVA 1TZMA 1AUVA 4TS3A 1RLOA 3R8XA 5BOSA 3GPDG 1P3JA 4PGMA 2IYFA 1ZH0A 3K1AB 1P39A 1NJ6A 5AKYA 3AL0C 4CL2A 2W6QA 4JEMA 5B4VA 4EDFA 1KKMA 1C7EA 3GGOA 3MHTA 1SCJA 2NU6A 2BC9A 3D6FA 4TYWA 4RH1A 3WLSA 5BUZA 1NUQA 2C1ZA 4NDNE 1S0UA 2XGOA 4BNMA 5I9NA 2ZJ8A 3NTVA 3WGLA 4I1VA 1TJ3A 3DWGA 2E5LB 4XYLA 1OXKB 2PUEA 4JQOA 4FQ8A 4GI7A 1RWMA 1K6JA 2P6PA 1LBEA 3LQ2A 4IIJB 4ITVA 1GCGA 3P0HA 5K5EA 1RC1A 3OHMA 2CZCA 1NQUA 3S4YA 3K70D 4BBAA 2BVNA 3AYZB 2J9GA 4GGPA 3BGWA 4QAQA 1GA6A 4EITA 2J3MA 4MUJA 2H54A 4NJEB 5TJHA 2D62A 2NQTA 3Q5GA 2IEGA 1S9HA 2JAXA 4RY9A 3R3SA 3AEKB 2RJNA 3SBEA 1L7VC 1HT2E 3FBTA 1JAXA 2BFMA 2X22A 5DB4A 1L7XA 2FN7A 3RUEA 1PIWA 1U2ZA 3OZVA 1EBBA 3DLBA 3HBMA 2O3JA 4J1NA 4II2A 2DX7A 4TWRA 2PKYX 4AAYA 1P6QA 4HDNB 1T6YA 4F9GA 1DC6A 4MR7B 3CH6A 1CULC 1S4QA 3KJEA 4XGIA 5AXCA 2I66A 1UC8A 4Z9BA 3UQYS 1SAYA 4DR2B 2O05A 1TZBA 1XEXB 1XLVA 3WYGA 1EIWA 2G80A 2NO1A 2VZ8A 3O7MA 4MOWA 4J29A 3AJ8A 3D6JA 4O4IF 3RDPA 2V7XA 3BRQA 4YAEA 5A02A 3IULA 3TGWA 2LGJA 3IOYA 2F8LA 2XCTB 1H6AA 3THWB 5F2OA 2JJ1D 4YRFA 4OVKA 3ZHOA 4CQJA 4LZOA 1B73A 1P1FA 5JAZA 3NHKA 2ONJA 3F74A 1VHDA 1V4NA 1Z3CA 1DXHA 4WWHA 4F46A 1LCIA 1TT7A 1L4HA 4BC0A 3RC8A 4GKKB 3IA7A 4FFMA 1FRQA 1WXIA 1ZMRA 3GG2A 3KO8A 5IYZA 4YJGB 1R9JA 2OO5A 5CFOA 2OBYA 2CZGA 4NS4A 1H1TA 3GNTA 4J49A 2QTNA 1JEOA 4DIFA 5EE9A 1UT8A 3K8QA 1H85A 3O94A 5KNDH 2NO6A 3K31A 4ZVMA 4NBKA 5AJHA 2AF3C 2GFIA 4BP1A 3IPRA 3LUGA 3SDSA 2YJ5A 3KSMA 1TUIA 4CV0A 2MOKA 2X2EA 5J40A 4G8DA 5EPUA 1GAXA 3NIWA 1TM3E 5DHFA 1AXGA 3DAFA 3EF1A 1TYZA 1U9YA 1V11B 1AMUA 2ZBPA 4GI1A 1UMBB 4H1UA 4KEAA 4NBVA 4Y6PA 4YUXA 5JCOA 1KQGA 3QLUC 1F5SA 1N2CB 1OBOA 3D0KA 4ZVLA 2ZBDA 1WCIA 1RCFA 4FR5A 4QUIA 1PVOA 3SYRA 4DCTA 1BJKA 1G8HA 1K5PA 1YRHA 2QE7A 3RM3A 3STUA 1D9XA 2XUOA 2P2NA 4O4IA 1O1YA 1MO3A 3IKJA 1OLXA 3TOVA 3IIEA 3PUYA 5BWMA 1IBSA 4ABYA 4PZCA 1V5GA 1KVRA 4FSDA 3S5JA 2X3FA 3JSAA 3TL3A 4B09A 1VSQA 4R1SA 3GLHA 2IUEA 1A9TA 1JWBB 2PZBA 3ELBA 1M2KA 3C24A 3RS3A 3DW3X 2QIPA 2XT0A 3C5VA 1XP5A 3QV1A 2E4ZA 4NR0A 2FMKA 1IY0A 1DX4A 3AZOA 4WNAB 3UK7A 5L53A 3D5EA 4OL9A 2NU8B 3A7EA 1VB5A 5DNAA 1XYYA 1M2OA 4UFPA 3KK0A 3JS5A 3OF5A 5L3QB 2MHCA 3GFPA 2C00A 3EWNA 3U37A 3VDXA 3L7JA 3YASA 4BNZA 1ZRHA 1QTRA 4HZUB 4RZIA 3U17A 1ICEA 2WP0A 5TB5A 2WIAA 3U3XA 1UKEA 1NX6A 2R62A 4FDMA 1W2HA 1KL7A 1Y8QB 3OQJA 2HMWA 1M2JA 1RABA 1WMFA 2FPIB 1AVTA 1ETUA 2MINA 1ABFA 4B76A 1R4MA 4MEAA 4BFXA 2ZSKA 1FQWA 1ICIA 1YDEA 4MAMA 4RVOA 2VSOA 2R8EA 4QTXA 3GP8A 3W4IA 4L8YA 3NZEA 3GLGA 2D3TA 1OA1A 1UMDB 3DCYA 5D86A 4KE7A 4CMBA 4WFJA 1WS6A 3HKCB 2ID9A 5C52B 4XUDA 1W49A 4HXYA 4QREA 4TTPA 4X00A 3RQIA 1JPVA 4MQEA 4W1PA 1EUDB 1I9CA 2REXB 3O2SB 4FJ1A 4N4AA 1KE2A 2IV7A 2B6NA 2Q0QA 1AA6A 3E2MA 3TMYA 2TMKA 3FOZA 2O8EA 3QUAA 3MLBA 2X8AA 4WE3A 2OCXA 5DVZA 2QAGB 4I81A 2O2SA 3ZDFA 3A9SA 2HLDD 5FT9A 1XQYA 1L1QA 1BQ4A 1TQ8A 1E0DA 1TF7A 2ODQA 4NFHA 1S01A 3Q9UA 4KXYA 5L7WA 4QYMA 1QZUA 4H7PA 3U1VA 1P2VA 1Y3BE 2XVAA 2Q6VA 1Y5IA 1CJSA 3ILSA 4NICA 3NTOA 2R79A 4KCGA 1K6MA 3EQZA 4ER5A 1SKYB 1E69A 1EYZA 2UDPA 3JVUA 4X92A 1WBJB 5CLHA 4ZOBA 4PZLA 3D3QA 3JR3A 3Q0EA 5K8VA 4QOSA 1A8IA 5EIAA 1YXMA 3I3SR 1DFGA 3H3FA 1Q44A 5LU9A 3KVOA 3OU6A 3VPGA 2LNDA 1J99A 4PNPA 5K0CA 2BP7A 1OI7A 2IOHA 4TWAA 3BE5A 4DEXA 2OHXA 1S4MA 2W6JA 1AB6A 2I2CA 2P5YA 2ZWPA 2W2OA 2VWHA 1NAHA 1EK2A 3EDQA 2DHQA 2FKNA 3L7NA 2RH4A 4KOAA 1ONNA 3K9HA 5A9SA 2JGLA 1GN8A 3JQPA 1L5RA 3ZY3A 1T1RA 3UW3A 4DBLC 4M36A 1VYTA 1HNXB 2IELA 3TSOA 2UVDA 3PUXA 3IALA 4L3OA 1H2AS 2B9VA 3E7XA 4OAPA 1QHFA 4Z4FA 3C4VA 1XIVA 5ERXA 3SXJA 4YRJA 4DIKA 4A26A 5C8VA 1XELA 1K2VN 3PITA 4AYTA 2RD2A 5TPZD 2UZ3A 3H5VA 3H9QA 3KKNA 2AWNA 2PS3A 1NVXQ 2C61A 1KYQA 2ZTSA 3E82A 2QRUA 3FYUC 4PG5A 1SC6A 2F7SA 4PIVA 4S1OA 3UK1A 5IBPA 3ITDA 3OURA 4RYDA 3D8SA 3TEFA 2WD9A 3TOXA 2ZVQX 1M66A 4OQYA 1TK2A 4U7JA 4DA9A 4LF9B 1N6RA 1T1JA 1J2UA 1EAMA 3PFGA 4YT4A 3JYOA 3C6ZA 2MIIA 1RBZA 2CYCA 4QBIA 4JLAA 5FFFA 4TLBA 3STYA 1SVKA 4PNEA 1OWNA 4MJXA 1QYRA 4UARA 3B3AA 3ROMA 5K99A 1DT5A 3PTAA 3K92A 1CKEA 3OLYA 2QMUA 2O8NA 3R75A 1ZIOA 1WV0A 3OQPA 4CKXA 3KQPA 2XAUA 3EXHB 3FKSD 3KJHA 5ALIA 2YKGA 3PEYA 3WIUA 5BOVA 1VSBA 2V1UA 1ZSVA 3U4AA 3ENWA 5KYVA 4NABA 3F47A 4KQGA 3SX0A 2BKVA 3L7MA 2P5TB 4N40A 3QWHA 4HUQB 1EVEA 1I2DA 1PSZA 1QK5A 3GXBA 1Y6RA 3KP1A 2BTQA 4H77A 4M1WA 4XAQA 3V8EA 1I2ZA 2EFCB 4XM2A 1KXZA 4NZYA 1UKBA 4ATNA 4D5GA 2I6SA 5CFQA 2ORIA 4LHYA 5LP6B 5EZ6B 1PJQA 4TZ0A 4GR5A 1Y7HA 4RLSA 1RZRD 1ZH2A 1PQUA 1FNNA 3A1EA 1RJ9B 1XAJA 1R5JA 2H9YA 2KB0A 3M3DA 3N3BC 2A5FA 4CGYA 5IHPA 4R8SA 1FW8A 2P91A 5H9WA 1CUBA 1NBIA 3R7WB 3BD7A 4UEWA 4F85A 3T0IA 1SVMA 1SOVA 3BN3A 4U0KA 2L17A 5ALFA 5SY4A 2Y1GA 2J5BA 3PQ2A 3C3DA 1P72A 4RK1A 3S0JA 4IOKA 2Q28A 2NQ2C 1PR6A 3SC2A 4P86A 1EFPA 3QLVA 5DHAA 4BV3A 1URPA 4U7GA 4YONB 4AW9A 3HVKA 4F3RA 1FXWF 2IYUA 3MINA 4K05A 1F6BA 4PTYA 1XL0A 3FM9A 4ND8B 2NO7A 4JL5A 2DJIA 3OG9A 4HH0A 1J2JA 3I05A 3KD2A 4DSUA 3IUYA 5LIRA 1BE1A 3B52X 3ZZMA 4XGKA 4Y1GA 2FXVA 1HEIA 2AKAB 4GX0A 3ZOKA 2B94A 2VUHB 3H1GA 4AMVA 4BO8A 4TT3D 3PXDA 3L6CA 1OBHA 3ANXA 2BH9A 1V48A 5FJIA 4F2PA 3SJZA 2WFLA 3GHYA 1A4UA 2E85A 5BSHA 2GD0A 1G2OA 2ZXFA 3A6PC 5JARA 3JY6A 1KAMA 3KXIA 3N7UA 1MOZA 3RVDA 2QIOA 5K0JA 1C7JA 5K2OA 2JKZA 1TQ2A 4HTAA 3K6SA 5JS6A 3NP7A 1NBME 1SHZA 3TAUA 3WLIA 4LSGA 4KKVA 1CR4A 2PQ6A 3C3WA 3BZWA 4MUHA 4B3JA 3SQXA 3IXMA 1DZIA 1FUIA 4M88A 2DBVO 4YUZA 2W93A 2ICAA 1JR4A 3FCXA 4L0CA 5HHTA 5CYFA 1KARA 2IY7A 1BWSA 1ZGGA 4RGYA 2HF7A 1EM8B 1HLGA 1GGEA 3L84A 4KQIA 3WMFA 4LRSB 4F7WA 4CF7A 2LW7A 4MMXB 1WSAA 1G20B 2EL9A 4U2GA 4PC2A 1E8NA 1KE1A 1J07A 1I32A 4XOIA 1E6CA 1KJJA 3RYCB 1PX0A 3RTEA 4TS9A 1NQOA 4BFYA 4DCCA 4GR4A 3FJYA 2D3WA 2FF7A 2QN3A 1KAQA 2QZZA 4HYEA 4QGHA 1BMDA 4R1PA 4UDOA 5HDQA 4F84A 1OY1A 1UODA 3P5SA 4JJ6A 5BSGA 2V03A 2HZ7A 1YHZA 1VIAA 2Z8YA 3GJTA 2WWVD 4HQLA 4JA0A 1YBMA 3FGZA 3VFDA 1QG2A 2XZLA 3H97A 1ACJA 1RC0A 1CD5A 3C97A 3GRPA 3I32A 3QVTA 4RNDB 4LDJA 2F1OA 3VHXB 4EGSA 1E1DA 5HQ3B 4BOYA 1ZEJA 5I45A 1JU3A 3OIYA 4C29A 3KAJA 2HDOA 2IYQA 3C8UA 5CLGA 2DF8A 2E55A 3FVVA 2WG0A 3H4TA 3SQLA 4NXMB 4YRZA 3I3OA 5ALVA 2P6MA 1H9CA 1JIJA 1CVIA 1AG9A 3SHFA 2XYVA 2CMDA 4FOOA 4DAOA 1G2QA 4XB6B 2X5XA 2XMSA 4MWTA 2XSZA 4QODA 5KNCA 1D1QA 2XD9A 2FR8C 4HAIA 5DBFA 4ZAVA 3HP4A 2F64A 3W8EA 3G7UA 2VR1A 3CY6A 2JGIA 2YZGA 4QLBA 2PJDA 1QRTA 1ISGA 4CLDA 3NIFB 4Y1RA 2HDHA 2QU8A 2C4HA 2G63A 1OI4A 1SBCA 3L7IA 2MR6A 2WJPA 2W9XA 3D4NA 3W3AA 1PZFA 1MH9A 1TEVA 1TJPB 1Y3DE 4WXYB 3Q40A 3R7NA 2C7RA 1M1NB 2WPDA 4W5HA 2IWHA 1VBKA 1E9RA 3GD7A 2KLBA 1RQ2A 4Q01A 1ZLYA 1DX6A 1IBCA 2QQFA 2X7JA 3GJSA 3I64A 3JZMA 3KWMA 2X6RA 4ID9A 5JSUA 1QLWA 3FRIA 3TRDA 3MT0A 1LSSA 3CVOA 2JGDA 4MV6A 4QDTA 4CMEA 4KPEC 1F8XA 1MG0A 2JGKA 5F33A 5G3ZA 5I9LA 1UPCA 2ZUVA 5JRJA 1HYHA 2VZEA 1ZW6A 3BXHA 3DJFA 1NVEA 2WJZB 3DXXA 3EGOA 5EHIA 4B75A 3P2JA 2W58A 2O0LA 1RLMA 2HA2A 4F4HA 3SFZA 3P5BA 1QHYA 4ZFNA 3EGDB 4L9RA 5CPBA 5ERGB 2HRZA 1H9BA 3OIWA 2YWHA 4YJDA 5IFKA 4FR2A 3NBFA 4US1R 3VJKA 2GVDC 5J3JA 4O2AF 4KAFA 3AONB 2WIKA 4H7HA 3BC1A 4JSYA 1VLQA 1R8QA 4CV1A 3QKIA 2IGBA 1E77A 4DNPA 3ES9A 2G0AA 4HXEB 1YGPA 5L9AA 3I9NA 4WXRA 5BW4A 3FPCA 4TUYF 3AVYA 2CV0A 4BJ3A 3G2HA 3IMFA 4DPMA 1RJDA 2OVBA 2JH9A 3ZE7A 1M2WA 3BEOA 3W6PA 1RE1A 1RRMA 3PB3A 4BZXA 3FFXA 3OETA 3AKZA 1LDBA 1GXSA 3PF9A 4DLUA 1EE2A 1XLTA 4OHVA 1BEZA 2EGGA 3AR8A 4DQDA 2VTKA 1H4QA 1ODLA 1NF3A 1RXWA 1IN5A 4IJQA 3ZUGA 2ERXA 3FZNA 3QKRB 2Q5JA 4LJ4A 4K6MA 5E6RB 4NARA 3QEOA 5AJYA 4AKSA 2V9PA 1A8SA 2BKLA 2FMIA 2PH3A 3BAFA 3FNRA 1L4LA 2PMDA 2ZWVA 3I37X 4KQMA 2O2ZA 2BFWA 1F8UA 2DR3A 5DN6D 4JIMA 3EZ2A 1NBMD 3FOAA 4HDRB 4HWSA 1JKIA 2LCFA 1GQRA 1NY6A 1PR2A 4XTRA 4P53A 4Q21A 1IJKA 1Q0TA 3OECA 2AC7A 6CHYA 2IH2A 1L7BA 2RGNA 4JHLA 4QARA 4GICA 5JLAA 3FCUB 1UFKA 4DLSA 4DMLA 2BFEB 3PWTA 2XWSA 1GDDA 1TEHA 1UDBA 2N42A 1UXIA 3QIVA 2AG8A 2Q1UA 3ZY4A 4BVHA 5EHQA 5LZ2A 3G0HA 3GVXA 1UQUA 4KQKA 4UBIA 3HXMA 4C22A 1OB5A 3WV5A 3A1FA 5KWIA 1KORA 1EE9A 2YQ4A 2I65A 4URYR 4CMHA 4Q0MA 4XUGB 3A1SA 3IO5A 1GZ6A 1QV9A 2QTAA 5IEJA 1VL1A 4LYFA 5KYXB 1B8PA 1C1YA 1YA4A 3EIHA 3GRAA 1P5FA 3ZX5A 1Z6PA 1NDUA 5HS4A 3C7KA 1MP0A 2IYZA 3C41J 3P9CA 2H7VA 3GYBA 2IPNA 4WADA 1G9SA 4G5GA 3D6TB 2D7CA 3OZIA 1C9KA 4NECA 4BQSA 1P1BA 3WWDA 4BCCA 1YK0A 2QAIA 1OHHD 2EG9A 4NEGA 4U7FA 5CNKA 3SF8A 3QV2A 1XDZA 4FMDF 1SBTA 4IY1A 1QIIA 1W0KA 2Q6KA 4HTFB 4RTSA 3LQKA 3V80A 4P8RA 1T4MA 1W8DA 4V2UA 3EH2A 5TQ2A 1UM9B 4OD0A 2G0TA 221PA 2GI4A 4RTMA 1DKLA 2ZJOA 2E1PA 2R65A 2WV7A 1AKUA 1F06A 1T3SA 5AVSA 1KI6A 4KX5A 5I48A 5K9ZA 2O7SA 5GV7A 2ZI7A 2DWOA 2RJ3A 1NVDA 1XQVA 4G0NA 2QAGC 3VOSA 1F12A 1OX4A 1H8ED 1U81A 3V3KA 2QMQA 2DUMA 2XKJE 4KO8A 4GC5A 1SBYA 2OUKA 1JR3E 4JENA 2WG1A 1UZUA 4DQUA 1X1SA 4K88A 2FPSA 5JSYA 2C58A 2P4SA 3K8ZA 4GHWA 3HYSA 2YOFA 1SD1A 2OEPA 2FZLA 3HCAA 4XB2A 1MO4A 4P31A 1B3RA 4IOJA 4N5LA 3I4CA 2ZE7A 4RIGA 2ZDGA 5F51A 2C84A 4CIXA 1C9MA 4W7HA 2WF7A 2XMRA 4F1KA 2O23A 5KINB 2ISQA 4TSRA 1RKUA 2ZTUA 1G4HA 3L0DA 1HZZC 3TBHA 3W04A 3WDSA 3VU9B 3WJ2A 4BX9A 3QQ5A 1E79D 1G7SA 1KR5A 2VZ9A 5DN9A 3JZAA 5AW6A 3WYBA 1GAWA 4URHA 1FMCA 1PD0A 3AL2A 4PFQA 1HOXA 2FG6C 2X9VA 3O84A 4JT8A 4TLCA 1JJBA 2VAVA 1ZNZA 4TKMA 5JRZA 1ESNA 2B7BA 2H3HA 5HKOA 1IEXA 4OI0A 2CBXA 4UQLA 2CK3A 1VPWA 3AGQA 4F8EA 1ZXBA 4QGGA 2YWRA 1WMDA 1JQEA 3MA0A 5T64A 3WHKA 1A72A 2D5IA 3PJRA 1U0GA 3SICE 1M67A 1RADA 3F5SA 3FPHA 3B82A 1XZIA 1ZBQA 4P36A 4FDAA 1MO6A 1Y1PA 4H27A 3QPAA 3COZA 1PF7E 3IT1A 4QM6A 3AXTA 2MCFA 3DAOA 2GPNA 4NG4A 5CCBA 3IQFA 1RAIA 4K8RB 2WIDA 1V3TA 4IIUA 5AW4A 1YQGA 1U2DC 1ZN2A 2DQZA 2Q3EA 4IJMA 4UC0A 3BFKA 1YB2A 2PMWB 1I4OA 3E9DA 2LIVA 1SG9A 3P9SA 4RJ2A 3KLPX 3UUEA 3MGAA 1CZHA 1G8MA 4EKNB 3OC6A 3K20A 2H2DA 4KQCA 5SY9A 3N2EA 4BLVA 1ADBA 4I6EA 2FMHA 2FE4A 4C20A 1P5RA 4Z0HO 1KEEB 2DHRA 1WHSB 4W5RA 2FSIA 4KJXA 2ODPA 2I8LA 3HJFA 4LDZA 4MQ5A 3NQ41 4QRHA 5DTEA 3U31A 3ONEA 1CY1A 1MJ5A 2NG1A 3DV2A 3SEZA 2V5AA 4EX6A 2PZ8A 4UTRA 3EXHC 2JW5A 3K0KA 1DG1G 1HR0B 1NQXA 4K86A 2JASA 4JX8A 3MFQA 4UASA 4EG6A 4AIRA 2HMUA 3T7KA 2IUSA 2WJ4A 4LC9A 1CLUA 1Y4SA 3RTGA 2VJCA 2UV8A 3FETA 4MUFA 4P58A 5G40A 2CC2A 2AVNA 4GXTA 3K2IA 4RM2A 5AQ1A 4ZI3A 2EZ9A 2QXUA 2XT9A 1RSZA 1GQFA 3DFUA 1EFRA 2DSTA 1I1NA 3GA0A 4HP8A 4RK7A 1EUCA 1WUHS 5LP6C 5LZ7A 4WNIA 1G6OA 3OJXA 4PTZA 3SR4A 2D2EA 2JFVA 3A9VA 2A9PA 4EA8A 4ZEWA 1N2JA 1WEHA 1UWLA 4OF4A 2EV9A 2Z2XA 2HLNA 1H3FA 1ZQ9A 4J16A 3PEFA 3PL5A 3HCCA 1MH1A 1S8FA 3KHSA 1VYHA 4HWGA 2XH8A 2QL9A 3AI3A 4IH4A 5C7IO 5JIBA 5KPJA 2GPAA 3CVYA 2VWQA 3ENVA 4OI1A 2X7HA 3OWHA 3AF0A 2O3QA 3DKPA 4ZQEA 4Z4HA 1J70A 2ORYA 1A5AB 2FE1A 2A88A 3T9EA 1N2SA 3ZUPA 1Z88A 4S0XA 4M0UA 4C1BA 4C0AC 3UMMA 1MJNA 4EQZA 3IH5A 1EJBA 1OKKA 5AKKA 4KOEC 4H7FA 2CLKB 5ED0A 1U1EA 5CAEA 1JG7A 3CW2A 4MRNA 4D6YA 3GH3A 3ZTYA 4A6XA 4BE7B 2OV1A 4HATA 1JPNA 1WDTA 4NYIQ 3WV4A 3CZQA 1VE7A 3JQQA 2OFOA 4RVCA 3LP8A 4BQPA 1WETA 1QVAA 2XJ4A 5EXSA 2BKEA 5CFPA 1N2EA 2P1ZA 3EA0A 2J6IA 4PAOA 4N5MA 4IEIA 2XR1A 1Q12A 1U6KA 2YN2A 3O73A 3I4LA 4MROA 4EHBA 2R6JA 3NWOA 3ANSA 4KFRA 3W78A 2UXDB 2JAQA 2PRSA 4HLQB 4MCHA 1Z0JA 4NKRA 2XAAA 2FHPA 2HJWA 4HPXB 3VPCA 3UJPA 1FB5A 4PRKA 2O5RA 3BIJA 4EL5A 2GNPA 4LMBA 4P32A 4PX2A 4KC0A 4R1QA 1R0XA 4ZRMA 4EPTA 5ITWA 2XZOA 4R6WA 1R00A 4ZRNA 3K96A 5CVJA 4PCVA 3GBPA 1Q0ZA 1UPAA 3IC5A 5D00A 1GFZA 2Z5GA 3O4JA 1BRMA 4A03A 1JKJB 3JWGA 3UMRA 4K6KA 4JUIA 4D8XA 5JXJA 2C4TA 2J9FB 1SR8A 2Z4SA 1QH8A 2C07A 2VDUE 2AMYA 3Q6IA 4TM8A 1SCAA 3A25A 3DCIA 4XFJA 4REQA 2HL6A 1DQNA 1YOVA 2WU8A 1TLTA 2NT3A 1QVWA 4GLLA 4GRAA 1LLCA 3I6IA 3EZ9A 4HN2A 4RC9A 3ZWWA 5FL3A 1SXJB 1JDSA 4RADA 3ZGLA 1A2BA 1LH0A 1U04A 1XHLA 1JA0A 2W6IA 3CPSA 3LTEA 2VOJA 2GRAA 4TKUB 1CEEA 1TIPA 3OM0A 1P2GA 4BMSA 3ICQB 3EGWA 4DDUA 4N3GA 3A36A 4ISCA 3CVXA 1XKTA 3PNLA 4JN6B 1LBSA 5C8YA 5HK9A 4RLQA 3T99A 3MTGA 3PNOA 2EHJA 1L1FA 2XXJA 3DZDA 4G24A 1JL3A 3G0CA 3RJ9A 2W5UA 1B8NA 4XX0A 1U9ZA 3GZNB 4URWR 1N3LA 1OD6A 2ECOA 4E7OA 1UH5A 5CT5A 4GO1A 1W73A 3V5NA 2X15A 5KYGA 1E0JA 2BF7A 1C81A 4BNWA 2VJLA 4WGFA 1G4AE 3HMQA 3BSSA 4BB0A 4PG8A 5JZVA 1C3JA 4JLKA 1E4OA 2P4UA 3EVNA 4TV8A 1IVYA 4RD2A 2WVHA 2NXJA 4EJMA 3K16A 4EL0A 3JYLA 4E4RA 5E3JA 4M7OA 4W5NA 3I1JA 4RKRA 2IP2A 1XMVA 5ECWA 1ZOSA 4FE4A 3BSFA 4GUDA 3T1QA 4V1CB 3DPSA 3E35A 3LO8A 2IHTA 2FFJA 2J41A 5HKKA 5IMSA 1ZC4A 4L2IA 2PUAA 3UKOA 1F0KA 1Y33E 1GNSA 3WLJA 4D26A 1DIHA 4KG7A 1GTSA 4X54A 1ZI6A 2FZWA 1L4NA 2QSZA 2G28A 2QTLA 2XGMA 3VR4H 2HJ9A 3E18A 1TRHA 2ETVA 3KFVA 4K81B 5ALJA 3TLKA 3ZIUA 5JZMA 4CEIA 2YJZA 1GILA 4PPNA 1UJBA 3LGXA 5C4IA 3QVJA 3BMNB 4AKIA 4RNCA 3LX6A 4E3ZA 1CJCA 1SVSA 3O93A 4KITB 4Y6LA 3JXEA 4IS2A 5C81A 1X8LA 3VTAA 5GZ1A 2NZ8A 1FS5A 2NW6A 3SYMA 1Q15A 4EMSA 5A0TA 2XA9A 5CT8A 4GX5A 3O3CA 4PIMA 1LNQA 2XRMA 3W0LB 1R5NA 4LF5B 4EY6A 4Z4GA 1WXFA 3K6JA 4PEVA 1EFTA 1Y6QA 4G1VA 1AQLA 2Y1OA 4QU0A 1VG9B 4P80A 4FWIB 3F6CA 4I1UA 4X93A 1NSYA 4RUKA 3INYA 2WHYA 1BXGB 1XEWX 1YCFA 3KWJA 3OM9A 1I0LA 2XPCA 3L4BC 1UIMA 4LOAA 2XUJA 4Y2RA 3JQAA 1GPJA 1Y8AA 2CFIA 3UH0A 2AN5A 1D1TA 2BFFA 3RJTA 3SSNA 4R5HA 4JITA 3QYJA 5TV2A 2VBFA 1RU3A 1NR7A 2GCNA 1WXHA 1S8OA 1Z0KA 3MBOA 5BO5A 3HBAA 3L9XA 4DWOA 1IZ0A 2D2VA 5EUMA 1E92A 4UHDA 3L04A 3M4ZA 1QP0A 1NM5C 1P9RA 2F4VB 2AK3A 3K0SA 5T4EA 2P65A 4BEJA 4RCVA 1UMCA 3KR1A 4LHVA 5J63A 5A2GA 3PKZA 3BXZA 5KZMB 2RFLA 1KJWA 3ZE2B 4KODA 3PHCA 4HRXA 2D0PB 2OCBA 1T3TA 4BPBA 4H6XA 3D6MA 1U3VA 2BHLA 2OO7A 3HJUA 1NXTA 4UW9A 5DRYA 2IUUA 2PS1A 5GOTA 4EZIA 2JLVA 1T9BA 1D1SA 3NORA 3QVGB 1SH7A 4O1IA 4TKVA 3USZA 4A10A 2SHKA 4JOBA 4COOA 1KGDA 1Z37A 2VDQB 3CUKA 4E6EA 3TXAA 1OI2A 1C1DA 1ZO8A 3HYNA 4JVSB 3SXUA 3IBFA 3T1HB 4LWQA 2GGSA 1XA0A 2J5QA 3BTSA 1XTBA 5EMHA 4MNTA 3R8FA 3I5UA 3LUJA 2R1UA 2PVSA 2WIFA 1ZESA 1JT9A 4LZJA 4O4HB 1Q95A 2J3LA 4CR8A 4UDYX 5JROA 4D43A 3FGNA 2QTCA 3TPCA 3UGQA 5KWEA 4ZMRA 3HXOA 1EK6A 2Z2YA 3SAJA 1PSDA 3K72B 3ASZA 4IPTA 3ZQUA 4KH1A 3B70A 2DFTA 2G5GX 3CEAA 1B42A 4WK6A 2ZUEA 1ZAKA 1VKNA 4QNNA 3MILA 1GWNA 4CZ2A 4XJXA 4HZIA 3P2OA 2GYUA 5BVHB 1GFSA 1BW9A 2CJXA 2HRBA 4LOHA 4PG4A 5AHXA 4ESEA 5F1PA 3ZNNA 4HQRA 1MZVA 4QRDA 1MN6A 4QSHA 4QJ4A 2C2KA 1BZYA 1ENOA 2HEGA 3DLCA 4N7JA 1L7MA 1JG6A 2V58A 4KBYA 4ZQHA 3TIGA 1EP2B 1M8JA 3UXHA 5IJ0A 2NMVA 1NW8A 1IJFA 1PL8A 4MAAA 1J8MF 4YAUA 5CLLA 2VXYA 2KLHA 2FLWA 1VSVA 1FFSA 1AS0A 4C21A 4J0DA 2HLPA 4I4TB 3MCAA 5AESA 3HCPA 2J67A 1ZOLA 4QU9A 3KALA 1VJGA 1TAHA 5K6AC 1JI0A 3EE6A 2EDCA 2IRWA 2O9JA 4HR7A 4MWGA 4ENTA 2DERA 1BYIA 1FFGA 4PZAA 4E2WA 1R0LA 4F45A 3AFHA 3K5HA 4FX2A 4KHPB 3QEMA 4NH0A 4MGYR 3BWEA 1JQ5A 3G9TA 5P8WA 2EDAA 3H9UA 3O3NB 2R87A 2YXLA 2J3EA 5B1HA 2C9MA 4QDZA 1OGIA 4IILA 5DJ5A 3SSMA 3IEIA 3JX9A 2Y4NA 2YVKA 5JXHA 2DT5A 4E0BA 2JLBA 3B20A 4FU0A 4R7ZA 5DSZA 4AUNA 1YZKA 2DULA 2JFWA 3NFYA 1KXJA 1ZH4A 3QHQA 1YZ3A 5B1YA 2QZ9A 1B0AA 4AT1A 5FNZA 4YJ3A 4LZPA 1BVRA 1IBLB 2BCEA 2YWDA 4Z49A 3IPAA 1UIRA 1IBKB 2PWAA 3KB6A 3KIPA 4GI2A 2J7PA 2Y1CA 2COEA 3TB6A 2I4LA 2R6GA 2RHJA 3EEYA 4FD2A 3TCXB 2MSNA 1W5FA 1EFLA 4BIIA 3ZQ4A 1ZR4A 1E7QA 2P5SA 4UBLA 4Z0PA 2VIIA 5H82A 3K2BA 2A0FA 2NACA 4FUTA 3VVCA 5IM4A 1JWLA 5IW8A 2FVXA 4TSFD 4LUCA 1NW5A 2OAGA 2WYOA 4N8EA 5FPQA 2OO3A 5JQGA 1RTKA 3DTTA 2IGTA 1VJ5A 3VMFA 1EDDA 1L2TA 1BVHA 3D4LA 4IDGA 2JK1A 8AT1A 1KQFA 3TAXA 3Q98A 1PLLA 4G07A 4QQKA 2GTIA 3ORYA 4OPMA 1FZQA 2I4MA 3HJHA 1E59A 3UJ9A 4DIEA 4HS9A 3NEAA 5BW5A 1I3CA 2R0QC 4R1UA 3H5NA 3M5WA 2XMZA 1XTUA 4NVRA 2WOOA 1R9GA 1V95A 1W5TA 1XCOA 2N75A 1LPNA 1LWOA 1CUEA 2NU9A 2P2LA 2SBTA 2QL7A 2QTRA 1A2QA 1KS9A 1UOQA 3ABRB 3I9V1 3TDKA 1A4RA 1I5OA 1EX1A 1V6AA 3EXIA 4CHGA 3EG5A 2JFOA 5AKXA 3DL2A 1QGDA 3ETCA 1U0OC 4NE7A 3KWFA 3TRFA 1UADA 3L79A 5BV8A 1AE1A 1UEXC 1GU7A 2QRVB 2X2OA 3DM5A 2HREA 2DB3A 3V8PA 2H1VA 5IKPA 1RPAA 1KVUA 2FZVA 3EHEA 2AXQA 2O14A 2Z0MA 5SICE 3ZBQA 3CZ5A 2D1TA 2ZWAA 1BWPA 3T9BA 3LH5A 5LXTA 3RBXA 4DE5A 3L1VA 4TWJA 3COVA 4F72A 2VHQA 4G2NA 3SP1A 1TU4A 2XQGA 3MWGA 3OQVA 1KJYA 2W0MA 4LX0A 5HYVA 1T3GA 3DMFA 4NG5A 4H7JA 3L8EA 1I24A 3KJNA 4OEHA 5LUBA 4Z1OA 2O8FA 3P94A 3AJEA 2COKA 3TOSA 1IOZA 2DVMA 4FCVA 2CXOA 4IF6A 4ZC8A 1WDMA 2A35A 5JRDS 1TYCA 1Y80A 1YI8A 1LQ2A 3CM0A 3GN2A 4QUEA 4DC1A 2ZATA 1TZJA 4OLBA 1JH9A 4F93B 3AKEA 1R4NB 4B2YA 5AVTA 5FH9A 3LDHA 2CDAA 3DSRA 5AK0A 5FOVA 2C5SA 2FLVA 2NUAB 3WJ7A 5TR9A 2ZT8A 2P0AA 4TVOA 3NYQA 4FYXA 4MS4A 2QN2A 3UKDA 4JC8A 4YLGA 3U3MA 4CTJA 1ZA2A 2VP6A 4KGDA 4CI9A 3JW8A 3T5GA 2FWBA 1ZM3A 4MCIA 3OOEA 3GVPA 2X8JA 4RY8A 3S27A 2P3SA 4RMHA 3O8RA 1WY7A 4K9RA 5HZGA 1O96B 2GXQA 1P5ZB 3KLBA 3OCCA 3PFFA 3W2FA 4LF8B 1QCDA 1GEGA 1YRYE 1G7CA 1PT5A 2PJUA 4ZV4A 4OQZA 3HABA 4QOHA 4A8JB 1QYVA 1VXOA 2ZJZA 3D8BA 3DZBA 4B3RB 2F8MA 3OTWA 5H1YA 2PUWA 1J2EA 1K0UA 1V9LA 3PVSA 1LDEA 4JLUA 6REQA 4CXMA 3TBKA 2WTXA 3EGIA 1BN7A 1NPTO 4XGQA 4PC7A 5JATA 1VRCA 1RM5A 3FDXA 3IIJA 4IZHA 1DEKA 1VA5A 2H16A 4K6HA 3ZNPA 2PPLA 1NN0A 2ZYHA 2GN0A 1B43A 4F2DA 5I7SA 3LBYA 3FPAA 4F3CA 1PZEA 4FHEA 3H9GA 1ZVVA 2DPMA 4R0MA 1DAIA 2C96A 4R0NA 1CCWA 3ZNOA 5DP1A 4NENA 2QR5A 1AZLA 3IAAA 4J90A 1Z06A 1NTRA 2XIJA 1JALA 3AILA 3LBFA 4PX3A 1NMXA 2AFHB 2QTGA 4O2BF 2Q8QA 4MIOA 3UHOA 4ALMA 4G23A 5TMDA 1JHRA 5J5AA 1N3IA 5CX1A 1B15A 3AP2A 4WLFA 2ASEA 3AFMA 4F5YA 2AX4A 2PA0A 4KVAA 1SXJC 3B2NA 3W5CA 3ZDDA 1XTKA 3NLLA 1NMSA 2E6KA 1I80A 3JVEA 4OL0A 2B8TA 4BRSA 2PFSA 1L5FA 2P9YA 1P9WA 1BU8A 4H15A 1BXRA 4W1RA 1N77A 3SZUA 1HNWB 3KETA 4FCTA 3NBXX 2ZB2A 1JHQA 3C3AA 7GPBA 1ZZEA 1Q1ZA 3F9CA 1EDZA 1H1LA 1W2WB 3M1AA 4S12A 3FNHA 1B6GA 4IVPA 3IT3A 5AVVA 1G38A 3KB1A 4BMPB 1A9OA