4ZYXA

Human gar transformylase in complex with gar and (s)-2-({4-[4-(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]-pyrimidin-6-yl)butyl]thiophene-2-carbonyl}amino)pentanedioic acid (agf117)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trifunctional purine biosynthetic protein adenosine-3
publication title Structural and Enzymatic Analysis of Tumor-Targeted Antifolates That Inhibit Glycinamide Ribonucleotide Formyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 65
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4zyxA00
2BW0A 1ZLYA 1RBZA 3KCQA 4YFYA 4ZYZA 5J63A 1GARA 4ZYWA 1RBQA 5CJJA 2GARA 2BLNA 4PZUA 4ZYVA 4TS4A 1JKXA 4S1NA 1MEOA 3AUFA 4TTSA 3TQQA 1RC0A 2CFIA 1S3IA 3TQRA 3O1LA 1MENA 1YRWA 4Q12A 1C2TA 1ZLXA 1GRCA 1CDDA 1MEJA 3R8XA 1NJSA 1RBMA 3N0VA 1C3EA 1RBYA 3P9XA 4ZYTA 3LOUA 3DA8A 1CDEA 4ZZ0A 1FMTA 3AV3A 4EW1A 3NRBA 4DS3A 4EW3A 3DCJA 4ZZ1A 4ZZ2A 3W7BA 4YFVA 4IQFA 3Q0IA 4EW2A 4NV1A 1RC1A 1ZGHA 2YWRA 4ZYYA 4ZYUA 4QPDA 5J9FA 2FMTA 4R8VA 3OBIA 4ZYXA 3GARA 4TT8A 4ZZ3A 4QPCA
chains in the Genus database with same CATH superfamily
5LJIA 4KO3S 1N6KA 2VTBA 4FVTA 4N9WA 1S5PA 3I04M 4K8OA 3TTYA 1SBNE 1E5DA 1YCGA 5DTRA 4QTZA 5CYPA 2H00A 2HQOA 1KMCA 1JWLA 1TVKA 1CUGA 2CHGA 1R8XA 2PH5A 2IK8A 4ZOEA 5DHFA 3UJBA 4QBFA 5FH9A 3KFXA 1I33A 3F3KA 3UQYS 1WXQA 3T9FA 1G17A 1B3RA 2QV0A 5TDHA 1N2JA 3M34A 3QFRA 4BMOB 2AEMA 3PNVA 4LTMA 3ENZA 4C1NA 4WESA 3VU9A 3C5EA 4R9NA 4KQKA 1R8QA 4NENB 5LMZA 1YNSA 2IEDA 3B51X 4A0RA 1QVAA 2HI0A 3ZBPA 1U0JA 3U7RA 3WLRA 4XOIA 1C8KA 5C8YB 2BEUB 5AH0A 1TM2A 2LW7A 2BJVA 5ES3A 3ENNA 3IDAA 3WGOA 3GF4A 5P8WA 2CLMB 3ZDZB 4BVJA 1V25A 4RPGA 3KZKA 3ZIAA 1Z4PX 4YUWA 2P9TA 2G5GX 4U6SA 2F43A 3C70A 3PPYA 4MR9B 5G53C 3FPSA 3E15A 4D26A 1IXZA 5AUNB 1KEZA 3R6WA 2I9KA 1VP3A 1KS2A 1TMKA 1G2IA 4CMGA 1GN9A 5IKOA 1T3SA 5IYZA 3Q3JB 5C34B 5DM70 4QUDA 5IZCA 1EVQA 3J80A 4DPMA 5DHPA 2X1VA 4RU1A 3GQBA 4UU1A 4KXQA 3N0VA 1TQ4A 4IQ0A 2WC1A 3AP1A 3V8NA 4GOJA 2HC9A 1JA1A 1UBSB 1XI2A 3QWBA 4C9BA 1J9ZA 1VL2A 2VXYA 1RKVA 1YR6A 4MYTA 1GGHA 3T52A 4EFNA 4CIDA 4D8TA 4S04A 3W5AA 3HVUA 3LCCA 5I8WA 2P6RA 4RHEA 1MGPA 1P0QA 1AB5A 2FPGA 2ZWOA 2R8XA 4IUBS 5CA1A 5A2QA 1TIBA 5AP9A 3ITNA 4D2IA 3KSDO 4LXXA 3HE3A 2GBCA 1T24A 4QJ5A 4XGKA 2XXJA 2OLEA 4IGIA 2FHPA 4CGZA 5FI3A 1JP7A 3QENA 1IXSB 4ZZ2A 1W75A 3FLEA 3F6PA 1JU3A 2L19A 3MG9A 3SU8A 4QICA 5F64A 2WMDA 2WZDA 4X7RA 5I8ZA 4ISCA 1VE7A 4GI1A 4LOJA 5ER6A 2C31A 2DTXA 4JGBA 5FL3A 2Y1CA 4TLBA 3AUAA 2I3DA 4ZEWA 3EPKA 2P3OA 1XTPA 3K9CA 2WFLB 3ROQA 3ENQA 3GEHA 4JOCA 4XZ3A 1Z22A 2WFLA 4LK3A 2PRSA 2ODQA 3QEJA 1LX6A 4XB1A 4R51A 4YR7A 4U7FA 2PGLA 1FEZA 1REQA 4RHYA 1V96A 2P9HA 3D6JA 1M1ZA 2HK7A 3LT0A 5C8YF 1XU7A 1G4HA 1WZCA 1UT6A 4PO3X 4LYJA 4XVHA 2LTAA 3ZGZA 4B4VA 5PNTA 3EIQA 3HEMA 2O23A 3F47A 2FVYA 4M86A 4MITA 3WISA 4AS2A 1FNDA 4EA7A 1Y5LA 5I5GA 3VDMA 1SCJA 3NBKA 3YASA 4YAUA 3Q5GA 4EO4A 4AKHA 1NUUA 2IEBA 2VQDA 2W2QA 2AR9A 3IAEA 3PWZA 4MYDA 4R9SA 4Q1DA 2EG9A 2AEFA 2JIOA 3D02A 1VGVA 3GRCA 4WERA 1M1XB 1ISGA 1KZ7B 3DF7A 4I2VA 4K9NA 3REQB 4F3CA 5A5FA 3MQFA 4ARVA 3HYTA 5CP8A 4UU7A 1RBQA 3G7SA 5K09A 4LRWA 2LE0A 2ANBA 1B6RA 4QXMA 3MMXA 5DNYB 1GAJA 4E2WA 1BW9B 1VIYA 2OPBA 2XQGA 5COQA 5TGTA 4D46A 4ZYVA 2CVOA 4P9NA 1CUVA 1ZN8A 3VUFA 1GCAA 4G8DA 2D5IA 1R5OA 1IDN1 4WBSA 1R4AA 3T7DA 1I2CA 4EGFA 3U81A 1CZKA 3BWDD 2P9JA 1IHXA 5F7XA 2G09A 2IHZA 3DTNA 4LYGA 4X6YA 3PVZA 4WCFC 2KI5A 4BNZA 4KSCA 2DXIA 1E5QA 3ZCSA 1T9GR 1Z38A 1AHHA 2HRQA 4FNOA 4WECA 4BNIA 5BUSA 2PD3A 2OXFA 3LFUA 3DHNA 1RC0A 3ZWYA 4IZHA 4IJMA 5K4AA 4XEUA 3I2KA 4Y0VA 2RHRA 2G1KA 3UWPA 4DE5A 4CLOA 3A6PC 4BLQA 1NURA 3NB0A 4Z86A 1BD4A 5DISB 4WDQA 2HT6A 3MLBA 4GAEA 1RMQA 3GN2A 1IWPB 2VJCA 3N1UA 1UBGA 3LECA 1UWVA 1QTQA 2AKYA 5BWMA 2IBSA 3VKFA 1M2JA 1ES9A 2UZIR 4AXBA 1YB4A 3ZDQA 1CVLA 4BNMA 3AJ9A 4NXNB 2VLIA 2HGSA 2Z57A 5DYTA 3KFVA 5G3ZA 5CM9C 3M6MD 4CQNA 1PTJA 3MAJA 3EMVA 3F67A 2VVTA 1DDIA 3OY7A 2JDID 2FPMA 4FYVA 1OOEA 1U4NA 2GNPA 5IMSA 3TE7A 2GETA 4GT1A 1H4TA 4BZXA 1NGSA 1HDEA 1I9CA 2GOYA 4HAYA 4N0MA 4LSGA 4A82A 5JSUA 5LNK1 5A9RA 5F7ZA 4DM4A 1M34A 5KTPA 4BKMA 3I73A 4FZRA 4XR4A 5DIFA 3K16A 2HCJB 2WMYA 5CG2A 5JQGA 1QV9A 5IDWA 3GZ4A 3FCCA 1U65A 3UN1A 1MB2A 1VRVA 5E3HA 4KN6A 1E5LA 4E4YA 2FPSA 5DP1A 1UM9B 2P41A 1SUBA 1WZNA 2WSSD 3I0ZA 4PTLA 3TNYA 3UHFA 3DFFA 1ADJA 4IWNA 4C0LA 1NV9A 3M6AA 3NETA 4IQFA 1YOVA 2BBWA 3UFXB 1QRSA 1JGTA 3L6BA 1NAIA 1KO1A 2ZRNA 1NG1A 1AA9A 3D6NB 4UDOA 4DCMA 5HQ3B 4YDHB 4RABA 2H4FA 3ML1A 4GX0A 4ETNA 2ZJFA 2J9GA 3TZHA 3C8HA 3N7TA 3U0VA 1LSUA 2M6RA 2GPWA 2VXCA 4FDMA 3O8BA 5F5NA 2EQBA 5JS2A 4CZ2A 2XMDA 1YKFA 4HWSA 2Z09A 1ZITA 4U7GA 2B8JA 1T2CA 1ZI8A 3E23A 1M8GA 3BB4A 4FYPA 4CG0A 4UAUA 1EMDA 4UTVA 5KOHB 1IJKA 1YVPA 4QOJA 1A2KC 1AGPA 2EOAA 4IZIA 2GD1O 3KJNA 4MMZB 4MWDA 1HE3A 4O1HA 4DJDC 5I7VA 1IDOA 1KXJA 2CL6X 2CXXA 1F17A 1K3UB 2NYUA 2ZVPX 3RV4A 4EEZA 1AHPA 1SCAA 3H6GA 3C41J 2GPTA 3H1GA 4FS8A 1QQ7A 1QWOA 2P4SA 4RXMA 4TTVA 1Z2PX 1XMQB 3KB1A 4KR2A 1Z4NA 1ZVKA 1GUFA 3DWIA 3EIHA 1JLMA 2RAPA 1XU9A 5CXSA 2EHDA 3ISVA 3EIOA 3C1UA 3HCBA 1DMSA 3F9CA 3V80A 3WKBA 4D4KA 5HWSA 2RJOA 3QU9A 5EZYB 1QE5A 2IEZA 4AUEA 3UWKA 4OBEA 6YASA 1SCDA 3D0OA 1EQAA 4OHBA 4HNRA 2JD1A 5BVGA 1KFBB 2ZBEA 1SIWA 1KK3A 2QTMA 4DT1B 4II3A 2H1IA 3MWDA 5JQWA 4S1NA 1J33A 2A8YA 5IVKA 1ZW1A 1YE5A 4HNHA 2BFAA 1JDJA 3M5CA 4FFPA 2I1VB 3W8EA 5FA6A 5B7GA 4JNKA 2NX2A 1WMBA 4W8HA 4BO8A 4EJFA 3O4JA 2CVQA 4CG1A 1JHXA 1B15A 4WGFA 2PZFA 1QP8A 1OJ7A 1QHGA 2XQJA 3KO8A 4YRKA 1YSCA 4IJVA 2ZYUX 4DNOA 5HP4A 3DXFA 1H2HA 2NSDA 1C9EA 5LQAA 3OFJA 1TUEA 1L5YA 1N0HA 2BCEA 4IGKA 4A5OA 1T9DA 4NSNA 2ZI9A 3IBFA 3ZPXA 5CXQA 5TVGA 1T0BA 4K9RA 3VYWA 1TJYA 2ZCJA 4DUGA 1GTZA 1KJIA 1YDEA 1ZL2A 3WVNA 4DQDA 3LAWA 5TPWB 5MGBA 1NQVA 3NP9A 2OHIA 1DAPA 2QD1A 4A5SA 3WYEA 1M6VB 5BWNA 2D06A 4ZGGA 3NONA 1EWTA 5KYXB 1MT3A 1G5TA 2CCGA 4A8HA 4Y9TA 3PENA 4M0UA 4P53A 1JIQA 3NHZA 1DXOA 3RTCA 2ATXA 3PGMA 2K7FA 3WLSA 5IJZA 3WLQA 2A92A 1OW3B 3DOIA 2Q5EA 2YQ5A 4ZZIA 4GUDA 1A2BA 3PHBE 4OI4A 4XYLA 5A4MS 5C4MA 4BMYA 5TARA 5IXSA 1NW7A 1QO7A 3RS9A 4FFWA 3FI9A 2YJ5A 1UC8A 4ZAVA 1TM1E 3HB7A 4BECA 3IH5A 1XAGA 4C4OA 4TRNA 3SEQA 3I3SR 1EB8A 4RY0A 2BR4A 1NRIA 1CIPA 3ESAA 3HBLA 1NYLA 2QTRA 4TLMB 5KHAA 4BO6A 4EHNA 2A9OA 3HJBA 3OQIB 4R8LA 3K20A 1CZRA 4E3WA 3OQIA 1G6KA 3H1FA 2NUPA 2NMVA 1H5NA 3GNLA 5LP6C 3CKLA 3KQYA 4JVSB 4OQMA 1P44A 2J1LA 2VSFA 3HA2A 3TSAA 1QFMA 4CMEA 4CCSA 4Q48A 3VR5A 4Q5IA 3RRMA 3QBJA 3RC7A 1RJ9A 2EF0A 4GPZA 2W6ID 3RRBA 1J0BA 3AIIA 5FEUA 3JYLA 2HB6A 2LNDA 2ZT8A 4EECA 2P27A 1YU6A 4PZCA 1Y1LA 1RT9A 1Z7YA 1Z8NA 1CC1S 2W8BB 3NZEA 2DUWA 1CK4A 2PBLA 4XSGA 2A1UA 2BW0A 2BV3A 2INGX 2OMKA 3DS8A 2IDMA 2NP6A 4UHKA 4MLZA 4G0ZA 3JSAA 4QBHA 3IAHA 4B9EA 3D4PA 2OYSA 3ZTTA 1EUQA 3DXZA 9LDBA 2JLVA 5D3QA 2W6OA 2ZIAA 4H1HA 4D9BA 2F59A 3CE9A 2VP0A 3N8KA 1F2TA 1A4XA 1YE8A 4UJ5A 2P4HX 3RD5A 3WC4A 1UT5A 4MQFB 2HMUA 2ZI5A 2DB3A 5TQ2B 1TF5A 5ARBA 1M2VA 1Q7EA 1YJXA 5B6IA 5BSEA 3O4HA 1PJSA 4G2TA 1BXGB 1JZQA 3PICA 3RGWS 4ZFNA 1NONA 1KYZA 2XQFA 1FLNA 1YJ8A 2IT1A 3GHHA 2Q3FA 2O1SA 2YICA 2W2TA 2YHSA 1VL1A 2XE7A 1E1LA 3MTJA 2QTNA 4AO8A 4RQUA 1X3SA 3GJTA 3TLMA 4ID3A 1IEQA 1HYBA 1SHKA 3L77A 3JZAA 4FCVA 3RABA 4WLVA 3UK7A 1CUEA 4FYKA 2XXAB 4JLAA 4EB8A 3AVYA 4ESVA 5K20A 2EP7A 4MW9A 5HM6A 4Z4IA 3VNUA 1KSHA 3IJEB 3PS9A 4QECA 4OXYA 4TMVA 3EVDA 3ZKAA 5A5EA 3HB1A 5LD2C 5KMGB 1R88A 4XFDA 1M2HA 1O94D 2O8NA 3CVJA 4B43A 3LWNA 3B1KA 3WRYC 4PCLA 2FP3A 2LXNA 4F38A 4B3GA 4IDEA 4MXDA 2IYAA 3N0WA 4CKCB 2OFXA 1M6EX 1JHUA 2XCIA 3MMSA 3OIGA 4KCGA 1NUTA 4WT7A 1Y48E 3R3UA 3VPGA 2PJRA 1B00A 2N1MA 4M2LA 4HB3A 1PG0A 4H16A 2NSJA 2X0KA 4ZAGA 1IJFA 4OAOA 3HJNA 4RY8A 4W9NA 3L05A 2PXAA 3BH7A 4GECA 4H4CA 1XCOA 2L82A 3NRCA 2XCQA 4AKGA 1UK9A 3JQAA 1BE1A 4ML3A 3A6DA 1JAXA 2O05A 2VS1A 3EGVA 4XWAA 2BFOA 4RZHA 4NESA 3U37A 2JRCA 2FB9A 1I4OA 2C29D 1F8FA 3O2SB 3EVCA 4GPBA 1MBZA 1J6UA 3IO3A 3ZGXA 5JRJA 2EATA 3LD9A 3KOXA 2FEKA 2W2KB 1TJ3A 2BVNA 1WZIA 2W2KA 1DKQA 4QGFA 5FUQA 2CD7A 4LJYA 3I2FA 3DFZA 3KOZA 4QOGA 1BX1A 1CT9A 1ORHA 2YW9A 4GR9A 4RPLA 4U2CA 4GWLA 5BURA 2WNHA 5K8IA 2XGJA 1AO3A 1RM5A 1XYGA 3LQ2A 4Y8VA 1ZJWA 1YQTA 3R7DA 8LDHA 3BE8A 2XUJA 3T9EA 1E98A 2BZSA 4V0ME 1PD1A 3INRA 4I8XA 4NH0A 3WLLA 4YRQA 1PVVA 3C3WA 1TLTA 3AESB 2DUUA 2YIMA 3UYKA 1JBQA 3AESA 4TZTA 2O1EA 5KHLB 1T3LA 1HZJA 2QHXA 3NAQA 4JB2A 3UM9A 4ENVA 2BFFA 1M0SA 2HCBA 4FJ2A 9GPBA 3M6LA 2QG4A 2VSQA 3EZLA 3W3AA 4RGQA 2ZRAA 3K92A 5KWEA 3CZCA 3FDJA 2W2LA 4PX3A 4RUKA 3PQ2A 4RTKA 4UCXA 1IN8A 1Z4IA 4ME6A 5FWXB 5JMOA 1D8TA 1KEEA 4CWAA 1Q0TA 4XVRA 2Z5LA 1KRHA 1WQ1R 4HGYA 4OGWA 3KZOA 4WFKA 4D0NA 3PQ7A 3SYMA 1KBOA 4NDNE 1DUIA 1PYDA 2QUIA 4O0MA 4WLNA 1HE5A 2P69A 2Q3LA 1WCXA 3C74A 3W6UA 3L7DA 4ZOLB 3MFQA 5HRCA 2G07A 3ED5A 4FC7A 4K1XA 2FUKA 3ET4A 3OTWA 1GRQA 4ITVA 3RKUA 7MDHA 5JPDA 5IS2A 3BXPA 4FGKA 3DE7X 4OVKA 4LMAA 4PO8A 1A27A 5LUBA 5AVRA 1M1YE 4PGGA 1OH7A 2CDBA 2OD7A 5EESA 2VEDA 3J7TA 4L3WA 4PG8A 4CIAA 1PUJA 1A8IA 1QRDA 3D2AA 5DSTA 4WOCA 3QPVA 5IT4A 2DQ4A 4FIZA 2O0HA 1B1CA 1I30A 3TW0A 1W96A 4PQYA 5CVJA 1I1NA 2GRAA 1GLNA 5EYPA 1AQYA 3OWXA 5I9BA 3ZHZA 5JSQA 5AKZA 2O5CA 2ZWVA 2K4MA 2VHEA 2XA1A 3L1UA 1MG5A 3ECCA 4WXHA 1PQ4A 2V7QA 4DQVA 1RACA 5JNTA 4GS5A 1NMZA 4M46A 2WZBA 3IX7A 4BB0A 4D41A 2FOLA 5LOVF 3MB5A 4MH0R 2YWXA 5HFNA 4UM9B 3W06A 1E6WA 3T3OA 2CLSA 1OLSA 1SC1A 3KKKA 1K89A 1SC9A 1Y7TA 4WBXC 3RIHA 3MNFA 2ODPA 1ULHA 4LHSA 4E11A 1GPLA 4KGVA 3FFXA 5E1MA 1G7RA 1KBZA 1SVMA 1TUGA 4M4SA 4QAQA 3N0XA 4WOKA 1JB9A 4R2JA 4K3VA 1IM5A 2B3DA 2FR1A 3IHLA 3RFCA 3RFFA 4QU8A 2I4TA 1VJ5A 2GK4A 2Y1WA 1CUWA 4UZEA 4RETA 3AXTA 4KQEA 5BW6B 5A03A 3BB3A 2CWDA 1DWUA 4I46A 3MMNA 1V8FA 4A0FA 1IXKA 2HO4A 2WNSA 4MVJA 2IHYA 2HA3A 1AKNA 4MUKA 5BNZA 3ETLA 3KSZO 5KAMA 5CR9A 2G8LA 4GKKB 2IV3A 3AY7A 1VC2A 1VQ1A 2QOEA 3GMSA 4R40A 3NYQA 4UM5A 4QPNA 4Y2GA 5CT5A 4GR4A 1XKLA 3KQNA 2V1UA 5DYYA 5AW0A 1E3TA 1SFRA 1UFOA 1V11A 2GA8A 3CXRA 3OT4A 5ALVA 2ZUBA 3CIFA 4S2EA 4YP0A 1IBLB 1JU9A 3KPYA 2E3JA 2D0PB 3DUFB 4H27A 4B4OA 3ZN2A 1UK7A 4IIYA 1DFIA 2IV2X 4PEVA 4URZR 2I1QA 1X1SA 1I14A 2QYSA 3K8QA 5KYVA 4BX3A 4BZWA 3SBXA 3UNXA 1NY5A 3RYHA 1SD1A 4ZOLF 1RJWA 5AXAA 1G8FA 2P2NA 4OUDA 3E1GA 4ZALA 4C89A 2VRCD 1E2BA 5DYNA 2AOXA 3PR2B 1OU4A 2OFWA 2ZJ4A 4PRYA 4IPTA 1C7EA 5CFOA 3PHHA 5H9WA 1XFAA 1VHQA 1XJQA 2SKCA 3HJHA 5AUPB 1XVUA 3W4IA 2GA9A 1N0VC 2XB4A 3FR8A 3IQZA 1OUMA 4N5HX 3ZYZA 5JARA 3EXHB 3HPRA 4TT8A 2FUCA 1N2HA 1UBEA 1EM6A 4QL3A 5I9MA 3VSAA 2X8WA 2C54A 3SM3A 2WNIA 5EE9A 4QNNA 4XARA 4ALNA 5KPDA 1M2OA 1N5KA 1JE0A 2YJZA 1IBRA 2I55A 1LBHA 1DLJA 2PX3A 1O77A 3H9BA 4HQLA 3AEKA 4L8LA 2HV8A 3IGFA 1WU7A 4G0QA 4U02A 4F5WA 5K6AC 5FOSA 1CIJA 2AJBA 4M0CA 4NU5A 3FTNA 3AOEC 1YBHA 3C3EA 4URHA 1RYZA 5IBRA 4UOEA 1KC1A 3NHYA 3CNOA 1MOPA 2Q7OE 1NX9A 4FSXA 2B78A 1A9YA 1TD1A 1XD8A 4J2HA 2EEZA 1YR7A 3BULA 2JZCA 3HZHA 1NM5A 1EYZA 2Q7DA 3DZFA 4IIUA 4PHCA 3S4YA 2D5AA 3RTEA 3SC6A 3SQDA 4E5MA 4LV6A 3TM4A 3Q2KA 2I91A 4PHFA 2ACKA 1HDGO 2CNNA 3PC3A 4KUHA 9ATCA 4P7KA 3S1SA 1AKYA 1CB0A 3ZCQA 1C9DB 3VYVA 2JLRA 3FZNA 3NM6B 3TOSA 3EZ2A 2X41A 3CKMA 1THGA 2J3LA 4I4TF 5DWDA 3N05A 5JZMA 3MELA 2E4WA 3JW8A 2Q5OA 3KAJA 1YL6A 2Y8EA 3E9QA 4KXNA 3TQQA 2WWGA 2GCNA 2XXBA 3T1VA 5ALEA 5LPNA 4M53A 1J1IA 4ZQGA 4ZJZA 3TDNA 1X7HA 4DMUB 4EJMA 2JBWA 3MAGA 4ZHSA 4HPXB 1NW6A 3DL7A 2V8BA 3TZBA 1U9JA 2XB9A 1QGYA 4DJTA 5LIRA 3MILA 3T1YB 1PWYE 4J16C 3Q2IA 3OTIA 3G6KA 4BQPA 5IC5A 1O0BA 1EU1A 4LDAA 4RK4A 3KHUA 1EJ6A 3TLKA 4JXZA 1NVWQ 4ZRDA 3FCUB 2O8VA 4W7SA 3T61A 2JC3A 4EUEA 1ZUHA 2EJBA 2YZMA 3VR6A 3HU5A 4KYTA 3TD6A 1JEQB 3L0YA 2AXEA 2IGTA 3PXXA 1JEQA 5JJBA 2XF8A 5LNK6 3TL6A 3FTFA 3H8WA 4JQCA 4F91B 2Q3DA 1NLYA 3AF6A 4FGWA 2F8TA 4C4YA 1OZHA 1UP4A 1E2KA 4G23A 4LJSA 4BOYA 4NATA 3UK2A 4BMVA 2ZE7A 4B45A 3AEQB 3N76A 4FHFA 4RF5A 5GJVC 5A71A 1Q3KA 4RPCA 2WV9A 1RXCA 1B0ZA 2C8VA 3IPAA 4Y3UA 4ZARA 3CGWA 2FQWA 3MC1A 1OLXB 1SZDA 2IS6A 4Q21A 4NC9A 1KYWA 4MIOA 1OLXA 4UC0A 4Y98A 5JE8A 1JLLA 2AXNA 2I78A 2O0JA 2X8JA 2GS9A 4G4IA 3E9ZA 4LKOA 2M6SA 1J2JA 3L5OA 3LBNA 1AGRA 3RUAA 5AHKA 2H5JA 4Z3KA 1NDUA 4J8PA 1SQGA 1UPFA 2E4UA 3HACA 3JQRA 3COPA 4WFIA 3ZHYA 1CDZA 5DN6A 1SBHA 4UARA 3TSWA 4DOMA 1ITZA 2P6OA 4O4IB 3E5RA 3OETA 4O4IA 3L7CA 5H3CA 2WF9A 1IPEA 1YZHA 3F8SA 2RE8A 3PSAA 2EJCA 1T1JA 2OAEA 3V4PB 1QS0B 3F5FA 4BCCA 3R77A 5FV4A 2Q3HA 2Y1OA 3OZCA 1RI1A 2PUJA 4HZIA 2ZWMA 3Q12A 1FTNA 4M8SA 1V5GA 3T0IA 4MARA 5D86A 1PJZA 3T38A 4OGGA 2ORWA 2C3UA 3EC1A 1NVKA 2VHYA 4BFSA 3RJ9A 1Z8FA 3UEOA 2VTKA 1ZHFA 2VJOA 4MR8A 4QLBA 2WTXA 4G6ZA 4M1YA 2HUNA 5ICMA 2HK9A 3NBUA 1HK7A 1TZBA 5D5QA 4RA6B 1LI5A 1T4GA 4ZQBA 2QAGB 2ZVJA 1E92A 4LF4B 4OATA 1ULZA 1E64A 4WLOA 1BEEA 1Y6RA 4LJ8A 2LRHA 1H6AA 1WLSA 3MUNA 2IP2A 3PE4A 4GM0A 5REQA 4AWXA 1EINA 2W90A 4H0FA 5HF8A 2CYCA 2P2CA 5C5DA 4G8JA 4NE7A 1OYVA 3IT2A 1T3GA 3IB6A 4QXAA 2FEPA 3J81k 4UOZA 4QM7A 3ZJ5A 2G76A 3B6EA 3QVVA 1NR1A 2IUTA 2PX8A 3CURA 1S96A 4WJZA 5LB2A 3R7BA 4C3OB 5BMVF 2YMQA 2QX4A 3WL6A 2OOKA 3PLNA 1E2QA 2PUWA 4K05A 2BMAA 2ZIGA 2O2GA 3I53A 4HAWA 3RU7A 1NLZA 1CR0A 3R3YA 5KZMB 3MJEA 1ZCAA 2IPOA 3AHEA 5KNCH 2RKWA 3H9GA 1I8TA 4RK7A 2GJ9A 4KK3A 3SKVA 4J29A 4N18A 2MSNA 5KDLA 2HA5A 2WSYB 4KOAA 4IKOA 1GZSA 2UZAA 2H06A 4GI7A 4JR0A 2VQSA 2EZUA 4J7CA 3ZR4B 1KMQA 1XJWA 4BAGA 2R5WA 4RY9A 4U7DA 4Y6GB 5EMJA 2FWJA 2VZLA 2ZUEA 3QKRA 3ZE6A 4EVIA 5HOQA 1YVUA 2NYRA 1L5OA 2HSJA 3MT7A 5ALDA 3ER9A 3PEYA 2MYUA 4AUNA 2XH8A 2BHTA 3SFTA 2FSVC 5H9VA 2OO3A 1TCVA 2GPJA 2B1GA 2GCOB 3RVQA 4QKQA 1DPGA 1XRSB 1PJTA 2AI3A 3DMYA 3B53X 2FUG1 2RGBA 3OPMA 4IVQA 1JSCA 1YNOA 4M8KA 5HF6A 4F4IA 1E9AA 1G19A 5FBHA 3W5VA 4C43A 5LIPA 1F60A 1NLFA 3I5XA 5GZ3A 3NHFA 3M4JA 1D2AA 1PEYA 4QYMA 3VH2A 2CYBA 4FBLA 3WAGA 4MUYA 2QPOA 4IWXA 3O1HB 1LZLA 4UAVA 1X80B 3MCAA 2Y1EA 1JPUA 4NZZA 1UDXA 2M9MA 3VDNB 4KI7A 1X7YA 2VNSA 5TQ0B 2O54A 4ZO4A 3U09A 2MR5A 2XTMA 4TN1A 2G7MC 3L9WA 5AK0A 5F1PA 3IUPA 3WO0A 3ZIUA 3AV0B 2QTTA 4DIMA 621PA 2QROA 3ZEAA 4EAQA 5HBRA 3RWOA 4DLBA 5BT9A 2V6MA 2YN4A 5I7OA 2X0NA 1NA5A 2KE5A 2Q5LA 5AOCA 3SIPA 1H8HA 2PX6A 1AUPA 1H66A 2V7UA 2WJHA 2ZTMA 3AZOA 4HDAA 3GRVA 3M6XA 5HTKA 3TL3A 1A9XB 1E2UA 3IA7A 3O4IA 4BNHA 1FMFA 1JVNA 1XLVA 4Q01A 2F67A 2JIBA 5DV9A 4MVJG 3X1YA 1KJ9A 3CCBA 5GGXA 3NWEA 1QH8B 3P2JA 5AQEA 1KVSA 4HBZA 2OXRA 4FKZA 4KO8A 3VOSA 3PRKE 3ESCA 3V8RA 2OK7A 4H4DA 3HV0A 1C8VB 1ICIA 5DNAA 4A2QA 4BVBA 2C7PA 2W7TA 3PDIB 5H81A 4MICA 4IIDA 5D3MA 5AW2A 4HFJA 5ECWA 1GR0A 1LSOA 2ZSUA 1AHNA 4Q34A 4EYKA 3C0KA 1L5ZA 2YIDA 3LUAA 4F4FA 4QEZA 2FW8A 3DFIA 1OXUA 1DT5A 4LMBA 3W8NA 4A73A 5EJMA 2ZRQA 3WYCA 4UUOA 5ALJA 1OCEA 2HN9A 3KZVA 3H11B 2HK8A 3F1LA 1FUKA 2OHOA 1NZFA 2PFGA 2B8EA 3ANSA 4WRRA 4DL9A 3SEFA 3THXA 1ESMA 5KNBD 2ZZNA 1G1AA 2HMYB 4PWZA 2ODNA 4AZWA 1BEUB 3AFOA 2XT6A 4M21A 1NRJB 4BX9A 4MVWA 4U5XA 4CQJA 4O8ZA 2GI4A 1UAGA 3DC7A 1ZNZA 1BKDR 1D0VA 2H1CA 2HPAA 2QVXX 3ELUA 3RJMA 4D9NA 1O54A 3NNDA 4D8UA 3DZJA 3OLVA 5KSWB 4P7JA 1HXHA 2B7CA 2C8LA 1TK9A 3EAGA 3H1AA 4IO0A 2FQ1A 2VSNA 4IDHA 2RGNC 3DJYA 4M7PA 3U4DA 5IMBA 5C2JB 2FZVA 1Q1QA 3I6BA 1R5JA 2XT9A 2YUIA 3DPIA 1ESCA 2A35A 2QY9A 3L8EA 5ILGA 4BFTA 1BS1A 1X15A 4KMMA 1X1BA 3WB2A 1RRFA 3WL8A 1W48A 2VH1A 3R7WA 5HEKA 1UMDB 3VKUA 2IDJA 2OG1A 4W4TA 4D3YA 1RWOA 1UMDA 3WYGA 1W36B 3EAQA 3IVAA 4QQFA 1MHTA 2O07A 3CF4G 1GEEA 3QJGA 4F5ZA 1GITA 2IF0A 2QWXA 1SOMA 2PKWA 1MD9A 3PC8C 4DILA 4ARCA 3OE4A 4GC5A 2MU1A 4B7ZA 4CR6A 4PYIA 4QXRA 3KOMA 4JI5B 4GI5A 3H2IA 2NIPA 2GJAA 4DY6A 2JLXA 4RIHA 1NUAA 3BCSA 4RD0A 1H2AS 5JS8A 1RHJA 2AH5A 1GZUA 2WRZA 4NAVA 4S1VA 1WUKS 5IF3A 1L5HA 1TQDA 1X8KA 5G4LA 4TM7A 4QAJA 3F3SA 4NJMA 1SU6A 2D1FA 3HXTA 3LFHA 5BV1A 3AVXA 1O0CA 1U81A 3O3MB 5B2ZA 3VBCA 1FZQA 2P9QA 1W4BA 3FNRA 3AR8A 3O95A 3C3DA 5IAGA 1RJDA 3JZFA 3RB8A 5KYWB 5KYWA 2PKCA 3TOZA 1I3KA 1VOTA 1KIAA 3A1FA 5FD8A 3R0VA 3TH5A 5BSFA 1KQOA 1OKKD 3GAZA 3HDYA 4DMFA 4WBNB 2AOUB 1TJNA 4NPCA 1U11A 2D6FA 3EFHA 4R8MA 4RM3A 1P1BA 4BGUA 4OJNA 4Y2SA 5ALWA 1A96A 4GQIA 1U2DC 1D2NA 4KHZA 3Q4GA 1L5RA 3K1YA 2KHZA 5EJ7A 2ONKA 2NU8B 3EPHA 4WEOA 5FUWA 1H9BA 1TW2A 3B6ZA 1BJRE 2RBEA 1ZVMA 2EBFX 3LBAA 2DQSA 4RLFA 5HA5A 3MHTA 1VSTA 3IAS1 4YMUA 5EA2A 3C7TA 2XW6A 2Y1KA 3V7NA 4KLCA 4L4ZA 2ODEA 4LXTA 2QQGA 4YBRA 4CJXA 4X24A 2I4IA 4UQOA 2F17A 2ZTUA 3DMNA 4P4TA 3OEEA 3W9UA 4INPA 4O4HF 5KINB 5C80A 5GQSA 2VYNA 2QMOA 3A2KA 2XGGA 3HUTA 3KPWA 4I0WB 2EFGA 1GA4A 4NZOA 3ZV6A 2PNJA 4YCBA 4JMPA 3EDRA 4XJTA 1WZEA 3H3JA 3W5JA 4PS1A 5I8PA 1D2HA 4N82A 2Q28A 1LJUA 1UZMA 5T57A 1GTVA 2F1OA 1QLJA 4X63A 4X85A 4NMLA 3AINA 5JW6A 3H9JA 4IEIA 1KBQA 4QXPA 5E4TA 5TS2A 1G8KA 1XTJA 1JKFA 1J0AA 5C7LO 1P8AA 4MAAA 2Q4OA 2RC6A 3LGAA 4BZPA 2HIMA 3IQEA 3HYLA 4DYVA 1W76A 5ERXA 4YJHA 5A7GA 4EQ6B 5JVDA 2C00A 3FPBA 4JQZA 3ABZA 3BMCA 4RIIA 2JEOA 3CF6R 2C2BA 1N6NA 4QBIA 2YQ4A 2IKQA 4EBFA 1AO0A 1GU0A 3VR2A 5FBLB 1CS4C 1D4AA 5KWIA 3WHPA 4DABA 3QBTA 2Z6VA 1XBTA 2A5DA 4EA6A 2WHYA 4CL8A 4I55A 5IKMA 1KDTA 1FNCA 3DO6A 4GL4A 5IC6A 1IY8A 1QE3A 4BPRA 3T15A 2PYZA 4ESOA 1VSUA 2VT3A 4ZVVA 4FFBB 2FR8A 1MH1A 1P4HA 2H0QA 5ESDA 1E1CA 4C0KA 5KJ1A 1N1MA 5FTNA 5EUMA 3TGLA 4HQRA 3NC1C 3LC1O 4JJZA 1UP6A 4N0EA 4QDJA 3LQQA 4A10A 4EPWA 4RTNA 4LZNA 1JFTA 4PNZA 3GRRA 4XDZA 4MGYR 1IY0A 2PGNA 3VC2A 2HWKA 3VUEA 1QK4A 3N2LA 4DEYA 2B8WA 2IPMA 3WADA 1OE0A 3CRMA 3IJRA 4LJRA 3TSYA 4JT2A 1HSOA 4C6RA 1FTGA 2YVAA 3WGTA 2RK3A 3RSCA 1PV2A 4L4UA 4JXKA 3H99A 3HFRA 1GFZA 1XG5A 1J20A 1U3GA 2GBFA 3AF1A 4EITA 3OQ1A 1PIWA 3C6MA 1WV1A 2AMYA 2JD0A 4EL5A 2VJDA 4JBYA 4J2OA 3K1AB 4Q47A 3SNKA 1R9NA 2ZQZA 3DB1A 3QVWA 3RC9A 1GYQA 2EZ8A 2NTNA 3B7WA 1R12A 1N6IA 4UJ3A 1XKQA 4O2RA 4AP6A 1KZHA 5IBQA 3B82A 2EEPA 3P5SA 1G2QA 4LDJA 5CEJA 1TE2A 3U44A 1IQRA 3BL8A 1HUQA 2WVJA 3RUHA 2H1LA 5JG7A 3OQJA 2C1ZA 1SXJA 3H2ZA 4KFCA 3OJXA 1X38A 4IJ6A 1Z4QA 4F8YA 4RE6A 4N7RA 3ROMA 4MGIR 2PZKA 4HLCA 2J7PD 1QZXA 3L04A 4L5YA 4EFDA 2FOXA 2J9YB 4JLMA 2EIHA 2Y1GA 1BFKA 1C4WA 2UUCB 5HDBB 4A0QA 1FPQA 3PPVA 1DUVG 3JWEA 1JL3A 1Q1NA 1RZ3A 1S02A 3JD2A 2FXIA 4OP2A 4GOXA 5DH9A 5BYBA 1S4QA 5BNTA 1I9GA 1N2GA 2O7RA 1C9KA 1ODFA 4MQ5A 1E2HA 3FNGA 2Z4SA 4MRNA 4LXHA 3CZ9A 3VH3A 4O8CA 221PA 1QPZA 2FMTA 3I72A 3A1NA 2D2EA 4JLSA 1RKXA 3S2IA 4DM7A 1K7SN 4Y67A 3NIWA 3FLBA 4ARSA 4AZTA 1L7OA 3TXXA 3K0CA 1K5PA 2ZYSA 2ZRDA 3KP1A 3COVA 1QHHA 3HC7A 2AB0A 3OJEA 4R83A 2CHUA 1ILEA 2G82A 5E6RB 1E9RA 3ORYA 4H1VA 2H2IA 2PR2A 1H0RA 4W5QA 1MDFA 3GRAA 3W2HA 2H2GA 4BKPA 5AVUA 1PDVA 1FFCA 2SCUA 5ALFA 1X39A 1Z4JA 4PPNA 4ZCSA 2QDKA 1RLJA 2WG2A 5FBZA 4YPOA 5HZGA 1EFVA 8ABPA 1R8YA 4HAUA 4WVFA 5A0FA 2I6GA 2XNHA 2BYTA 4Z6KA 4P7BA 3U6BA 2RKBA 4W5OA 3AH8A 1WDTA 2BLNA 3E2MA 4WFQA 4JDPA 1KYIA 1Y5RA 3WLNA 2XRFA 3SOPA 2FK8A 2R2GA 3IEMA 4PWYA 3BWMA 4JMLA 4I1VA 1EZ4A 1CR6A 1V71A 4HNSA 3PL1A 4E5NA 3IPRA 1X7ZA 5BNWA 2BZ1A 2CN1A 1FFEA 3HKBA 3SHQA 3VDQA 5C8ZA 1NVMB 1WJGA 3EUAA 4ARIA 1M67A 4HH3C 1WW8A 4FLEA 4JODA 4M9RA 2X0JA 1J49A 4RDHA 2I2WA 3C6XA 1QC5B 3B36A 3GR6A 3LZ6A 3P26A 5I9TA 3OZVA 4MW6A 4JLDA 1QC5A 5A6SB 1R4NA 3V1MA 3K70C 1SHZA 4ZMSA 2IU3A 3DEHA 3HB0A 2HCTA 1QDLB 5K2MA 3W8RA 3GZNB 1Q7BA 1RJFA 1M6HA 2OVFA 3AETA 3BN3A 3SSNA 2Y6UA 3E0XA 2ZFUA 3UMBA 1QP7A 4X61A 2PFKA 1L1QA 5I48A 3B5IA 5U4XA 2JFUA 4LOAA 1MPTA 1ZL0A 2ECFA 3A6JA 5E2AA 1MIOB 1CEQA 5FR1A 2XUFA 1Z6PA 4FDAA 4RQAA 3UCXA 3NKFA 4GRIA 1ATZA 5KOJA 2C4MA 1JDSA 1EFAA 1E1RD 2IY8A 2N3ZA 4MROA 1R0YA 2DTDA 3VR5H 2P62A 2COUA 1CJKC 4YASA 2CLFB 3MD9A 5GV7A 2OQIA 2YJNA 3E03A 3ZH9B 3RAEC 3Q3IA 2QTVA 4CNBA 1X7XB 3KVVA 3NAZA 1TPYA 2IE0A 4KJZA 4YXWA 4QM6A 4MVCA 2F3UA 1YIOA 2CHQA 3AJDA 3GNQA 3SR4A 5T7BA 3KQLA 2GKGA 1JEYB 2ZQ5A 1Z0UA 2ZB8A 2KJQA 4NE2A 1ENOA 1C41A 2EQ5A 4KBGA 5ELXA 3GI1A 4HGOA 4RZUA 4G0WA 1FF9A 2OG2A 1P9LA 2XCSB 1WF3A 3BSFA 4A7PA 3MRXA 4FBMA 3D7LA 3GFTA 5LR6A 1JFSA 1VMAA 2GHTA 1OAOA 4G25A 1X9HA 1UMBA 2JVKA 3QFTA 1A2QA 4F3YA 3IBYA 2GQ0A 3FR7A 5KDOA 4NV1A 3RVLA 2DLDA 2LGJA 1SVSA 4IDGA 2G9NA 5F7JA 1ZGZA 4EO9A 5JASA 2HX1A 3LDUA 3SXPA 2YQZA 2WUDA 1OIWA 2GFIA 4LF9B 4JBNA 4MNTA 2QZPA 4A1OA 1GNSA 3DHWC 3ADKA 3RS3A 2JJYA 3EIEA 4F1JA 4TMFA 1P2SA 3BMQA 1H6BA 3OU6A 4XGQA 2FW6A 3E2PA 2A9PA 2OILA 3D3WB 1MJ5A 2QVYX 3FPAA 3I0NA 3JTMA 1E79A 3LWBA 1T2VA 3O2JA 4M9QA 4RD2A 5AM3A 5IDXA 3EVAA 4JBGA 3MF4A 1JVSA 1UOPA 3N58A 2A5LA 5IM4A 1XMPA 1ZOPA 1QQTA 3FI0A 3A32A 3IXMA 3D8SA 1Y0BA 1YS1X 3TW8A 5LMCA 4HX9A 1U90A 2HSWA 1UJ4A 2PYIA 3VOBA 2ZM6B 1P1KA 5AOBA 1D5WA 3WYAA 4UPDA 3RSSA 4EHIA 4O3FA 5LU9A 1X86B 1G6HA 1PNVA 2C9CA 2VAWA 3A3NA 1ZQ9A 3EARA 3BE4A 4P4NA 2IHBA 4PBRA 2IZ7A 3EEFA 1I13A 2BI4A 2CLCX 2ZRIA 4J9VA 4UDNA 2H48A 4JDUA 5B1SA 2CHFA 2P4UA 3D7RA 3DAPA 4LVOA 5E4JA 2C3OA 3N2GB 5LCXA 4TQUS 4L4SA 5AICA 4CMKA 2DY0A 4DMHA 5JWOA 1IZ9A 2ZB7A 3CJTA 3BF7A 4MI1A 3W34A 2YMLA 3WGVA 4C0SA 3JRNA 4A4DA 3VYTB 1H1DA 2OCXA 1W4CA 2D5LA 2ZJYA 1KVTA 1O9BA 1RI3A 3F4LA 5AXCA 2H8GA 2G67A 2PT9A 4YRLA 4L5AA 5EHIA 2ZZKA 3F8WA 5HE8A 3M4NA 1E1KA 1ICEA 2JJ1D 3EEIA 4FFOA 4FW9A 4MI9A 3VI3B 4OX9B 2P2LA 2O2SA 1DBQA 2VHWA 3BAZA 3BHNA 3BYZA 2EKQA 3W5BA 1Z33A 2HNAA 3QBEA 1NMEA 4Z1MD 2YYSA 4JCOA 4DWVA 1P0FA 2G8NA 3JWPA 1WTCA 2R2AA 3RBAA 3CRZA 1H9AA 2P0AA 4GQBA 4F93B 1DARA 3GLIB 1J22A 4RPHA 1CDDA 2Q6LA 1DJNA 2IU4A 4LIPD 3RHSA 1L4KA 3MK31 5WRFA 3E2IA 4NFLA 5CT9A 4QEDA 1TUBB 2DP4E 3KUDA 3ZI7A 3L92A 3WL7A 3BD6A 2OL4A 5FFNA 1K5HA 3QEBZ 3B48A 1CKEA 2AS0A 2DWCA 4LZOA 3WGHA 4W5RA 3SDSA 2G06A 2RGDA 1MC5A 2JIZA 5TS3A 1Z7BA 3OCVA 4L28A 3W3AH 3OFND 2WAXA 1M74A 3G5MA 5E4YA 3AI3A 2JD2A 4YREA 3TRKA 3I5MA 3RSFA 1KKMA 2QN7A 3UKDA 2D1TA 2JGDB 1A4RA 5BPHA 1UDRA 3CVUA 2GKOA 1DOHA 4WXYB 5CK4A 4PZPA 3V8EA 4CKEB 1XPOA 5JD3A 4ZHQB 3R9XB 2AGVA 4BNXA 1E18A 3C16C 4ZI7F 2QRGA 4WACA 5HQTA 1NIPA 1HORA 2PCLA 1MAAA 2NGRA 4RTSA 5LN1A 1HGXA 5HCNA 2Y1FA 4HKTA 4ZICA 4ZCMA 1WDLA 3OF2A 1CE8B 3OIVA 1WQ3A 3GJ8A 3O93A 2RK4A 3DH0A 4K1LA 5TF0A 5H3LA 3M3DA 2I87A 3FWHA 3MEQA 5LWHA 4MUIA 3WKDA 5A6VA 5DK4A 2I4OA 4Y1RA 3A9WA 1V1RB 4R1UA 3S2SA 4LNUB 4ZYUA 4XIGS 3ZG6A 1UCFA 1VTKA 3OZUA 1E7QA 4CCYA 5EWMA 3TUIC 4C20A 3C85A 1ZM3A 4NLLA 3A3OA 2LPMA 3FUTA 3L18A 1JAZA 3HADA 3K6RA 4QDXA 5KPJA 3L4JA 1NY6A 2H4JA 1QTIA 2LCFA 1I5RA 4IDAA 4IOKA 4ERNA 4EYSA 1KYQA 1LB1B 1LPBB 1ONNA 1MX9A 1YB1A 4MR7A 1X92A 1CR1A 4O4LF 4PYMA 4DQ0A 1E5XA 1U1GA 1Y8RA 2YNMD 3V34A 2X5NA 3KE8A 4P3OA 1DRJA 2VJYA 4K86A 4W8OA 4DLYA 4H6PA 3VPHA 4E32A 4WXRA 1VIAA 1P3JA 5DCLA 4Z99A 3WGNA 1Z5OA 1VE6A 3QW4B 1UJMA 2EDCA 1MC8A 1X7WB 4ER6A 2HPHA 3ILVA 1C5KA 5BRAA 3TLGA 1HT3A 3UK1A 4MS3A 4FILA 3IT3A 5LL6P 1MJFA 3K3PA 2WABA 2C7BA 2R44A 2J07A 3BMNB 3V46A 4J1NA 2EYUA 1FMJA 4L0QA 2OT3B 5BW4A 5LQUA 1XD9A 3F6BX 2Y0CA 4E2YA 3C15C 2OZKA 3KQSA 4CF6A 1YQXA 3L41A 4YWJA 4IL5A 3MM4A 1CQXA 3O03A 4MVJH 4ZEVA 2G6BA 2FNAA 5CAEB 2B34A 4HLQB 4MUGA 4ZOBA 2PD6A 4K7JA 4TKMA 5A5DA 2CLEB 2Q8QA 1XZBA 2VQ3A 3IKMB 3WNCA 3L0SA 1C1XA 3IYLW 5KYGA 5L4LA 1B2RA 1O95A 1F20A 3EFOB 3JPWA 3NM4A 4D9GA 2Q3EA 1A9PA 3WSWA 4RTQA 1VBKA 3H83A 2WWRA 2XB8A 3A1VA 1MW9X 1PS8A 5LZ9A 4B4KA 3X2EA 4YCJA 4E13A 2V96A 4OFZA 4RMIA 1SVLA 2QRLA 3ORRA 5EKXA 4CM9D 4B3XA 2BH2A 3ABSB 3QLVA 2G0NA 3L79A 4XM2A 4RH0A 5GTDA 3BTUA 1CUAA 5ALHA 4AN0A 2QI9C 2CL0X 4EOGA 4WKPA 1N7GA 2VXOA 5GJWC 5J4HA 2GEFA 4Z4EA 5TX7A 2ZAYA 1V37A 3IOYA 1QGED 2BEWB 2OHVA 3M9WA 1VDZA 3PCTA 3PTAA 3GDFA 4HP8A 4TV8B 3FLMA 5A1JA 4EB3A 2JZNA 4KQJA 1I2AA 3CVXA 2J3KA 2Q9CA 3AV3A 3GMTA 1EJ0A 1ND5A 3GJ6A 1FFGA 3PNPA 4EZIA 2H16A 2PX5A 3UUFA 4N01A 2BFBA 3PKZA 1R9GA 1T9ZA 4M9ZA 1CY8A 1ZG3A 3EOZA 2WHRA 4PQEA 3GH3A 4PTYA 4RAQA 3EEYA 4FZJA 4H31A 4MJLA 1JJ7A 1ZH2A 4HY3A 4XLZA 5FQOA 1WOYA 1KE1A 4YJ2B 2H6EA 2QJFA 3KKQA 4YJ2A 5GY7A 3LPMA 1OHHD 5FBWB 4DV5B 4UEOA 1A97A 3H65A 4PR0A 4M9SA 4RZQA 1XUOA 4YDQA 4EPYA 3E9EA 4IFEA 1E4OA 1B6TA 5ITZB 3DZCA 2IYWA 4GX1A 3UYLA 4EJ6A 4EK9A 1C7JA 5ITZA 2Q0QA 1SUEA 1O9HA 3GDWA 3PX2A 4PY2A 3GLQA 2KBFA 2PFSA 3MS7A 3E82A 2W6MA 1A77A 2NZWA 4RLQA 4F5YA 3K05A 4YROA 5MDHA 3U7FB 1BXKA 3O4RA 2VJBA 3AM3A 4JQYA 4EY7A 1DEOA 2PJDA 1A71A 4FD3A 3TCKA 4DDTA 3BA6A 4I08A 5IVDA 2ZYWX 4BHTA 4C6TA 4TLDA 4GWKA 2HIHA 2X4DA 3ZLUA 2DWQA 4TPKA 4X3CA 5IVIA 2BSXA 1AUOA 4UNQA 3ZWKA 3L7JA 3O21A 4G5QA 4K2HA 1OWNA 2XMBA 5KTTA 2GK6A 4ZYWA 4V0NA 2R4QA 4NG4A 5IZ4A 1BSVA 3CR3C 5JBIA 1VJCA 3EBPA 5IVHA 1Y9JA 1XZHA 2XCTB 2J08A 2BUBA 2AMJA 2WU3A 3DKPA 3NC0C 3TLYA 2BR5A 4LE2A 3VR6H 1KDPA 1ISSA 1DO2A 3SEZA 3TXYA 3HY4A 4G5HA 4R05A 5JZVA 3NDRA 4RL4A 3E1SA 5B1YA 1N6PA 1KGDA 4ZD6A 5B7NA 3G0OA 1DQSA 2G71A 1Z08A 3PSHA 3HO8A 2ZYGA 4X84A 3AZPA 3DJFA 4DG9A 4CQLB 1I4WA 3D7SA 1NASA 4WXPA 1P2TA 3O4VA 1ZH0A 1QYWA 3ETEA 4OHCA 4BXOA 1XZPA 3GLRA 5DHUA 1H22A 1TU4A 4IXTA 5I6DA 1BQEA 1DOAA 2EKPA 2P90A 3ZNPA 3MS2A 1BYUA 4KFUA 1ZK2A 3IKVA 1RYYA 3G7UA 3IQHX 2GBGA 3BCHA 2GD2A 3JPYA 4Z2AA 5HMMA 1DCTA 3OPYI 3P2MA 2OCBA 2FPKA 3V2IA 4CMAA 4RJJA 2JCGA 2OY0A 4V02A 3G8DA 3N74A 4Q1EA 4UXIA 3EZXA 3W6NA 2G9RA 1J8MF 3V4ZA 4FI3C 4BNTA 1MOSA 3OH8A 4LQCA 4LDNA 3PRJA 5BQFA 3X1DA 3JR7A 5ARCA 1U9ZA 2FG5A 4O2BB 1YONA 3PDCA 1DELA 1JTFA 4D9MA 2H1WA 3CNBA 4A8JB 3Q3CA 3RVPA 5IFLA 5K0CA 4D0GA 4U3JA 1SGWA 2ZAOA 3O8NA 3THOA 4DRZA 3K9QO 4INZA 1DTWB 4XCVA 2A6PA 3FMPB 5CYFA 1R9JA 4MDFA 4IBOA 3NI2A 4IIBA 5DHTA 1Z26A 2GVNA 3DWGA 4ZVLA 5BW8A 5BVHB 3AIMA 1ZXLA 5I7RA 1M54A 2L18A 5GVSA 4JYPA 5JSZA 4GG1A 4TUYA 2X42A 2HFKA 1FBNA 2JGLA 4H7DA 5JAHA 3P9RA 2GHQA 4FFNA 3NHAA 2Z04A 3V3KA 3FYTA 2H4ZA 3Q8XB 1ESDA 4M1SA 2C95A 3QWAA 1Q0HA 2XMSA 3DOEA 3EVEA 4XX0A 4XJSA 4NH4A 3BXOA 4FFSA 5F77A 1MZPA 4JU9A 2OXTA 2HDNB 3I9LA 5EE1A 4D4MA 3LOQA 3PFHA 4OG2A 3ZVKA 3S44A 3UAYA 1VMIA 1U2PA 1XR3A 5DXJA 5FTKA 4QU9A 1P2FA 4IHJB 2YX1A 1Z7WA 4HMOA 3SJ7A 5BWOA 1FVOA 4ALIA 5DYIA 3ZOKA 3S8EA 5AI9A 1Q44A 4G4GA 4ONEA 5DN9A 5JQGF 2UYQA 2FJUA 3FDXA 2G25A 4MUEA 1U7TA 4M0DA 1A82A 5DM1A 4GZLA 4BAZA 1PU2A 4Z4HA 3HUFA 2VXBA 3DBLB 4LDPA 2ZSBA 3VMFA 3W5IA 3K2QA 3H2BA 4WCVA 3ETHA 1D5CA 2IYZA 5LBIA 3CPEA 3Q6IA 4YHBA 5BR8B 3RK0A 2ZIZA 2R84A 5JALA 2XKJE 2HRBA 3BICA 3W6OA 1RRMA 2O3TA 3PG5A 1EVLA 1KOJA 1VFNA 4N6OA 3GLGA 1V1MB 1FXUA 2B7BA 4RDIA 2ZKIA 3SMQA 4J3FA 4P6VF 3ZV4A 1QG2A 1JIIA 1D7OA 2PEZA 4LG1A 1HYEA 4UUMA 4G0PA 4CIVA 4MK4A 4D8WA 2ZIFA 3TUJC 3SQOA 1P4GA 2SHKA 1D1TA 2QR5A 1KQGA 2IOFK 1Y3FE 1TA9A 4IV8A 2VHZA 1DS6A 2V45A 4BFZA 1ADBA 4IFIA 4QOIA 1THTA 3UHOA 4R8KA 4JVLA 4GRAA 5JY6A 4F6LA 1E0JA 1Z28A 3FZQA 4RKRA 3ZXIA 5CIQA 1OXBB 2IDKA 3FGNA 2H1RA 3KNZA 1PLKA 3DE1X 3HPQA 3KU1A 3R44A 5HCIA 2PBRA 1U99A 4AYWA 5CRIA 2A0XA 3AJ8A 1L5QA 1IK4A 2BGIA 1SXGA 2GERA 3WY9A 1PNTA 3OA2A 2JG3A 1F51E 5DHSA 2P8JA 3OP4A 5AVZA 4JKYA 3C3KA 5B3JC 4D44A 2HR1A 1XPRA 3TQSA 2QD5A 2O8CA 3WMGA 4LOKA 3IVCA 3ZLTA 1Z6YA 1ZUIA 3I6IA 1H0SA 4HWGA 4KPGA 3G1UA 1Y7HA 4KYUA 1WMSA 1C3XA 1M2WA 1TU3A 1LPOA 2REOA 3IQWA 3IVMA 2L0XA 4YUAA 1A8SA 5CTAA 2VJAA 3PXEA 3VTFA 5BQXA 4WHMA 1OX5A 3NMUF 1T8SA 2F3PA 1CRZA 4G86A 2REBA 1N8SA 2XUHA 4E07A 3PIRA 5AW1A 4ZV7A 4B2YA 2I71A 1ZESA 1PZGA 3HJGA 4W5TA 2HDOA 5ICFA 4UFOA 1Y42X 1YCFA 2M6KA 3SX0A 4RTOA 3K6SA 3KSRA 4YECA 4HNTA 2PKXA 3KOYA 4KDFA 1B74A 2RHTA 3D8NA 3LC2O 4OK3A 4MGHA 3V1KA 4CLRB 5HGJA 3L8CA 4C7BA 4EABA 1CEYA 3X3HA 4BLPA 3SYKA 1C14A 2QYTA 7AT1A 3DXXA 1JZTA 5KJFA 2GXUA 3TF5A 2YTZA 4MCAA 3T9CA 2PUFA 4WCFA 1TO2E 2WD7B 3NPAA 5JJ5A 5LM3A 1VA5A 1KJWA 2HQ1A 1G21A 3FB1A 4XJVA 5FJIA 3RSLA 3U9TA 3D43A 2ZRFA 1NI3A 1NYQA 3E8MA 1FFXA 4CIWA 5IABA 1D03A 4PC2A 5IU6A 2GN4A 4QYIA 1H2RS 1RQ7A 2QN8A 3E22A 4MVJE 3RU9A 1FUYB 4HDMB 4OYLA 5G2OA 2EG5A 2XSZA 1EIWA 2I3GA 1K6JA 1MAHA 3GV0A 2FW0A 4MZXA 1QP0A 4CM4A 1Q92A 4A9AA 2X9NA 2ORIA 2ODAA 3DGEC 3I12A 2Q7XA 4I9NA 4N0PA 4PLTA 4IXNA 1BDBA 4IXMA 4BVKA 3GX1A 3WGIA 1GTRA 2AX4A 4FMDF 3DEIA 4L57A 1WIWA 1DEKA 2IHKA 5DTIA 1XP8A 5JUWA 1T9HA 1M2GA 2H0RA 3DEFA 3PITA 1I2ZA 2PCJA 1QLWA 3A4YA 3GXBA 3QFHA 1E2IA 2NTVA 2EXXA 3KCQA 2OAQ1 4RZ2A 5FTLA 1GQOA 1TZKA 3R6LA 3CLSD 4MUFA 2ORVA 2W4QA 1SCNE 4HXFB 1HFEL 1ZBQA 1KH3A 3O4FA 3P2KA 1RM0A 2PLAA 2LBPA 521PA 1Z5GA 3HKDB 5F98A 3VR4A 4BX2A 1DB3A 3P4YA 3KUUA 1SHUX 1A88A 2CW5A 3TZCA 3T9BA 5CD9A 1AURA 3LQFA 3Q72A 4Z9BA 1DV2A 4QLOA 2O7VA 4QYSA 1TW3A 4Y7CA 2HNBA 1WXHA 2B9EA 4JKOA 3JQPA 5CB8A 4B87A 4NULA 5IUKC 3IV9A 1L7XA 1QIGA 2ATCA 2JFNA 1L7DA 2DRIA 4K8RB 3WO1A 2MSKA 2B36A 4UBOA 2Z9DA 5DBGA 5IBPA 3SVLA 3LBIA 4HX2A 3O3CA 1EBFA 3I92A 1XEFA 4F4CA 5FX2A 1AXGA 3BXZA 1IB6A 3QVKA 1HEIA 3VHRA 1A72A 4ALMA 2C5SA 1OI2A 3KKPA 3TPZA 3WRXA 1U02A 4E5VA 4JUDX 4OQDA 3EH2A 5F9FA 3EXEA 1USVA 4HYQA 3TQRA 1DTSA 3B6KA 4UUPA 4AG6A 4DCPA 1QK5A 1VBFA 2YKGA 1F4LA 1ISPA 3Q5DA 6CHYA 4UM7A 4X54A 4N03A 4P98A 4FEGA 4O59O 4OFWA 2HEGA 1UC5B 3ND6A 3PHIA 4XQEA 5KBYA 4TT3A 3CZMA 3DGFC 4G0XA 4RKFA 3OQPA 4KR9A 4DNFA 4EG0A 3PFFA 2IE8A 1UKBA 2WUGA 5EQDA 4BBZA 3CE6A 1L6IA 2UVPA 3KQTA 5DGIA 1E3WA 5FPPA 4Y6SA 4S0ZA 4XDGA 1EJ2A 4NABA 2YHIB 3FCOA 5MFPA 2YRXA 4LC0A 4AMGA 1J07A 1GAQA 3I39X 1AA6A 2Z2IA 2HBRA 3GOHA 4GBMA 3GWGA 2WU1A 4QSHA 3VJMA 3PNSA 4EYOA 5HK8A 2BFCB 2NU6B 3MJTA 1QIMA 4ALJA 4B79A 1XDWA 1I7PA 2NU6A 1I32A 1S2MA 2HRZA 5JT1A 1FUUA 4AICA 3FOBA 2C03A 2N47A 4DV3B 4ADSG 3JQGA 3IOEA 1S7GA 4QPZA 5IJ9B 3HLYA 4FFMA 1XMXA 1HLFA 2ACEA 2QQFA 4RDXA 1HDZA 3ZZMA 1F3LA 3E70C 3HVHA 1E4YA 1S8NA 3RU3A 4JLWA 5P21A 1BX3A 3S99A 3ZOZA 4BMZA 3RS8A 5IK2D 1GO2A 1T0PA 1Y63A 2FPPB 2CUTA 4I6JA 3UMRA 2YDYA 3LUBA 3PYXA 2CF6A 4NBKA 1G59A 4D57A 1A8QA 3EJWA 1ZGGA 2PX2A 3BDIA 3K72B 1QV6A 4FHCA 1ODCA 3S70A 3GP3A 1PR6A 4U8GA 3VO2A 5LBTA 1L1EA 2AOWA 1TFRA 1XHLA 2O14A 2HRRA 5GONA 1QKKA 1W6RA 5JHHB 1XKXA 4MVJP 1IJBA 3GJXC 4IG9A 5AHOA 3URKA 3SLRA 6REQB 4R2HA 4CF3A 4B35A 1STOA 6REQA 1KSFX 1ST3A 4CF7A 2DZDA 2R66A 4J49A 4RK1A 4QJIA 4PV7A 2Y77A 3P9SA 3MCTA 4MV6A 3VR0A 4PRLA 1MB0A 2GCPA 3WQRA 3C7KA 3WGJA 3IXQA 3G5TA 3VZDA 1QOZA 2HJSA 5EEHA 1JDZA 1G5IA 2O8DA 2IFTA 1ACLA 3LP6A 4U2KA 4V0OA 4HQKA 4ZP1A 3PXGA 3L1JA 3GPLA 1R16A 3T1HB 1Y5NA 1J2YA 1K6MA 2Z1MA 4QO7A 3FSGD 3OESA 4TM8A 3SCZA 3RODA 5K8CA 1TM7E 4GKBA 1W5FA 5T5QA 5HKKD 4FB4A 5C1OA 3PTZA 2GYVA 3LS2A 2CV0A 4Y1FA 3SZLA 1G8YA 5DNVA 2Z6AA 3EQ7A 5DLYA 1WB9A 3VVMA 4WNAB 3WK7A 3RRYA 1Y1PA 5BUCA 3BTSA 3ZUPA 3AVTA 4YH1A 1JKMA 1B0UA 5DLQC 3E0QA 4IDCA 3USES 4A26A 4BNDB 4BNDA 3T3HA 4IGFA 4NAHA 1NNI1 4MCIA 3W2TA 1YH3A 3ETGA 3Q8WA 2IX3A 4HGZA 2P1RA 3DMTC 4E09A 4C2TA 4ZTUB 1ZRSA 3OZEA 4OQXA 5K2OA 3DT8A 1JA9A 3QWHA 1A7UA 2QSUA 1MF7A 1MU0A 4MV5A 3TQIA 4BLTA 1N34B 2D4HA 4LRQA 4YCSA 4P7GA 5BXQC 5CH8A 1SXHA 1NNSA 2CL5A 2J0EA 3QEAZ 2RIPA 3NIBA 4WX2B 4Q7LA 1FP7A 4NYIQ 1UBKS 3KEFA 4NNOA 4V0LA 4YJGA 3TZQA 5FUXA 1UIMA 3IIMA 3O0TA 3DUWA 1SXIA 3H4TA 4QQKA 3DE2X 3FHOA 5A9TA 1N9GA 3RS5A 1OYWA 3UHPA 4EPXA 2E89A 2QT1A 2XR1A 4ZA2A 2D7DA 2PL5A 2Y68A 4DDWA 3DZKA 2BFDB 2WW8A 1FTYA 4I9HA 2B8TA 3HYRA 4RFSB 1OYOA 2X8AA 4OX9Y 1CP3A 2JLAA 3WKAA 1E2MA 3IVXA 2HU5A 4UTNA 1B76A 1XQ9A 5H02A 3PHJA 1C9YA 1TK3A 5DGXA 5J4VA 5LXTA 1RM4A 2YVLA 5ESXA 3G82C 4FJ0A 4CEIB 1P72A 3I37X 2WT9A 2DFDA 3NEYA 4DZTA 1OT5A 4G1BA 4UVEA 3JYQA 3AIKA 5BYKA 1P5FA 1JHMA 3Q7IA 1NN3A 4HWKA 3WGKA 1ZD9A 5HE9A 3ADBA 4PICA 1P18A 3NHBA 4Y2YA 1RD4A 4W1PA 1CRQA 4D9FA 1EDZA 1EA5A 3PQCA 3PWKA 1F9EA 1GPH1 2BD0A 2CMHA 1XDUA 2H5IA 2XIQA 3OEHD 3L4BA 4PCUA 2NG1A 3INYA 1U0FA 4L08A 1T5DX 5DLEA 5GWXA 3VV3A 4YA6A 5DCYA 3URMA 1TEVA 2V6IA 4YFVA 1UDWA 1YA8A 3TRHA 5B5SA 4OHOA 4KN8A 1ZMTA 3B2NA 2NV6A 3HUDA 4B2IA 5D2CA 2VBFA 3DV9A 5BSKA 3SQWA 2DERA 2QP4A 3T7RA 2AUNA 3V2UA 1CS0B 1P17A 1PTJC 2FX3A 5K3FB 3ZS8A 2VJMA 1VYVA 2H2HA 3H4IA 3PGLA 3TLEA 5AJHA 3HS3A 1G4AE 1Q15A 2IXFA 3QVUA 5HF5A 1MIHA 2HL6A 1CY4A 2UZ4A 3HDTA 1KO7A 1UZAA 5L4SA 1A7JA 4UNNA 3WWDA 1E9SA 4BP8A 4DLKA 2P9FA 5EKDA 4BNKA 1G0OA 2PUTA 2EJWA 5CCEA 3IDOA 3GVIA 3UJNA 4ZU3A 1S3SA 3HMQA 3DVQX 1NVEA 3OHPA 3INGA 5J2TB 3LUHA 5JCOC 2AD1A 4EHBA 4YMWA 4J7AA 3WYNA 1KIFA 4HLDA 1BDIA 2X9GA 1DKPA 1KY5A 4G07A 4H2DA 3QOFA 3AJAA 1C3OA 3R3XA 1L5FA 1A5ZA 2X5JO 5E2IA 2OEPA 3RVNA 4P38A 1GZ5A 3LVRE 1W85B 3AFGA 4DZRA 4MJXA 5T8KC 4DRXA 4R1MA 2XZOA 1KYXA 1MAVA 4FYWA 5EXPA 5BN4B 1BWRA 3QQPA 1DUSA 1ONSA 2AJCA 3M70A 3U3KA 3TNJA 3X1MA 5EIFA 1NN1A 5ARDA 3N3AC 4GH5A 1OAKA 2FGJA 1DNPA 2O0MA 3OOWA 1SY7A 3GAFA 4KIGA 4Y6OA 2XGSA 3AVVA 1NR5A 4YRSA 1PQUA 2IYOA 3KQMA 1BVRA 2GBLC 4MB2A 3RTAA 3CH5A 1HE1C 4CQMB 1P7CA 1OZGA 3HK2A 3IMGA 1Y81A 3ADPA 4QSMA 2ORYA 5AOAA 5JCZA 5JAPA 3W5DA 3D81A 4D74A 5MN4A 4QUIA 1A8PA 2VHJA 3G2JA 2KB0A 4NYJR 3OE5A 5A7HA 4ITRC 3HCDA 4KR0A 3RAJA 2WKWA 1LF5A 1J1ZA 3EBOA 1KY2A 4Q16A 4EDFA 3E3OA 3GRZA 3KR9A 1YVDA 2A5YB 3WK4A 2LKDA 1Z35A 3TCNA 1XHEA 2VK1A 3NOXA 2RSLA 1B43A 5DRTA 3D6MA 3PIDA 2EFDB 2QYHA 4NS1A 4B17A 2PPVA 1PI3A 2FEMA 1EM8B 5I5EA 3LV8A 2M2IA 4WD3A 1RIIA 3I8SA 5DB4A 4P1ZA 4S3MA 5BR4A 2F9FA 2F3SA 1L4FA 1MP0A 1RWXA 2RDMA 3FW1A 4W6ZA 3VXKA 4Q15A 3NX4A 3RADC 2DEUA 3Q9UA 1FC0A 1HYGA 1KFJB 5K99A 4AY5A 3TXAA 1LLCA 3QOWA 1HFWA 1OR8A 4XYMA 3UXMA 3D0RA 4DG5A 1TNDA 4JWKA 5ITWA 3SZRA 1SBZA 4OQNA 4BQNA 1JF8A 1I7SB 1SCKA 3I9FA 3NWBA 5EUCA 1DJOA 3C8DA 1R6UA 3MCUA 3QFCA 3S81A 2RGGA 2GSDA 1K97A 4TLAA 1JIXA 1AB6A 2E18A 2PSEA 4BB9A 3LCVB 1DBSA 2WSSA 4FDUA 2Q1TA 3RG8A 4LI0A 4M9CA 1O2DA 3AERA 3NVMB 4V0SA 5EI5A 3TINA 3JAWA 1DDGA 5TT0A 1PNOA 2IUEA 2I7XA 3QUBA 4ND3A 3EZYA 4HRXA 4J0FA 4YRDA 3K32A 3U0BA 2DJIA 1MQ9A 4HEJA 4M6WB 1CQJA 1LSSA 3BMOA 3TI9A 2CVZA 5DGHA 3D4NA 1DE0A 1UODA 1ZM2A 5JPCA 4D9CA 3DE0X 5E4FA 4GYKA 1YL7A 2EWMA 4TRRA 3L8ZA 4PCAA 3RSOA 3I30X 2A5GA 2C61A 3ESYA 4HQNA 1Z0IA 1OFGA 3CUVA 3HVKA 3JATA 4C1BA 3GLGE 2CT8A 1CX9B 1FYXA 3ZS9A 5KWSA 2ZVDA 3G2IA 5CH5A 5DU2A 4JLJA 2E4XA 1OI3A 1M6YA 3OKCA 3SJAA 4GEGA 1TD9A 2B30A 2FR0A 4J4TA 5EIBC 3OCYA 3SD7A 3N6RA 4MGEA 4QRDA 3JQ7A 4DPKA 2WQ6A 1IUPA 1P62B 2EX4A 4NZNA 4EHLA 4DNQA 3QPCA 1WU8A 2NXWA 2ZRGA 4IGEA 1HFKA 1DIOB 2P65A 2VNAA 1PSDA 2PT5A 3CLRC 2B35A 3CRNA 3RVBA 2I7CA 4CMEC 3RNOA 4LV5B 1C3JA 1TZCA 3JYOA 4A2WA 2GNAA 4ZOCA 4L51A 4CEJB 3C7DB 3N39C 1JKJA 2E48A 4R1TA 2IJGX 1U6JA 4Q1AA 5C1DA 1I3MA 3JRWA 1J70A 2KLBA 1Q11A 3H3XA 1U9IA 4IOLA 1H42A 5LA6A 5A62A 2K6GA 4TV9B 4I1YA 3O0DA 4P3PA 4TV9A 5T4FA 2NM0A 3IP1A 4ND1A 3SKYA 1PW7A 1NKTA 3V7YA 2XD9A 2PX0A 1F6BA 3MWFA 3LIIA 3HDJA 3R23A 3SP1A 2C20A 1PYGA 3D6UA 4E30A 3COSA 4R7GA 3QKWA 4LJKA 3SXUA 1X8XA 4AS3A 1RLTA 3R9IA 3TDMA 4AW9A 3NYWA 3NEPX 5I51A 1W5BA 3DONA 3KZXA 5CFLA 2QQEA 4JP3A 4E33A 1Z2AA 2PVSA 2M1ZA 3R20A 4KQMA 3CV3A 4P4SA 4G5RA 4D0RA 1BCRB 4K9MA 1IY2A 1XMJA 1DJPA 2ZG6A 1RBYA 4CV2A 4RVDA 4WAUA 2FWAA 5CYOA 5BNFA 2TMKA 4BRWA 1AUQA 3R24A 4QBKA 3A8TA 3R3HA 1QSGA 3CONA 1V16A 4J1TA 4D9EA 5KREA 4KLNA 4BP1A 6GPBA 4CMIB 3DVLA 5ETJA 4CHTA 4XEHA 3U62A 4CMIA 3KS9A 3N7AA 1YMUA 3BJMA 3GJRA 5KVSA 2Q41A 2H17A 2YJ3A 4Z4QA 4M55A 2C0PA 3TN7A 2EKBA 1P2DA 1IB0A 1HE8B 4RH1A 2X9LA 1RQXA 4RHCA 2AZXA 3TPFA 1GQQA 4ZK6A 1ORVA 4KWIA 2FMXA 1GKLA 2X1LA 4Y1GA 5FBRB 1HDCA 1W1IA 4URFA 3EXAA 3A1SA 2J5RA 4YYEA 4C21A 2G72A 3AJEA 3TR0A 5CDTA 1QGUA 1YJAA 5G0SA 1N5OX 5FWYA 3KSBC 1V8PA 2NZXA 4W9NC 5A0VA 3U4QA 4PQGA 1PGJA 5D87A 4YMTA 2OO7A 3H5OA 4Y9UA 2WR8A 2X3FA 2CUNA 3LUCA 2OHFA 2J32A 3Q9NA 4TQAA 3TR6A 3C3PA 4C06A 2I6XA 2P6MA 4CDMA 1RCUA 3MWEA 4O2LA 5HKAA 5L3VA 2Y0BA 4FYXA 3VAZA 4YAWA 4U7WA 2AWNA 1ORWA 4K03A 2NO1A 2MHCA 2QLNA 4H35A 5CHEA 3GH1A 2JGMA 1EUCB 1NU6A 2OTCA 1CLUA 4NZPA 2W6IA 1OSNA 3DT6A 5EXSA 1CFZA 4BZQA 3VSCA 1ID1A 4BNNA 4KREA 4U2GA 2OR3A 3EVGA 5DZSA 1L4YA 2QX9A 2W2NA 3LUGA 4IIXA 1YAHA 4L3VA 1H94A 3IOBA 3M5DA 2ICAA 1D04A 4Q24A 3L8GA 4Q93A 3I9OA 2FPIB 3ZHSA 4BVAA 1OB5A 2QD2A 2FF7A 1Z25A 1RPJA 2POCA 2JEZA 1GNQA 4MTCA 3EIUA 1UIRA 1B0AA 4RY2A 3R76A 4CKCA 2DE0X 1FRNA 1SIOA 1XWIA 1UK6A 4PHHA 3MBKA 4AMUA 4X3PA 4KXXA 4YJ3B 3MBOA 4KNVA 1CG6A 3I52A 1E66A 2WYOA 5J1SB 1QP4A 3IV6A 1QX4A 2IPAB 3BFJA 2Y1DA 2X13A 3U26A 5IT0A 1GNLA 1YR3A 2ECKA 2O48X 2Z08A 3LPDA 3N70A 1Z0KA 3UT5B 4RHFA 4BGDA 3V1LA 4URYR 5EQTA 4OQEA 4UCQA 3WP1B 3GA0A 1L4GA 4IUYA 5CA0B 1SURA 2O2EA 2ID7A 3H0EA 4KIJA 4KXMA 5CA0A 1C1DA 1ZD1A 5C53B 1L4NA 2H85A 1TB4A 4F4UA 2P2SA 5CLIA 1S2LA 2NAPA 3SN6A 2A0KA 1DC6A 3SDZA 2OBLA 1RWQA 2QVZX 2ZSFA 2GLTA 4G5OA 1EWRA 1IN5A 1ARZA 4MV7A 4C07A 3BC1A 5H8WA 4OMCA 2E6KA 5JY1A 2VQFB 1D4FA 1F8YA 1O94A 3CH6A 3LQKA 4MW5A 2PUVA 1FVHA 3EGDB 4PC1A 4MLCA 4R7TA 1VB5A 3QEMB 1HH4A 2PS9A 2C2XA 3QPUA 1D2MA 1XRLA 3QEMA 1AMUA 4H1WA 1U31A 3LTEA 1E3JA 3Q7SA 4K6HA 3ZWNA 5IX8A 2Q5HA 5TPZD 2C5GA 3PP8A 3KDAA 1ORIA 1ORDA 2XE6A 1U8XX 2W6JD 3I2GA 4OBXA 4U8HA 5B64A 3HZZA 4EHFA 3B8HA 1R3DA 3E9NA 2J4FA 4ZGWA 2IYUA 2I2FA 1KQNA 4RYLA 2VTEA 1JHAA 4F92B 3G59A 2W22A 1SB8A 1TT5A 3AFHA 1OXKB 3GRPA 3QKTA 3W2FA 2HMSA 3O7MA 4K6CA 1VL8A 1YFKA 4GLBA 2CJWB 4U6NA 3ZX4A 1EUYA 4YC7A 4ZZ1A 1EK2A 2XPCA 1U0OC 4H4EA 2BGTA 4H3KB 1G8HA 1N8NA 1T2FA 4B46A 4Q3EA 3LZCA 4MOWA 3G9ZA 4P83A 4QDTA 2G1AA 2BMVA 4RSGA 4BWYA 4DDVA 3COJA 1M2EA 1ZC4A 1N0WA 5CDUA 1DCKA 2AMFA 3HTXA 1LWOA 4UPVA 2WDPA 1A76A 2BEVB 3F6EX 3FUXA 4KFRA 5DM4A 1L7NA 1TCUA 2B0CA 4KSBA 5D51S 5EWLB 3QNMA 3DBRB 1OQAA 3W5SA 1M7HA 5AKEA 3B12A 4FGUA 4KKXB 1JHDA 3BDAA 4NCJA 1W46A 4R1LA 4CTOA 4YJ3F 5BYAA 2BMJA 4HDSB 4HGRA 2J45A 1QRUA 8ADHA 3V1UA 5AM0A 4HDSA 4CTNA 2QENA 1H1LB 1WEKA 4JP1A 1YS4A 4MQBA 2V5AA 4ZT5A 3RKRA 4YT8A 1L7RA 3W5CA 1WG8A 4W1SA 2RBKA 3WMFA 5J2UB 5MHTA 2J3MA 3NP7A 3HDQA 2ARKA 2H7XA 3DMHA 1DWQA 3IELA 5C5CA 1DKNA 2VWPA 4LDRA 3SIRA 1JFVA 3L06A 4CM6A 1PFQA 3LDGA 1K8YB 3PC7A 3M81A 4BLOA 1LNSA 4ZDKA 5AKXA 3A3PA 3HEBA 2FP4A 1PJAA 1SBTA 2PWZA 3MBIA 4MO9A 4V3BA 4DWWA 5B30A 5EIEA 4N3NA 2R5FA 3VNAA 4AJHA 3CM0A 2XF2A 4R6WA 1DAIA 2ZIVB 3BQ9A 4HGPA 3S2EA 4M83A 4KGXA 5GVRA 4Z51A 3RYFA 3UMYA 3G8AA 1V3TA 2P9YA 4UHJA 3C1OA 1EVJA 3H04A 1W44A 4AKEA 1VI5A 1I6WA 1P81A 3OQBA 3DBHB 4J43A 4YCCA 1R0ZA 4ESEA 3HKCA 4GBGA 1FQWA 3FPCA 5HX7A 3THWB 4P7FA 3U16A 1VBMA 1SVNA 3SM9A 3WHIA 1QHXA 2OSBA 1YZLA 1G63A 1CNEA 4R1SA 3FDIA 3HM2A 5DW0A 1CUCA 4YJFB 5C7IO 3W6ZA 1YI8A 4IIJA 4ZVUA 2ASVA 3FOFC 1RC8A 2XRYA 6AT1A 4DR2B 2DWOA 2EFCB 4KITB 1ZKMA 2ZEJA 1YKSA 3LKDA 3PPIA 3UAZA 1NF2A 1YR1A 4GPTA 3NTXA 1UMKA 3EZNA 2FZLA 4TSRA 4US0R 5ALSA 1Q1AA 3PE6A 4EKNB 2C5HA 1NMQA 4HDKB 2ZE5A 2D13A 3T7TA 1Z34A 3ZWCA 2AFIB 3IS3A 1E0KA 1NM5C 1P7YA 2ZBDA 3JSXA 4IAOA 2BCGY 1DAOA 3B1WA 3S1AA 1FBTA 4CE6A 7REQB 1GNTA 2EBWA 4I55F 2OV6A 1R00A 1MR3F 4CKXA 2ZXUA 3R8XA 5AQ1A 1IMJA 1T35A 1Z6ZA 2MYPA 3EOAI 4GW3A 2IPLA 4IF6A 4XAQA 1JG2A 4AM8A 3BSSA 3PLRA 4QUEA 4AJEA 3QH4A 5CNKA 4LE1A 4NDZA 2WB2A 1PG5A 3W3ZB 3I1IA 3CVYA 1VL5A 3R6DA 4MRMB 2DT5A 5AVKA 2OA0A 3FVWA 3SBDA 3BIJA 1R0XA 3ITDA 4ER7A 1L7PA 5FI0B 3NKLA 3FCAA 3NT4A 4P08A 3IDSA 3WLOA 5E95A 2RGNA 4X92A 1K86A 1PT6A 2WPNA 3KJHA 4R1PA 2Q0HA 3CHYA 2WINI 3PJDA 4OO3A 4U6QA 5CGZA 4E2XA 2VUTA 5JIBA 5FBQB 1L9XA 3PNQA 2OWDA 1M2FA 4R2MA 3RGGA 3ORQA 4OHKA 3MQ2A 4LEIA 5KKNB 4WWHA 3SX4A 4ENUA 3BJEA 5LQSA 2GLUA 3HXLA 3AKEA 4KBFA 1HYHA 2GTHA 1KH2A 1W36D 3THSA 3CYFA 8OHMA 4RCZA 3PC8A 1KJNA 2PVCA 2YXNA 3GLIE 3QPAA 1WB6A 3F7TA 3OZIA 1MVLA 3U4IA 1T1EA 4N47A 2GH1A 3ICEA 3AY6A 1EVEA 4YQYA 4K81B 1ULBA 2VRCA 3GZTB 4UVIA 5JO9A 4D9JA 1OXVA 3O8OA 3PQ6A 3PTLA 3L0ZA 2XMCA 4MWBA 1HO3A 4UBNA 2FEOA 3B1XA 5HFAA 3FTEA 2VF2A 1GCGA 2IOHA 2WP0A 3RSZA 3MSXA 3U9SA 2FPWA 4IHKA 1B8PA 2HA6A 2JH8A 2CYAA 3PFNA 3TRFA 1EXVA 2I1WA 1C9JA 3RTBA 4JELA 1TA0A 2ONYA 3AF0A 2ZXEA 3QF4B 3V7UA 3A05A 4J07A 3WIDA 2GBPA 4RKEA 3C7CB 3ROEA 2O59A 1FX1A 1J0DA 2DOKA 2Q21A 1G20A 4U7TB 3M82A 2IW3A 2F1RA 1S4MA 2FI1A 4MCHA 4ZPJA 4P82A 2P40A 3GCWA 3KYCA 4AY3A 2ZCUA 4B74A 4LWZA 4BE7B 4DC0A 3TSOA 2NVWA 2XKKA 1CUBA 1XA4A 4IDBA 4OH7A 1KVQA 3ORFA 5TJ9A 2IIQA 3OZFA 3FSRA 1U2DA 2ZDHA 4LRYA 3UGQA 1HLDA 2ODTX 1ZIDA 1UPCA 1HRKA 4DQKA 1X8JA 4O2AB 1E8NA 3SFVA 4X62B 4V1CA 3F78A 4RVOA 3TOVA 4RK6A 2C1XA 5DHRA 4LBZA 1GKYA 3WLHA 5IRCD 3HXOA 4LJ4A 1D1QA 2DH5A 3B1VA 1ZN2A 3CWQA 3RRXA 1YI1A 2JATA 3CX3A 5JWRA 5AJTA 3IJPA 4I50B 4K9DA 4QTTB 4TTQA 4BY9E 3A4TA 4CFSA 2JAWA 2F8LA 1M9NA 3KWLA 3OMWA 3QX3A 1SKYB 4KO2S 2IKSA 4JSRA 3E3MA 1QCDA 1UUFA 1PJ4A 1R8JA 1XK7A 1DO8A 2BN4A 2FUNB 2QAGC 4IH9A 4MKFA 1FFHA 2YV4A 4A2PA 1NZDA 4B3BA 4B3MB 4KE7A 3Q2OA 5JMPA 1EVYA 2VDLB 3ZI4A 3VVCA 1TEHA 3P0HA 5AIBA 1IN1A 1OREA 4GPIB 3JQEA 4CODB 5BO5A 3DW3X 2AN4A 1JSZA 1XB2A 1UWCA 1BMTA 4OY3A 4Y0AA 1I1HA 2YWHA 1OILA 4NK4A 4M9UA 1RS0A 2CK3D 3AUXA 3DKRA 3FYUB 2W48A 2ZTVA 3A2MA 2JI7A 4MIKA 4UEWA 2VJNA 2V7BA 4IICA 1MEEA 4YIHA 3DL0A 2A3NA 2AC7A 4AAYA 3MFYA 4BJ6A 1JFFA 3D4IA 3V00A 1AOXA 3GJ3A 5FOXA 3LQ4A 2OFFA 3U3XA 2RAUA 4NZ9A 4TKZA 3ONWA 1BDHA 3SZ3A 1I94B 5AVVA 1T3HA 2EW2A 1Y8ZA 2ZRCA 1YS7A 2NWQA 3PWSA 5ELLA 4AURA 3G9UA 1LQUA 1UXJA 1EP3B 1DAFA 1E1YA 1DQZA 2L69A 3HMKA 4LW8A 1NQUA 5FNVA 3ZGNA 2F7SA 1T26A 3W77A 3RVMA 3PD0A 1OWPA 5AVSA 1BX0A 3IC5A 2XA2A 4QXOA 3VR4H 3G7NA 1QF7A 2B0JA 4O02B 3G2MA 3KZ1E 3LXRA 4QTYA 3CR7A 1T43A 4OGKA 3GRKA 2Y0PA 1P31A 2XZPA 1EWYA 5ICSA 3HR4A 1KRWA 1C9NA 3REOA 1UDCA 5T3YA 4I1PA 4O2AF 5FBVB 1SVIA 5DBEX 2GD0A 5CFRA 2DSNA 4LOHA 4DQLA 4GSKA 2QW1A 3EGOA 4FMCB 5DBOA 3TM5A 1L1FA 3JD0A 3N75A 1JH9A 4OSEA 1C7FA 3QK7A 1NBHA 3LDFA 5C51B 2VQEB 1US8A 4I50F 4EDHA 3FTPA 3U1VA 2W8ZA 3TLJA 1P7PA 4L50A 3V42A 1XTBA 2RONA 4AKTA 2YFHA 5KYUB 3F6RA 4KHPB 3ZXUB 4I81A 4CLEA 4DA6A 1GNVA 2WJJA 3FF1A 2YZ2A 2HJ9A 2OBMA 1ZKDA 3O3NB 2MWMA 3ND7A 5L9AA 2Q3JA 1WPRA 2UYYA 4PINA 4BMXA 2WBLC 4GDFA 3VFDA 4AY4A 2WVHA 3LXUX 5GZ1A 4F9FA 4A91A 3NDPA 4YYZA 4V0MA 3TUZC 4QQNA 2Z3ZA 1YZTA 3EPRA 4OJMX 1UPAA 3ABIA 3RIXA 3QMVA 2XMQA 2YINC 3ABRB 3D7NA 3H5LA 4EJSB 2IZOA 2Y9PB 5DI3B 1SIBE 4MQLA 1UXOA 4JEMA 3AUYA 4LJAA 2JFQA 4JY7A 4OQQA 3RNLA