4ZYXA

Human gar transformylase in complex with gar and (s)-2-({4-[4-(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]-pyrimidin-6-yl)butyl]thiophene-2-carbonyl}amino)pentanedioic acid (agf117)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Enzymatic Analysis of Tumor-Targeted Antifolates That Inhibit Glycinamide Ribonucleotide Formyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Trifunctional purine biosynthetic protein adenosine-3
total genus 65
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4zyxA00
2CFIA 1RBQA 4EW2A 4ZZ1A 4S1NA 1ZGHA 3DA8A 4YFVA 3GARA 3W7BA 1ZLYA 1RC1A 3AV3A 3LOUA 1RBYA 1RBMA 4EW3A 4ZYVA 1NJSA 3NRBA 4ZYUA 4NV1A 3R8XA 4DS3A 3OBIA 3Q0IA 1C3EA 2GARA 1FMTA 1YRWA 1MEJA 4Q12A 5J9FA 1GRCA 4TTSA 5CJJA 5J63A 4ZYTA 3TQQA 4QPCA 4ZZ3A 1ZLXA 3O1LA 4TS4A 4ZYZA 1RBZA 1CDDA 1RC0A 3DCJA 3TQRA 4IQFA 3P9XA 4ZYXA 4QPDA 1MENA 1GARA 2BW0A 4ZZ2A 2BLNA 1JKXA 1S3IA 1CDEA 4ZYYA 4TT8A 4EW1A 1C2TA 4ZYWA 2YWRA 3AUFA 4PZUA 4R8VA 1MEOA 4ZZ0A 3N0VA 4YFYA 3KCQA 2FMTA
chains in the Genus database with same CATH superfamily
1H2ZA 1CUXA 4RA6B 2FEKA 5I7RA 4J0KA 1TKBA 1N8TA 4OMDA 3OE5A 4I8IA 2RGWA 4F5WA 5ICCA 1JBEA 1FSSA 3BOSA 4IXTA 4JEMA 4P5DA 5CGZA 2HJ9A 4URZR 1C9MA 4Z4CA 4FR2A 1Y8CA 3EDQA 5BVHB 3ZDDA 1XKTA 1L5YA 3BGVA 1QK3A 1Z15A 1SQ5A 2H1FA 1OYVA 3OZFA 3U1BA 3EZ9A 3QUCA 1IOVA 4HB2A 2DQYA 4CMKA 2PXCA 2AXPA 3HY3A 4CHTA 5AKEA 4ZXPA 3CLSC 2M9MA 4MTCA 4ZAFA 4B7XA 4I1PA 1L3IA 2PLWA 3DE1X 3JWHA 1L4EA 1PW7A 3OQ1A 5FOUA 3C1TA 5DRTA 3WDLA 1MAVA 1P6XA 2G9ZA 1U81A 1PLLA 1FNDA 1G38A 1YQTA 1SUSA 2YMLA 1I7QB 3KXLA 3C7AA 4MUEA 3GLIE 1GPDG 3R4CA 1VA4A 1TQ4A 1KDTA 1UPXA 1BROA 3O8BA 1RRGA 1OLXB 4RPLA 2H18A 1FP2A 3GNQA 3MS2A 2YQ5A 4ZV7A 2B36A 4AZSA 5JJ5A 3P9KA 3HKBA 1X15A 3H2BA 3DBRA 5CJJA 1AUXA 4L0DA 4U9IS 1E6EA 3WZMA 1GRRA 2VR1A 1ZH6A 2H4ZA 5KNDH 2F8SA 1U3UA 1R9GA 2V7UA 3C98A 4GL4A 3VOAA 4PAOA 2QTGA 2FOLA 2P77A 2WAAA 1PRYA 2G40A 3IQEA 4MYSA 3HO1A 1YMVA 1ZOPA 2G04A 2NNLD 1L7RA 1R66A 1UC5B 4MKZA 5FR2A 2YYSA 1LCIA 3OY7A 1LEHA 2P4HX 3LP8A 3AHEA 3QA3E 3REOA 5ALWA 3VV3A 5AJUA 5DLYA 3ZOZA 1G1MA 1VPVA 3IYLW 5CT6A 3QQ5A 4HZUA 1RBYA 3T5CA 1AMOA 5KO2A 2WE8A 4B09A 1EB9A 2DQ4A 2FX2A 2CZCA 2J7PA 2VVTA 1DXHA 3HVIA 3N05A 3UT5A 3E5HA 2Z6VA 1E0DA 3WWPA 4ETNA 1IUNA 4M86A 5JO9A 4M8KA 3EZGA 1Y1PA 3C87A 1RQLA 3LCJA 4U5QA 4MUAA 3MYYA 4OI1A 3VPBA 1SURA 1E2DA 1H8HD 1V96A 3R4VA 1XPOA 3PFHA 4Z1OA 2HDNB 5AUNB 1TQHA 1R9NA 3B9PA 4TV8F 4C6SA 2GZSA 2BHSA 1E63A 1JH8A 3PI6A 2YWXA 5GZ6A 1KK3A 5IDQA 1GKLA 1ZP6A 1BEZA 4G0PA 1SC1A 5HX7A 3B3AA 5L4NA 5CCDA 1EM6A 1FTWA 4ZVQA 2YZMA 1ZCFA 1WY5A 4UHDA 1ENYA 2OK7A 2B1QA 3HLTA 1U0JA 3MTGA 2PL3A 3IIJA 1G4AE 1LV8A 4FFOA 3VFDA 4A9AA 4PSCA 4RS4A 4Y6PA 2D1RA 2H5IA 3IFSA 4QYXA 1SHTX 3UTCA 1OVMA 1Z26A 2EFGA 5AP9A 1CUEA 2EHJA 3CNQS 3SS7X 4D9JA 1QZUA 5JSZB 2RGCA 3WE7A 4G1MB 2YXDA 3VH2A 4DIOA 2M6LA 3TZEA 2HSGA 3HDGA 3BQMB 1T1SA 4EEKA 2H7CA 1ORHA 5JYBA 3VSBA 1FFXB 4NE2A 3K7EA 5DHPA 2P6MA 5G1OA 5TPWB 2P4SA 2QZJA 2C84A 3G7UA 1SC6A 1KWGA 4C7VA 1JWBB 4G23A 1XTIA 1CP2A 1KZ1A 4HUJA 2XNDD 4QU5A 3H13A 3U3JA 4F97A 3ADBA 5AVWA 4CV1A 3N2NA 4G85A 1FA9A 3GFPA 3D8RA 3DWFA 1Y1SA 4QOJA 3RPEA 3VR4A 4AECA 3BORA 5JZVA 2FLKA 1GA4A 1FNSA 3DL7A 1NURA 3D7MA 4KAAA 2ZSHA 4YUAA 4TMYA 2ID7A 2ZAYA 2FPKA 3QVVA 1JHOA 2VF4X 2P3SA 4NJEA 2GAFA 4MB0A 2XQGA 3VPDA 1P0IA 2HJWA 2GLXA 3RYIA 2JI7A 1V1MA 1C9DB 1CDOA 1G8AA 1UXKA 2BEWB 2JGFA 4BC0A 1Z34A 5IBCA 3KT8A 1KJ8A 1MUUA 3CPEA 3MBIA 3P5BA 3PJEA 3S68A 1G6Q1 4J07A 1KZYC 3K0AB 4N3NA 5I45A 3AVUA 2GPTA 1X1QA 3PC3A 3CVOA 3HB9A 4KIUA 1M83A 3L7LA 3SFZA 5K8VA 4BV8A 2OG2A 2J9FB 3TOSA 6CHYA 3RG2A 3LF1A 4JQOA 4W5JA 3T9AA 1F4LA 3ICWA 1FLAA 4XAQA 3FCSB 5BY2A 1AH2A 4R01A 1XVVA 1E2FA 1PZGA 2IE8A 5ELMA 3RAFC 1OC2A 4I3FA 1PN3A 4ZC8A 3X2SA 1IZ0A 1Q92A 2A9PA 2PUTA 2FHPA 3ZWPA 2DGDA 2P3OA 2QZZA 1RXWA 4XEHA 5B7GA 1B74A 1K97A 3IPCA 2GDZA 3F49S 4X20B 4L0QA 4NBRA 2BFCA 3N8HA 1R74A 2IHYA 4K40A 5FUBA 2ACWA 4YN3A 4C20A 1ETHA 4F4HA 2QQGA 1AKMA 1M2GA 3GHHA 5JARA 2Z1NA 1E8DA 3O4FA 4PLWA 2IJGX 3ID6C 1E6LA 1OX6A 3A1CA 1Z07A 3BWCA 5DBEX 3VZPA 4II3A 4NQRA 4GI5A 3SHFA 2CJXA 2M1XA 4WNAB 3H3XA 3SR4A 2J3KA 3ANXA 4XLZA 2QRVB 4EYEA 3EXHA 1GT6A 4A8HA 1XLTA 3BF7A 3EXEA 4OHVA 4BMCA 1VLZA 3RRMA 2BC9A 3IBGA 3WJ7A 4JUAA 2XCLA 4WKNA 3UMYA 1FRVA 2ZRMA 1WCWA 2IQIA 5CLQA 1CUVA 1DWUA 3GK3A 4RMIA 3WS7A 3QFCA 1N2BA 4HNQA 1P4SA 1OMOA 1JIUA 2JHPA 1OGJA 3PE3A 4UUAA 3EOZA 4EG1A 4WESA 4G6ZA 1J8DA 3T1YB 1XTPA 1XCOA 4JLMA 1C2YA 4PU0A 3HXTA 3ZU5A 3VKGA 1Q7TA 2HPZA 2XD4A 3AL3A 3TZ6A 2OCLA 3O2QB 3UB4A 4ZDJA 3PDUA 4G5RA 2HPVA 3ISTA 3VC1A 4P58A 5HMMA 4DWWA 4Y2XA 4E32A 3OE4A 4E2YA 5EMHA 3VJLA 2J3HA 5A6SA 1VYHA 1Y42X 2RK6A 3FSJX 2QLLA 3IJEB 2D0OB 2HPHA 3QE0A 4LGCA 4EL0A 5ALOA 4S2EA 4MQFB 3W1VA 5TQJA 2OPHA 2EKZA 3SJBA 1CS0B 3QEJA 1ELOA 4YMGA 4OGKA 1P73A 3DHNA 3W5IA 2B1GA 4JLVA 2C9ZA 1NVBA 2JW5A 4RK1A 2GK3A 4ARZB 5I7OA 5HFAA 3EWIA 5DASA 5AK6A 3K09A 4OD0A 3O8CA 1DT3A 2XXBA 1TT7A 3U2QA 3KZVA 2Q9CA 5AXAA 3NORA 2I54A 3L0PA 3BDAA 4X63A 3BJRA 3FUUA 3H84A 1WCIB 5BVHA 3VRHA 1XCJA 3B13B 4JP3A 4RA9A 1D2GA 1CBUA 1CKEA 1WU7A 2ZYHA 4UAVA 4WCVA 5FPYA 4NCJA 1WMEA 4QATA 3WDKA 5HQTA 3E7FA 5L6LB 2CDCA 1QV9A 4LE0A 3TPZA 1BMQA 1AB5A 1SBHA 2XA2A 5EIEA 4CNBA 2XB4A 4DIUA 4Y1RA 2G83A 1YBFA 2VLIA 4PSDA 4QDJA 3JAWB 4L9AA 2AXQA 2FE4A 2MSWA 4QVGA 4WY8A 4HAIA 4MICA 4AUEA 2R44A 1DTWB 1X74A 4QEKA 3RS2A 4QKQA 5DBIA 3I0ZA 4MVJF 3VKUA 2H3EA 5EGNA 3FR7A 4UVIA 2GXAA 1ISSA 2C00A 3G2OA 5ESRA 1Q0QA 3THYA 1NZJA 1PFKA 1T0UA 2GYYA 3AO0B 3CJQA 1QLWA 1OIXA 4QOSA 3HVHA 1ZN7A 3S29A 4JXJA 5LWQA 2FZVA 1ZGBA 3IB6A 3OPVA 3U7IA 1OZ0A 3X1ZA 5CHYA 3LCMA 1KF0A 2HBZA 4FKBA 5DYWA 3GLSA 2Q27A 4WEQA 4D57A 2X8BA 2CNLA 1WXXA 2H11A 3M4XA 2CKDA 3TDNA 5CB6A 4F5EA 2CL5A 2IXBA 4QUAA 3ZDCA 4NFLA 2YWBA 1SWVA 3FZGA 1FS6A 3BK7A 3D4NA 3THSA 1YSCA 3LDUA 3K9BA 4P7JA 4H6XA 4L08A 5A71A 4ZVUA 2WUEA 2XDAA 3L1KA 4JSYA 2A4MA 1IN1A 2GMWA 4QTXA 3C24A 1KEEA 2UYCA 1K0FA 1T9BA 1T9AA 3LUFA 1WZCA 2Z56A 4V02A 4YDHB 2RG1A 3WO0A 3JQQA 1ZLYA 3OCUA 4KGDA 1NOJA 3U19A 4AG5A 3VZQA 5K2MA 4J0JA 2FFHA 3LBNA 1H2RS 3WOHA 5EKDA 4BEJA 1Q15A 3AR3A 2GYVA 3K1ZA 4JL8A 1HFWA 1VSVA 2Q6OA 4HC4A 5IVDA 3STWA 3SQOA 3C3CA 2NADA 1ZGGA 2QL6A 4P53A 3EQZA 4BLWA 5IPFA 1DQYA 5FFMA 1W1UA 4YP5A 1R8JA 2G63A 4C4TA 3Q1LA 4ZD6A 4B4WA 5LC1A 1JTVA 1XZHA 4YAUA 3Q7QA 3IP9A 3KAJA 3W5UA 3WGQA 4BMNA 2D8MA 5CIYA 1AOXA 3AUYA 5DHRA 1VOTA 2JFPA 2J6CA 2RHLA 3UV6A 4EX7A 2J41A 4XFKA 3A3OA 4FNGA 3T6KA 1FK8A 1MQSA 4V0SA 4P98A 3H17A 1SIOA 3FPLA 4YRZA 1EHYA 3T34A 3UOGA 3ZGZA 1EUDA 1QS0A 1NHWA 1TNDA 3O8NA 3BJEA 3RT1A 2Q3BA 4DS3A 3EF3A 1NN0A 2OXFA 2Z0MA 4M0DA 1T10A 1NE7A 3F7OA 3BXXA 3LRXA 3U9TA 4MW1A 2I2XB 5ENZA 3UOAB 3WNQA 3T12A 5LZ7A 4E5SA 1TO2E 1US8A 1PE0A 4K6CA 1YDEA 4R1LA 3QVGA 1CQPA 1EQUA 4ZIRA 1T0PA 3R3ZA 5CK4A 1FFWA 2BN4A 1TK9A 2C94A 4WKGA 1E3JA 2XDWA 3JAKB 3NBMA 3HFSA 3I37X 4X91A 5A3SA 3ENQA 4UATA 1SXJC 4H1HA 5L3SA 3NUZA 4B31A 3T0IA 1Q1QA 2ZWPA 4OKSA 3X1KA 4DBZA 3GN1A 4O3FA 2JVJA 1NWHA 4X41A 2IV2X 3GA7A 2JIOA 3DL2A 3GLTA 3INTA 3M33A 4RZ3A 1SC9A 4BVEA 2BJWA 3PEEA 4MGKR 4MV6A 3G5TA 2VCEA 3A1NA 2GAIA 3Q3EA 4GDMA 4I2NA 1U0TA 4IRUB 4LMBA 3H6KA 4GFDA 4A0SA 1UPFA 1E5TA 1ZDMA 1J0XO 2QRJA 3GJ3A 4JJ8A 3U62A 3AZQA 2JLVA 2HLHA 1ORVA 2IXEA 3AR7A 2IYRA 1F51E 1QH9A 4EMBA 3H5IA 5FWXB 3U81A 3EA0A 4G8DA 3R3VA 4MQUA 4S05A 1ESNA 4PO1A 4QYIB 3ACBA 4AICA 1H42A 3VUEA 3N3AC 3V9PA 3LJKA 4INJA 3H2SA 3WGIA 4P9NA 1N5RA 4MV3A 2EWVA 3VHXA 1RWBA 3LHIA 5NLLA 3RT9A 1UMCA 4KJZA 3L6RA 1JEOA 4XPIB 4TV9A 3UMJA 1L7NA 3ZWCA 1LKZA 2KM1A 4IJWA 3KJIA 3A11A 2BGMA 2AE1A 3CEAA 1J2UA 5E4FA 4DYHA 5DHSA 2IZOA 1C9NA 1LV7A 3HV2A 4DJEC 1EX9A 4MKGA 1ZH2A 2OMEA 1UWKA 4CTKA 3DBLA 2ZYSA 3CUVA 4RF2A 5EHGA 1QP0A 1A7AA 2JBHA 4DLVA 2R1UA 1PG0A 5LM3A 3AILA 1JVSA 4FFPA 4FNMA 4WCFA 3PX2A 1N5LA 1C3LA 3VZCA 4TLEA 5FNVF 1RIIA 2YZKA 2ZQZA 4N7BA 5KS2A 1FF9A 4HL6A 6PFKA 4K3VA 2ZTLA 4QRHA 3SWWA 1CLEA 2Q46A 1JT2A 1RRVA 2AN9A 3R6GA 4KUEA 3G2JA 1PR9A 1V43A 4PRKA 4Y2JA 2HRCA 5BNFA 4GH5A 1OJ7A 4F0JA 3ZWQA 1F1JA 1IZ7A 3E5NA 2VJLA 2AYZA 3PR2B 3W2GA 5C35A 2A1TR 1BA3A 1MOQA 1BGXT 1V8FA 1VECA 2JI4A 2E55A 2ODNA 1QXSA 3LGSA 4FCVA 4PCVA 5F4ZA 5T4FA 4DUZB 3AG5A 4IQFA 1E96A 4K87A 3RU2A 1OJLA 1RRMA 2ZJZA 2IIQA 3D4OA 3UG7A 1PFWA 2C9MA 1UDBA 2IEZA 1ISFA 2WU0A 1GZHB 3GAZA 3LIIA 5LQRA 1V1JA 1XX6A 2IODA 1DBRA 3IEVA 4X84A 2PSHA 4WOKA 4HEA1 1NE2A 4E3ZA 1RAGA 1R9MA 1XQWA 2QMHA 5BYAA 4M7PA 1ONPA 3GEDA 2C04A 2VJQA 2GN0A 1CUUA 1WU8A 1J99A 5AJHA 4X24A 3RYCA 2X8AA 5AW5A 5P8WA 3T4EA 4BO3A 1MFPA 3PCTA 2DT8A 1ZCBA 4UUOA 4YT8A 5A2QA 7GPBA 5IBQA 5JXHA 3FYHA 2XB2A 2AMLA 2NIPA 4N7MA 3R9WA 4E2XA 3A8TA 4UUNA 2BL4A 5JAZA 5D84A 2YXPX 4JX8A 2QUZA 5EFOA 4EHJA 4NCBA 2WOJA 2I99A 1SFRA 1UMCB 1Z0IA 3L4BA 4MVJE 4JBNA 4XPIA 3HYCA 5E7MA 2P2CA 1U1DA 4KQEA 3GUYA 4FZ3A 3V8VA 2Q4OA 5JATA 1QH1B 1T1IA 5MN6A 1FFXA 4QGSA 2DY0A 4I2VA 4PG5A 3GLIB 2HUNA 2J0SA 2PRYA 5FPTA 3IO5A 1KBZA 5I9MA 1UT5A 3EVFA 4DQKA 2QQEA 4G81A 4US2R 3U13A 2OMKA 4P86A 4MRSA 4TSFA 5D6OA 5EYPB 3OTWA 4G0OA 3FAZA 4KVGA 4HEJA 3AEYA 1K1EA 4S3MA 5DPMA 3LC0A 5AK0A 3UV7A 1BDJA 4CG1A 4EDHA 2QQ5A 3AL2A 1JXOA 2GETA 4OSEA 4QGHA 2Q5CA 1V4BA 5AKGA 4C4XA 2PKEA 1GTSA 1NQVA 1XMOB 4BNFA 4UZFA 3T4XA 3IEIA 2SHKA 3DPIA 3SIPA 5LR6A 3BZUA 3QE9Y 2GNOA 2CK3D 4DUGA 2WD7A 3PFBA 4HN4B 1NXVA 1U0FA 3LA8A 4BO4A 2FPXA 1CS4C 7AT1A 2C0CA 3A2KA 4MDYA 3WKBA 4Y2QA 1QUFA 4KQ9A 3UMFA 4IUCS 1TI7A 1I4WA 1K3TA 4DF3A 3DHEA 4HMOA 1SULA 2DSTA 4ZCLA 1QIJA 2OQ2A 4MP6A 3HKCA 4E6EA 3FZEA 1X8KA 3AV3A 2PBFA 1G8FA 4F1JA 2EEZA 1XE3A 2ZP1A 3KAKA 4RGVA 4GI1A 1U0SY 4PZYA 3OQIB 3ZLBA 1US8B 1Y1RA 5IN5A 1MFZA 1LNSA 3BREA 3UJDA 2EYUA 4B6RA 4RL6A 3BWDD 1AGRA 1Y4UA 1JPNA 2NZWA 3DF9A 1PSWA 1H9BA 2TRSB 3SZRA 1BWQA 3L7NA 3O8OB 2HIGA 4D74A 3HM9A 4YXFA 1M9NA 4ON9A 1KIAA 1D3AA 1AKYA 1P77A 3EOBI 3KJZA 2EXXA 2ZCVA 2DETA 1RKVA 3BSWA 2ZJ7A 4GC9A 4GPTA 5HA5A 3RRXA 4D2IA 5DN6D 1VQ1A 1ZL2A 3GJ8A 4S1OA 1DC6A 1KQPA 5GIPE 1CD5A 5DSZA 3ZWAA 3Q4GA 3D0RA 1ZD8A 2V5UA 5LOVB 4DG5A 1BA2A 1JN0A 4JLNA 5EE1A 1VCIA 2AB0A 1U5AA 2O05A 2Z83A 3T7IA 5KOJA 3R9XA 1YJCA 4ARSA 3PJFA 5E3HA 3I73A 5HK9A 3ADKA 3H5NA 3PC8A 2XCIA 1AUPA 2AXNA 4EKEA 2AUNA 1H65A 3NHJA 1MJFA 3C7KA 3S5JA 3UJAA 4FPXA 4YPVA 4P80A 2HEIA 4R2HA 5DKFA 3N86A 3L8MA 5KQRA 2C7VA 4IH9A 3W8RA 3E8SA 5D00A 4YTEA 5K0GA 3I2KA 3EMDA 3MTIA 3WWDA 1W36B 3DL0A 1RABA 2DHDA 4ML3A 2R751 3AESB 3ELYA 1IHDA 4J43A 4L02A 5IJXA 2A8YA 4F4DA 3KEGA 4ENPA 5DGCA 4C3UA 2C2ZA 1ZD5A 3BHJA 2C42A 1VL6A 3ONNA 5DM4A 1JLLA 4AUKA 1E0AA 2I29A 1FZTA 1OIWA 3N39C 3I5UA 2QMQA 5CPBA 2XRZA 1I6KA 5CB0A 1XGKA 4RESA 3B9RA 4C9BA 3EZ2A 3V1TC 1WETA 3BMXA 2Y1OA 4H7JA 5DXAA 1E9BA 1X7YB 3Q9UA 5CA0F 3TG2A 2GS9A 3PBKA 2CNOA 4A2PA 4RTQA 2ZI3A 3R5TA 4OMCA 1WG8A 2I3GA 2C98A 2PU5A 2QRHA 3C16C 3C3YA 4IOLA 2P9JA 4XEUA 3M5DA 3ABRB 2YQZA 3G79A 1UBOS 1TK2A 1U0HC 3IQFA 3K15A 2K4MA 3U48A 4AJ2A 2IU6A 3PCXA 1GT91 1KVSA 2ZREA 4XI9A 2G4VA 4U02A 4HDNA 4AZVA 4E70A 1AXGA 1QIDA 4IWYA 1T2UA 4OLBA 1JA0A 2V4UA 4QJIA 2P68A 1NVTA 3UMRA 2ZVJA 4QA9A 3JASB 5HGXA 1MABA 1EG7A 3GJSA 3L82B 4GMHA 5C3MA 1M2OA 3M1AA 5AM3A 3URKA 2HV9A 2P11A 1KYZA 5KKCA 2RH9B 5H4HA 5TXGA 4WI1A 4DB4A 5DRYA 3ZY5A 2D06A 4FMDF 3JXEA 1YA4A 2BISA 4JGGA 2W0SA 2P2NA 1AZWA 5C7LO 1PX0A 4PLGA 3ZS9A 4D45A 3RDPA 4Z7JA 4LTNA 2MINA 4MAAA 4QXOA 4LMAA 3K5WA 2FWNA 3BBPA 3PNKA 4HT3B 5LDDC 3OQVA 4OLAA 4FX5A 1IDN1 3O4HA 5HIJA 4CFSA 2V7BA 3NNNA 2J9RA 1OXUA 3GFVA 1GLNA 4ALMA 4AKGA 1G6HA 4X20A 1H0KA 2GBFA 1FJHA 1RTTA 3KXDA 3NZEA 3KUXA 4MW5A 3RQSA 1JEEA 1T43A 3KYCB 1ZD2P 1G7CA 3MJEA 4IHJA 4KO3S 3ZJYA 4X0EA 4DIKA 1S3IA 3DKIA 4POOA 5HZGA 3JATA 3PGA1 2J6IA 3ZV5A 3URMA 4BOYA 3KHKA 2WP8J 3HWRA 4D8YA 1PZXA 3PUJA 121PA 4C78A 3D7KA 4DNFA 3BD6A 2J3JA 4PLYA 1KXJA 2NT3A 3QIVA 1DFGA 4KQXA 2W70A 2WZCA 1M8PA 3F73A 1AKRA 3UXEA 4B6EA 1WJGA 2HU8A 2X6RA 1D04A 4G1EB 1IY1A 4WASA 5EKTA 4PFSA 2GAOA 3WHPA 2A5DA 4E5MA 2C9OA 5IP5A 1HNZB 1X7WB 3I52A 2XPCA 4LZZA 1JEQB 4S35A 3CX7A 1WUIS 4X64B 3BIOA 1YTUA 4UJ3A 1E7YA 4NBWA 2FXVA 2B21A 4HGYA 2Y4OA 5F2KA 4AURA 4EELA 2REQB 1GQSA 2HWUA 5LYJB 1TJ4A 5A0VA 3GMIA 1X8XA 2FW9A 3FZYA 4IEFB 2VZ8A 4L3VA 4M38A 3HP7A 3JV7A 5HHTA 3CO5A 2I6XA 4D56A 1GFSA 5ELLA 1XOIA 5JXGA 1HG0A 1QG6A 2Y71A 1V45E 3EH1A 1W5AA 1F5NA 4F06A 4CIDA 4W7HA 3QLEA 3GGOA 2HRRA 3HY4A 4JGIA 3CSDA 4HY3A 5DW0A 4NJMA 5BUCA 1G18A 5TT1A 5J2UB 3EHEA 4JUDX 2YV1A 2X14A 5CURA 1AK2A 3RIHA 5JS7A 4URHA 1O5IA 1EDOA 1L5LA 1VBNA 5K6AC 1GARA 2WWRA 2GQ0A 2FXIA 1YRYE 4PONA 4CQLB 3H99A 5D1NA 4FOOA 3MNFA 4ILKA 4PLVA 3QVMA 3MRVA 1HOXA 3NJ8A 3VO2A 2I4LA 2OVFA 2QK4A 4WZBA 3EISA 1Y8QB 1UKBA 1F4VA 4FHCA 3W34A 1Z5ZA 1G8MA 3ZDZB 1YZFA 2IYOA 1ISMA 1PAUA 2C57A 3IXQA 2C9BA 5LBIA 4HNAB 1YZUA 1KYIA 2AJCA 1R6XA 2QZ4A 2HF9A 2XT0A 4ZVTA 4R40A 3MSXA 4R2KA 3EZ7A 3SE0A 2BV3A 2FF7A 3OHPA 3HDVA 2I33A 4EPVA 2C4KA 1OOEA 5B7PA 4PAGA 2Z3VA 4OA8A 4R6XA 2ECPA 1F0PA 5JSUA 2ZWAA 4R1OA 3U7QB 4D99A 1JRLA 2J87A 2FR1A 2VTDA 3PNOA 1UXGA 2UV8A 1OBOA 2WD8A 3NCTA 3VSAA 5CLFA 5KSWB 2HBYA 4RJLA 4QVIA 4PIMA 1FJXA 5KNDA 2QG4A 1Z4OA 1P33A 4BATA 4LXIA 1DC3A 4RTNA 4JOQA 2QN9A 1TC1A 4JVMA 4F6RB 2LRHA 3I58A 4YUWA 3EPHA 4HN2A 4NS4A 1U99A 2VPPA 5ALZA 2FSPA 3QKSA 1CWUA 2I34A 3RREA 4HEQA 1NUAA 1WD5A 3WBKA 1U7PA 2M32A 3CR3C 2YS6A 1BXRA 3GRYA 2XKBA 1M2KA 2PV7A 4N6GA 4WAUA 2ZCJA 2BPOA 3Q7PA 1T5IA 2FPLA 3AINA 3Q3JB 4HQ6A 2G76A 1CDDA 2GA9A 3QM1A 2Y9PB 4DJJA 5KNBA 2YW2A 1K98A 2PUVA 5FJJA 2GRJA 3VOBA 3W0LB 3C5HA 1RM3A 3OM9A 3OEHA 4V3CA 1SGWA 3AEUB 3EVNA 1H6BA 2COUA 3P4YA 4GECA 4DG8A 2H2IA 4HB3A 5JXIA 1RXSA 1FFBA 3VU9B 4OBBA 3E70C 2VH2A 1SBIA 4LRUA 1YZHA 1PFGA 2P0YA 1DS6A 3OM8A 2OHOA 1DQPA 4O2AF 5AJTA 1D1PA 1JDTA 3ICOA 3VH1A 2Z4RA 4XYMA 1GTL1 1O9HA 3ZE8A 4GWGA 1TW3A 2IKSA 5I4KA 1IRXA 1FY2A 1GNRA 1KJYA 4I4NA 4C4AA 3VPXA 3R3YA 1FYEA 1KZ7B 1FP6A 3MMPA 4RU1A 4EKDA 1ABBA 4YRTA 5BVGA 3QKUA 1LSSA 3DOFA 3O1LA 1T9HA 4HEA6 4X95A 4FHEA 3T5GA 5KREA 1I4TD 1Z4IA 1ZICA 2WUVA 2XQJA 3B60A 4M60A 4OXQA 5B3JA 1U6KA 4J6FA 4UU8A 4AROA 4EGSA 4DWOA 1OWMA 1NONA 3TSOA 4E1VA 2O0LA 3I9KA 1TC2A 2AW5A 1NJ2A 5BSWA 2I4OA 2VPXA 3TSZA 4ZEWA 3AESA 3UAWA 1FC0A 2GNAA 3K4QA 1E6UA 4V0ME 3MN1A 5HKBA 2FFBA 2G70A 3SHOA 2ZB8A 4RZXA 2DUJA 1KORA 1CB0A 3BKWA 2B6HA 2H9IA 4TT3D 4AMZA 4F9TA 4A26A 5IF9A 1N33B 4HMPA 3HO8A 1ZUIA 4KVFA 3FTEA 1BG6A 1UAYA 3VYRB 1FUIA 2HSEA 3ABQB 1SBQA 1ZIDA 5B1SA 3T3EA 1P5ZB 2ST1A 1L7MA 2GD1O 1QGOA 4I8DA 4A36A 2IHZA 1G9XA 2JARA 3E1GA 4DKJA 4YEDA 5DNVA 3ZJUA 4PZUA 1MJ5A 1YMUA 1GL6A 5DLPA 3B1VA 1KC1A 3HPRA 3AERB 5F64A 4MJ3A 4BN5A 3OEYA 1E69A 1IHYA 3BA6A 3JARA 4A6PA 4DJDC 1XRJA 3R9KA 4F45A 4EBFA 2MIIA 1MOSA 3PNBA 1KKMA 2BKUA 4FN4A 5HR5A 3HG7A 3JR7A 3TJRA 2J3EA 2I4TA 4N39A 2B5WA 1PGPA 4Q9DA 3AR6A 3AOEA 3X1JA 1ISHA 3KJFA 4N03A 3SHVA 4ZOCA 3KZNA 3KKNA 2XMBA 1KL7A 1Z0ZA 1ISRA 3L40A 5F52A 3W8NA 3CVXA 2G9UA 2X4DA 4RK5A 1RI3A 3K3PA 2I7TA 4JNKA 2AX4A 2VQ6A 4KAJA 4GBGA 3W04A 2Y1FA 2AZDA 3ZHRA 4F7DA 4F2HA 2QT1A 4BL5A 1P60A 3FRIA 2W6CX 5AUQA 3WZ2A 1KO1A 1MPTA 5K3CA 1P9OA 2WYIA 2O5VA 5AHXA 1MGPA 3QEKA 3TOVA 1U2DA 3PDJA 1JF8A 1Q14A 1QHIA 4TKZA 2QNIA 3FMOB 2NUAB 4JL6A 4UAUA 4EW3A 2VSQA 3MG9A 2WB4A 5TY0A 4DJ5X 4V0NA 2WKPA 3ZBQA 4NKRA 1D1QA 2EJBA 2XKJE 4JU9A 1ZD9A 3QPCA 3TW8A 4DFDA 1KEPA 2CXOA 2GFHA 2ZGVA 3IMEA 2G08A 2I67A 2QMUA 4UU0A 3SZOA 5ITWA 2KB0A 4GOLD 5ERYA 1IXRC 4BQRA 2F1JA 4ZCRA 4RQBA 3I5MA 2IPMA 3C6ZA 1QZXA 3SU8A 1SD2A 3HYSA 3O8QA 2RIRA 5IAKA 4CCYB 3LQRA 2H5EA 5H9WA 3TAHA 3NVKI 1AG9A 2AA3A 1CERA 4E5NA 1L2TA 1F0YA 2O4CA 5EP4A 4ZN6A 1ZO8A 4RDCA 4BNIA 2OXCA 4ZI7A 1UFRA 4IUDS 8ATCA 1X87A 1J1UA 2W2VA 1TGYA 3RHZA 1L4NA 2X0KA 4YA6A 4IIVA 2L17A 4OATA 2BZ1A 1SR8A 5D3QA 3SJAA 3X0DA 4BB0A 5CBPA 5JZ9A 4AT1A 3TS1A 1VLQA 2ZJ5A 5BWBA 2FN4A 2YQ4A 3NC0C 4ZU3A 4CR8A 1YUBA 2DKOA 3T8YA 5JV5A 3GROA 3P32A 5EWLA 4I5EA 1JFVA 1R8XA 1UP4A 3IKLA 1U8EA 3H8WA 4C06A 1DMRA 2GNPA 2VLBA 2Z2ZA 1PGNA 1MT0A 1YB7A 3PUHA 2ENUA 1UBTS 5HIMA 3HQ4O 4UM8B 3AEQB 5ALSA 5CDTA 4WDRA 1CY0A 3HJBA 1OXBB 3K9NA 5A3QA 1JYEA 1XF9A 4DA4A 3RQIA 3JD3A 4WBXC 3VHLB 4B82A 4YRAA 1HO3A 1X7HA 1G5IA 3LA6A 2AKEA 1NOKA 3KKQA 2RE8A 5J23A 4L85A 5CP8A 4RVGA 3TD6A 3AEUA 1GZ5A 1QSGA 3UG6A 1GNVA 5HUQA 2BFDB 2GKGA 3MJTA 3DTNA 1LRKA 2CHEA 2H4WA 3AGPA 4BFZA 1VLVA 1Z88A 2H6EA 3MQFA 4BUCA 1VYUA 4HV4A 4JYAB 1NBWB 4DHWA 4NLLA 3FSRA 1UT6A 4X1IB 2MHCA 2BMEA 1HZZC 4RIIA 5EXSA 3RSLA 1SVIA 2VL7A 2VPQA 3NALA 3QF4A 2OB2A 1OFIA 4X97A 5P21A 4CM8A 4GE3A 2IXTA 2Q62A 4H7HA 4YRBA 1E2GA 3O6VA 2C4TA 4I55B 2CYBA 4OHFA 1P1JA 3KQPA 2VRWA 4LJ9A 4U5XA 5FA8A 5EIFA 3L07A 5C31A 2FW8A 4ANFA 3EVTA 1FVHA 4P2GA 2WMOB 2W2LA 2ZULA 3IJPA 4U0KA 1TF5A 2XKKA 3NKFA 3TNDA 2HLPA 1RYEA 1V95A 3RG8A 1PI3A 1GUBA 3JD4A 1SUCA 1GPWB 4ZDKA 5JI3E 5LYJF 5C5DA 1V39A 3TR0A 2P41A 3AH8A 1BE6A 1KI3A 3OFSA 3EXHB 3QTLA 3WWCA 4BZQA 1C4XA 1NU6A 2JAXA 1G55A 4NEHB 3LKVA 4YUVA 1HE2A 1KIMA 4J3FA 2H1OA 1W29A 1E62A 2GN6A 4L73A 5DU2A 1LLUA 1Y5RA 3N70A 3PFKA 1L7QA 2GK7A 4KFCA 4Z4FA 2ZYRA 3AIOA 1R5BA 1LSOA 2BFBA 2R7MA 4EUKA 2GASA 1K4YA 4IFEA 5AOAA 4XFJA 2M98A 4MQEB 4LJKA 5TF4A 3PFWO 1PL0A 1I2AA 2M1ZA 3DD1A 1DINA 2P5YA 4NOMA 5FWDA 3SSMA 4RXTA 4EAAA 3KQHA 1TJ5A 3TZHA 1I6MA 5T8KC 1G60A 3AXSA 3DB2A 4YMIA 1A4UA 3F78A 1L7VC 3DZDA 1Y8ZA 4C07A 4YDSA 1TF7A 3IP6A 3LDFA 1BXGB 3LDAA 4Q7MB 5KWSA 3WGJA 1G1AA 3EIFA 2JLRA 4JD5A 4GVLA 1PYGA 1DG1G 2A78A 5H02A 1ZISA 4UCQA 1IHOA 1EWYA 5DIFA 4RULA 2ZJOA 4YR9A 4LF5B 3NP9A 2ZB3A 3OCVA 2CV0A 2BCEA 2ZBPA 3D5TA 3E53A 3ZI4A 5LD2C 2VNHA 3EVCA 3FNIA 4OB8A 4TN1A 2LBPA 4V0KA 4RMJA 5K5EA 3GN2A 2OWDA 3ZVKA 4CTNA 2Z6UA 4C4SA 2I03A 1J2TA 3OUZA 1P9NA 2Y99A 1UZUA 1FZQA 3CLUD 3ZE2B 1H2YA 1EWKA 2YHSA 4WERA 3B3FA 3KZCA 1MP0A 2EBUA 5G1PA 4OI4A 1P7CA 3K20A 1PZEA 1SIBE 3PP8A 3AC0A 3LKBA 1B8PA 4U1RA 4BMSA 5B7NA 1VPWA 1N2ZA 1UK9A 1IQRA 1QHFA 4H7KA 4JBLA 4ND8B 4PICA 1V26A 4N1AA 2JI8A 3ZW9A 5AVTA 4GT1A 3QFTA 3WNZA 1YZKA 4JB8A 3GJ6A 4NNOA 3B1ZA 1H1LB 2IPLA 4NBUA 3LXXA 4JC4A 4EHFA 1PGJA 5B2EA 5A1TA 4GPIB 4K1XA 4EUFA 3Q87B 4TQGA 4KR6A 1C9JA 3GGGA 3AGQA 3HI6A 3E58A 3AJAA 3MD9A 5CIWA 4PN3A 5BYKA 1G63A 1A8HA 4WZZA 4EFMA 1Y1TA 2Z04A 1OA1A 4KKXB 3IR5A 4UXHA 5ITSA 4AN1A 1BRTA 1QAMA 1QLHA 2VJNA 1VMDA 1T0JB 4JH0A 1Y1LA 4PHCA 1XMPA 3PJGA 4BVAA 1NBMA 5H3CA 3K6SA 2W11A 2RGUA 4WVFA 1PO7A 4GLJA 1DSSG 1DDOA 5E6UA 1IUKA 2CVFA 2HO5A 3QUTA 3EGXA 2VNJA 4UNRA 5GVSA 5KX5F 1NM5C 3GWGA 3KQSA 2NT4A 3L46A 5GM1A 3KL2A 3O9MA 3E8XA 5EZYB 5BV7A 3R1IA 5C8YA 4CQJA 2ZM6B 3O31A 4IJKA 3ZGOA 2UYYA 3IEPA 1GG2A 1IB0A 3F71A 4XXHA 4BPBA 1KMHB 4I19A 1ECCA 4UCXA 1QO7A 4M1EA 4FE4A 1MVLA 1SUEA 1OLOA 1UBMS 3E9ZA 4QT0A 4Q01A 3CZCA 1J56A 2WT8A 3L77A 4YCAA 4DA8A 3ZD6A 1WHTA 4ACAA 1A8UA 4F7WA 5THXA 5IFKA 2OO3A 3C3EA 1KE2A 5KTSA 3W05A 4ZI2A 2QBYB 1EVLA 1XG5A 2WHYA 2WSMA 4CLEA 4FHZA 4IG4A 1JR3E 4Q1AA 5BRNA 2AMVA 2HEGA 1LDGA 3D6JA 2XBLA 2P90A 2CJPA 3DVRX 5AHOA 4ND3A 3KT3A 1EM8B 1Z7EA 2HM7A 3R7NA 2RGGA 3VO9A 1I51A 4BWYA 3QFFA 1WPQA 1VE6A 4QEDA 5AXBA 2G4CA 4EG3A 1X7YA 3FSEA 2Q5HA 4DMFA 1SC4A 2AYXA 2W8ZA 3ZJTA 5A2GA 2FA9A 4IDQA 5K51A 1PV1A 3DVAB 1T4CA 1D6NA 5PNTA 2JKZA 2OZKA 2RAVA 3JATB 4XSVA 3UXYA 4G86A 2BH9A 4MULA 2P9BA 3CLKA 1W581 1KEEB 2WU1A 4BBAA 4CLRA 2YOGA 4ZVVA 2Q3MA 4IR7A 4TKUB 1IVNA 2XMRA 3RYTC 5CDSA 3DO5A 3DYVA 5E0KB 1SXPA 1S2LA 1JR2A 2VUIB 5EYPA 4JXKA 2EFDB 2GBCA 1YE8A 2IDJA 2O7VA 2XNKA 3DXFA 3K30A 1JALA 1LW6E 2D0PB 1JXAA 2ERYA 4C5CA 1Y6FA 1TQ2A 1P9RA 5EWLB 4X65B 4L8FA 1KTVA 1ZLXA 3O3OB 4B35A 2O1SA 3PK0A 2FEMA 3DEZA 1DIRA 1G2IA 4ZRMA 4RTLA 2H9AA 5ECGC 1MRSA 2ZDQA 1XJWA 3A3KA 2QVGA 4FOSA 1K89A 3CXRA 3THYB 4FDVA 5J4KA 4ARBA 5TQ0A 2F9FA 3AR9A 3IDSA 3KZKA 1DC8A 1LBSA 3EUEA 3QSGA 4I9GA 4EB0A 3BMQA 1PT8A 3CPHA 3MWLA 1EESA 3ZGNA 3BKXA 1C50A 2UAGA 3ZCTA 4ZA2A 2OBMA 4BNWA 5IJ0B 4RXMA 3IAUA 4L6CA 4K6GA 1E64A 1KI1A 2JFGA 3S4YA 4AJ4A 5ALLA 4D5GA 1T5BA 1L7BA 3ZDBA 4R3WA 3ZGLA 1Z8FA 2QIOA 2ERCA 2VK1A 3CB2A 3COPA 3OJCA 5BMVB 1T6XA 3G8CA 4A16A 4QIHA 1DEXA 4PYQA 4AP6A 1MDFA 3RBZA 5B55A 5IS2A 2Z4TA 3IP3A 1UMDA 2FGJA 2V9ZA 3QVLA 2PKCA 4IILA 1M1YA 4HVLA 1L8AA 4FYYA 1ZIYA 4IJUA 3IPLA 4NDZA 1DO0A 1I7DA 1E0SA 1KO5A 2CNKA 5DX1A 3W3ZB 3OX3A 3VNVA 1H4SA 1BCSA 3G2QA 5REQA 3GT3A 3U4QA 3K31A 1FIUA 5ABPA 1U8FO 4CEJA 4R1UA 1SU6A 1TFRA 5BR8B 2VXOA 2O50A 3SS8A 1P62B 2IP4A 3HUDA 2R2GA 1VJTA 4R9SA 1X39A 3C6MA 2CUNA 4MITA 4EAQA 1QYWA 2C0QA 2ENWA 4UNQA 2X5XA 2FDCA 2O2IA 3MT9A 4HYEA 1TIPA 4RX1A 5CA0B 3R7AA 3D8NA 1NW5A 5CNKA 5FQNA 4FXPA 4QEZA 4YMSA 2FPPA 4J03A 3ZIAA 4BTVA 2GM9A 4MYHA 5C1DA 2AVDA 4ISBA 1A96A 1BJTA 1N9ZA 2GD6A 1INLA 1KYVA 3AZPA 4QECA 4UNNA 1I2MA 5IEBA 3W6UA 1F2TB 2VT6A 3RWOA 4KR3A 3OP4A 5JC1A 4G1BA 2PGNA 3RIEA 1KEKA 3WC4A 1IQ0A 3ONFA 4U8HA 2QZSA 4KBFA 5KKAA 1D2RA 1XJQA 1YZQA 4A91A 4NPAA 4LXYA 4XD7A 1RHKA 5ARBA 4LZWA 1NXTA 1J0EA 3E48A 3NXSA 1CQJA 3QKSB 4QPNA 4TTSA 3WBFA 5FEUA 5LIRA 1GPMA 1U80A 5C9ZA 3ZY4A 2IYTA 1XLTC 1T9GR 3DLCA 1M6YA 2CXRA 5G02A 2C5EA 5JYCA 2ZRBA 1Z4KA 1GPUA 3KB1A 4BASA 1X92A 2JJ1A 2R8XA 3WLKX 4TRMA 4B2IA 3O8OA 3PDIA 3HJFA 3Q7SA 4Z7OB 2ARKA 2P9EA 1KI7A 3PVCA 4J94A 3SXJA 1NVEA 2ZYDA 5LA6F 3E7PA 1SBYA 1EXMA 2PVCA 4J6EA 3ODPA 3D5QA 2RCYA 1T1EA 2F1IA 2CF5A 3BFVA 4K28A 2ORYA 4MV0A 4NAHA 4EO4A 1UFOA 1ZVQA 2CL0X 4EECA 5LP6F 2BEKA 3FYTA 4GP7A 4Z0NA 5CVTA 2GJ8A 1XMQB 3AHCA 4B7UA 4HFMA 2YXLA 3V4FA 1QP7A 4UEWA 4DDVA 4IO1A 3GRPA 2OCGA 2WJ6A 5E2IA 1Y3IA 4W6QA 4ETMA 4W5RA 4XJXA 3A32A 2FG7C 1W48A 4YUXA 2NPFA 3BIWA 3OOYA 2ACEA 4KAFA 5EY5B 2RHBA 4MR7B 2KHZA 2LWIA 3V97A 3QEBZ 2FSIA 2IZ6A 1LPNA 3M6LA 1D5WA 3H65A 3OOSA 3STTA 4JITA 4AI6A 4RVFA 4KLCA 4A8PA 1N2CB 1XBTA 2JLWA 2XGMA 3FCUB 4NYIR 5AHRA 2BFOA 4LMRA 1QWOA 3P71T 3TQHA 3F5MA 2BONA 1XTJA 3FLMA 4BLSA 2QPOA 3NKVA 2WJHA 1IN6A 2J9ZB 2B0JA 1JDZA 4JWKA 2C5GA 3B48A 4DYDA 4HNUA 4K6FA 1J7JA 2JGDB 2GHRA 1N2XA 4NI5A 3N0XA 2O07A 4R0VA 4MEJA 2A88A 3KALA 4JUFA 1Y63A 4H7FA 3EW9A 4ERXA 1JHUA 3H1PA 1SNYA 3H4VA 3JYOA 3ZWKA 1J8VA 5K45A 4R9UC 4EEZA 3TIGA 5IH7A 4MKFA 2RC5A 1A5TA 5FBZA 1MH9A 5AW3A 1LX6A 4WNAA 3PHJA 5E6UB 4TTVA 1QZ3A 1R12A 1ZVVA 4E07A 1Q3TA 2XUQA 1C7FA 3MLBA 3PDWA 2ID9A 2GTIA 1PQ4A 2AG6A 4RK0A 1C8VB 3N8NA 4R2XA 1OREA 1PDOA 3KLPX 4BFVA 5JCJD 4IH1A 1QHXA 4R6WA 3SQXA 2X7HA 1BSVA 3H11A 3U60B 3IH5A 2V6FA 3DFIA 5TJ9A 4C6TB 1K7EB 2A9JA 3ZX4A 5BORA 1TAUA 5F5XA 4CJXA 5J47A 1O6GA 3D5EA 5K0FA 2OAGA 4B6OA 4EY8A 4LSGA 4JVSB 3EYWA 3K2IA 5T3YA 2XZTA 1GJRA 1ZUNA 3CYFA 4MV7A 3QYAA 3EBLA 4K9RA 1Y9AA 3T9DA 2QTRA 3LHSA 4DLXA 1QAOA 3PWKA 4V24A 5BUSA 1TYDE 4D6PA 4IYJA 4UAGA 3OETA 1M6EX 2DBQA 5FLYA 2WUDA 3KS9A 4G4SP 4YWHA 2GJKA 4X71A 1NRXA 4M9UA 4MIOA 1OB2A 2XIQA 5KYTA 2IS1A 4B6FA 1F20A 2CL7X 4Q9KA 4OFXA 1NRJB 1E1CB 5A5FA 2AG8A 4F38A 1XZPA 1JG7A 1RWKA 1YZYA 1EKXA 1I6WA 1U31A 3KYBA 3SCZA 1QIGA 3I32A 1GNTA 1NMQA 3K94A 5CXQA 5HS4A 2FEPA 4KQFA 4TGLA 1H4TA 3TB6A 1G2PA 2ASEA 5CLHA 3AYZB 2OOKA 5IAEA 1ZHFA 1OX4B 4UXJA 4DHEA 1M1YB 1QYXA 1JQKA 2VP9A 2WABA 3EVBA 4IZHA 1EFKA 2C78A 3GEGA 3SYRA 1M67A 5J2TB 4IS2A 1WULS 3QRWA 4M1KA 4NYJR 3AVTA 1W2GA 1Z2CA 3IAXA 5D8DA 5C18A 3CUKA 3LZ6A 2DPYA 4CL3A 2F1OA 2PNFA 4A5SA 2YVKA 3WWEA 1F2UB 4KW7A 1KQOA 2ZSBA 1HLDA 4G36A 4DV3B 1L4HA 5GGYA 1JQBA 1ZWLA 2GWRA 1IZZA 5CH8A 2V55B 3BHNA 3GJXC 3EXAA 2ECKA 2EFCB 3DE6X 2Q2NA 2HRDA 2EG9A 4O33A 1AS3A 5CA0A 1DIBA 4PYKA 4ARAA 4EHKA 3QU4A 4HXEB 4L5BA 2PL5A 2NQ2C 1I1QB 4KRXA 1CRQA 5KAMA 1S2GA 1T8PA 3M7IA 4ZCTA 1YR3A 1NIPA 2B2XA 1HQYE 1OWPA 2D0IA 2FMXA 3CF6R 3F6PA 2B4YA 1KI6A 3AEXA 3KWLA 3L7YA 1OX5A 3QKRB 4LY0A 4LXXA 3ND6A 4WKBA 3IV9A 2ZUSA 1M8GA 1POXA 1W8DA 4LVNA 4A27A 5MF6A 3DONA 4V0MA 1QU3A 3AY0A 3MS4A 4WX2B 4UTZA 2RGXA 4EB6B 1SQ6A 2CFIA 3IUBA 4ND4A 2VDQB 5DFAA 3OFKA 2WTMA 1RYYA 3FKSA 3SKVA 1L5HA 4XIJA 3BXHA 4H15A 5M29A 1KAOA 2ZKIA 4QRDA 2GJSA 1SIUA 2Y93A 3OQMA 2PGXA 3OUTA 3GRFA 1CZLA 4JLAA 5EMKA 5E7JA 3ADDA 3NETA 2ZRAA 3HC7A 5DT9A 4I8XA 1U5CA 1I3CA 3U7RA 2NWQA 2Q4DA 4PR3A 4EA9A 5JLJA 2P67A 3O8LA 4PO3X 1JB9A 3AUSA 1RJGA 3E7DA 4X93A 2QLBA 3L1VA 3IMFA 4L3WA 4OAOA 2J9GA 4XGNA 5E38A 3GQBA 2XA9A 5TQ2B 1TQDA 2B69A 3I2JA 3C1AA 2LV8A 2A84A 1ZONA 3JARB 2X22A 3L84A 3NUQA 4IKPA 2OXIA 2JG3A 1GUZA 3D6VA 1U1IA 4RS3A 4B0PA 4XJSA 3IE1A 1U8ZA 1Y7LA 4DLPA 5LFAA 2Q5EA 3BB1A 5K05A 2CW5A 1S7CA 1P6QA 1PD1A 4ER7A 2Q9AA 5IC6A 3GUUA 4QT4A 1GITA 1OIVA 1SMKA 4JT2A 4IDBA 2WPDA 5GOZA 1RYFA 2P4QA 4S1WA 3NBZC 4G97A 3JAWA 3UJCA 1IY8A 3L1HA 4B3DA 3K8QA 1QTIA 3FR8A 3AFGA 2ZOSA 1ZIOA 4Y2PA 4PPYA 3KQLA 1I4LD 4KLZA 1W49A 1DNPA 1BAPA 1D2MA 2UZ1A 4WT7A 2WFZA 2YY5A 3T7KA 1Q83A 2FE1A 3SJ7A 4BIMA 3CU5A 5HG0A 5HJ2A 2YDYA 2ZIEA 3HJAA 4CMBA 3NW9A 3T06B 4UQLA 5GZ1A 3R8CA 1PNRA 1ZFNA 2GHIA 2YZGA 3ZVLA 4C4YA 2NX2A 1OWNA 2AOUA 4OAQA 1JHZA 2PKQO 4XJVA 4HK4A 1G21E 3DDHA 3MZ0A 2XF2A 4ECAA 3WG9A 1P0FA 5IK2D 1JHQA 3UHOA 3L8ZA 5ISMA 3NWBA 5D6NA 5C8YF 4O4JF 2PK3A 3WI7A 4KEAA 1WBBA 1ZESA 1YKGA 3FFAA 4ZOAA 2F8LA 1W52X 1C9YA 221PA 2HX1A 2OV6A 1GZDA 1QGDA 2XH8A 3GRVA 2I7CA 3PDCA 4FSHA 4NRDA 4PVCA 4JP5A 3O1HB 3F2VA 3T95A 1V41E 3W2HA 3CN9A 2Y6UA 2FFRA 4L7QA 5I47A 1AD2A 3K0SA 4DUYB 4L6IA 3ZLUA 2BGGA 1LPSA 1I0LA 4LJAA 4NZZA 4LQDA 3TTWA 2HRZA 3N0VA 5ILQA 1IVSA 3D2BA 1KERA 1TMKA 2F17A 2X5OA 1OLSB 3WRXA 3F4LA 4JLKA 4URWR 1K7SN 1M1UA 1P29A 2RH8A 1QH1A 2XSZA 3GLGB 4V1CA 1UEJA 4LQCA 5SICE 2C5BA 3DT8A 3MD0A 1Z37A 2R1TB 2XWSA 3T7RA 3TE7A 4F3NA 3FHJA 3PQ5A 1P7WA 1X0VA 3DZJA 3H7AA 1YE3A 3E2IA 2NXJA 4QHSA 1N5OX 2BGIA 2VDRB 3B51X 3KPYA 4IDEA 5CB8A 4X66B 1CR4A 1V5FA 5EZSA 1KOFA 3LQYA 4U2EA 3W7VA 2GVNA 2XZLA 3OF5A 5CA1F 3A6GA 1BGWA 2VJDA 3GMDA 3GZNB 1OFHA 5BUZA 2Z1MA 1JHDA 3EIOA 5DTMA 1BX1A 1SB8A 2FTKE 4BB6A 1WHSA 3RAEC 3AM1A 3PGJA 2ZWVA 3QK7A 1Z5GA 4TYMA 2VDMB 3MERA 3HWX1 1ZBDA 4UEOA 3K9GA 4M49A 1YZ3A 3IILA 1ZRSA 2JFQA 3G5MA 5LPNA 1YD7A 2G9RA 4O6VA 2YW9A 1H8HA 4CKCA 3A1SA 2ATIA 2NU8A 1W1WA 5DISB 2FW0A 3T7DA 3MCTA 1TVKB 1XZJA 2XT6A 2N3ZA 3OMLA 3RVKA 5K9ZA 2ZUCA 1G20E 2GZDA 1Z6XA 1ADJA 3ETNA 4GRDA 1KKUA 4RFLA 4Y9SA 1KZGB 3WY9A 3VX4A 3E0XA 3KJXA 1XQ1A 3LKZA 3PE4A 4XVUA 3JSAA 3D31A 2ZB4A 1XLVA 3RUPA 2X0JA 1R0YA 3PHHA 4NMLA 5EC8A 5J2UF 1IXZA 4P2BA 1TU0A 3SF8A 3A4LA 3QU7A 4D02A 4CT4B 3UBTA 2EBWA 4P08A 2F67A 3SZ3A 3G68A 4G24A 2E2WA 4UM5A 3MM4A 4EI2A 4HNVA 4ITUA 2EW1A 2VHTA 3CFYA 1J21A 1U98A 1WHTB 3U3ZA 4IMIB 3QNWA 5D3KA 4HEHA 2ZU6A 2JFWA 2MDTA 5HVNA 4JC0A 2XZOA 3PJRA 1K9VF 3PC6A 2I3AA 3NBXX 4UPVA 2J31A 2FMIA 2GZ2A 4W9NC 5I7AA 1MQ8B 4QHYA 5AVJA 1KSHA 3T7SA 1B73A 1FYWA 4AJKA 3KSUA 3AVPA 5MHTA 2QUIA 5ANRB 2XYQA 1CPYA 5JSZA 4ZEOA 4AQ7A 3HE3A 1CEXA 2HHCA 1CJTC 3RSCA 3WV4A 1VIMA 4CF6A 1K7YA 3AYXB 3N8KA 1JBKA 3Q9NA 2Q3LA 2C2GA 4F11A 4DN6A 5E6SA 3MIIA 3L0OA 3O03A 5DP1A 4RFVA 4MWSA 2ZTVA 2HIMA 5CU7A 4A6XA 4DTCA 1M2EA 1WF3A 1OY1A 3H6HA 2PUHA 5AW7A 1S3GA 4NSNA 2OORC 4HGOA 4CN8A 3HLYA 2BE9A 2Q3HA 1TD9A 3Q72A 3SSAA 3SBXA 3L6CA 1MAWA 2WYWA 3ZWNA 3WYDA 3R5SA 5EPEA 4JN6B 3I42A 1HDYA 3PDIB 1P8AA 1XTQA 3IBYA 3IVXA 1K6XA 1E2IA 1YR8A 2FUNB 1HI9A 3E9YA 3HO6A 2IUEA 1P4RA 2VPZA 4J0HA 4P8RA 4J1TC 2YC2C 2WMDA 4QO8A 1KDVA 5A9SB 4A10A 3VR5A 1WOMA 5FR1A 4AG6A 1J9ZA 3OLYA 3R8FA 3NWJA 4DIDA 4B48A 1G8SA 3LC1O 3MTJA 1J5EB 2QLFA 1EE9A 2AMFA 2HBQA 1IPEA 2R4QA 3B3GA 3BB4A 3E2MA 4B40A 3UW1A 5LXTB 5DCWA 4D3FA 3WQSB 4Q7JB 1I9CA 4YV2A 3DLBA 5HMLA 3NGLA 4JR0A 1U0BB 1Y82A 1RVDA 5I8WA 2FPIB 4MS1B 4E03A 1K75A 2W37A 3M49A 1KK1A 2VYQA 3MTAA 4TYQA 2Z6QA 4LRXA 3NOXA 3VDMA 4NP6A 1EAMA 4DXDA 1UZNA 4JUCA 2I78A 1CQIA 3KYIB 2WA1A 5IJAA 4F6LA 1A9XA 2R5FA 4WJKB 1H2WA 1CZKA 4QUDA 4ZXFA 4BNKA 1JDNA 2E6UX 4LHXA 2DR2A 4NX2A 4O2AB 3HGTA 4QNRA 5K3BA 4EABA 2O59A 4OGGA 3L02A 3TOXA 3MILA 1VL5A 2J08A 4L5YA 3IIMA 5DDIP 8ADHA 1DKOA 3CLUC 4MR9B 2DF8A 2QR5A 2XDYA 3EGIA 2QAIA 3HMQA 3O8QB 4OI2A 3RRNA 3VNQA 1QU2A 1ZJ4A 4NZOA 1W0KA 1L4LA 3BDIA 2VJAA 2G6BA 1XTUA 3PUVA 1B0AA 2A0UA 3IJRA 1OW3B 2CLEB 2NU8B 4XVCA 2GHTA 5DWQA 3PNPA 3GO4A 5IW8A 4EKGA 3TIXB 5A6VA 5J58A 2XVYA 3G2MA 2DLDA 3KYCA 3N7AA 1VRCA 1JEYB 3IUYA 1SD1A 3A1FA 2QD3A 1CR1A 3NIFB 1DQRA 3NFYA 3OX2A 3PYMA 2FFQA 4A4DA 3D3WA 5B1HA 1KEWA 3MUOA 4YB8A 3EQ2A 4C43A 2GO1A 4M0FA 3IE2A 5BSTA 3L8YA 1OTXA 1P75A 1W88B 4UE3S 3GVIA 4PX9A 5JY1A 3S2SA 4KRGA 1KXZA 1UINA 3KG2A 4ENQA 1VCMA 1Y3FE 4TTRA 2Q6KA 2V7TA 4ZGWA 1T4DA 3H75A 1HY3A 5DI3A 3CT6A 2CKMA 2OM2A 4Z9BA 4TYWA 1M2VA 2QE7A 3U6KA 1JIJA 3IPRA 4R2IA 1ZJJA 3EY4A 3P2JA 2YJ3A 1IVYA 2GN2A 1P1HA 3GPIA 2OO5A 1WIWA 4H27A 4AMBA 5BSVA 1QRAA 2Y6VA 3S2EA 3AF3A 4IDOA 4EZIA 4QBFA 2C8JA 3WICA 4B3CA 4NV3A 1N2HA 1DAOA 1XZDA 4I3GA 3EGDA 4WNIA 3JQGB 2X9VA 2C03A 1DHRA 2DPHA 1E1LA 2Z8XA 2QY9A 2GPAA 2IBMA 4MNTA 3PGLA 1XO1A 3PCRB 3DBRB 4BXOA 2NNWB 2OYSA 1BJKA 3BJIC 4LOIA 5DBHX 3F47A 1VGQA 1U3VA 3TLZA 3M6AA 4Q1BA 1X3SA 1HDOA 1X19A 5HSGA 1IXKA 1M8JA 1MXFA 3I6BA 1UAGA 1UQTA 3UIEA 4O4HB 4HWTA 2YVLA 1JFRA 2H2HA 3KOYA 4U63A 4YFVA 1R6AA 3RUDA 1XEWX 3JVIA 5F9MA 4CKZA 2PN1A 1TVEA 2PS9A 1LDBA 4NMWA 3N58A 3PPYA 3AJ8A 4HPXB 4M36A 1Z56C 2E5WA 1DO2A 1WSAA 2FB9A 1QX3A 3AJ9A 2XOXA 3CPSA 4R1NA 5EERA 3UCFA 1AHPA 3DV2A 4AMYA 1VCHA 2BM0A 2YV5A 3V3TA 4KRYA 1G7SA 2I4NA 2FMHA 3M5PA 1W34A 3AEQA 1E18A 4D80A 3QVJA 1D0SA 2TMYA 4V1CI 3EN0A 4CR6A 2YUIA 3CKLA 2I6TA 3KTAB 4F12A 3GD5A 1O08A 2IXFA 2AC7A 4OHWA 1G17A 3D59A 4JC5A 3UK1A 2F48A 1OLUB 3B9BA 1U2RA 2IFTA 5ETJA 3B2QA 2P2ZA 4FGKA 3ZDXB 3JU3A 2AOVA 3HYTA 4ND8A 4U7HA 4XLLA 1HQKA 3WLPA 2BIFA 5JNTA 3ECCA 2HYIC 4BQSA 4EF5A 2ODBA 1RC8A 3HZHA 2PHZA 2XNSA 2I6GA 1QJCA 1SBZA 2WF5A 5EIXA 1FQWA 3EG5A 4HLNA 4DVGA 5DM1A 3OOEA 3I53A 1K0UA 4JGBA 2Q2WA 3WGKA 1K27A 3WWZA 1I3KA 4EI8A 1Y4DE 3AF2A 4LGVA 3GCXA 3RUIA 3SYLA 4C4PA 2ORIA 3AHIA 3CLRC 4WGGA 3PF8A 1KH3A 1X7GA 2FOIA 2RHWA 3TE6A 4K46A 3L6UA 4EYKA 2IA5A 3Q6IA 2Q3FA 3C5WP 1A5SB 2ZITA 1PBNA 2LCIA 5ULLA 1RACA 2EKPA 3K05A 3KQVA 3KZMA 2H2AA 4IDDA 1GPBA 1B93A 4IJ6A 4GZ5A 3BMCB 5E9WA 4B44A 3ZTYA 5BSGA 1WCIA 1O8CA 2V45A 1LS1A 5DMHA 4P4NA 4NMHA 2R8YA 4QUKA 5DCLA 5TRTA 3W4JA 4RJ2A 3AVXA 2HCTA 4LTDA 1PVOA 1TUGA 2BUAA 4G0XA 3DJYA 4DT1A 1WVGA 4LDRA 2DFTA 4WZ6A 1NDQA 2V65A 3WDSA 1IPHA 4YJDA 2TECE 4RTJA 4GQAA 1G3MA 3VTAA 4GNKA 3QTBA 4M9SA 3QLVC 4FCWA 4O2BB 2IUSA 5K8UA 1W88A 4FFMA 3DKRA 5FUVA 2AI2A 3R5HA 4Y9DA 4A6DA 3M9WA 3ZCRA 3OESA 3OZUA 3SEAA 2IBSA 4UEKA 1KSFX 3RC3A 4BQFA 1A27A 3N8GA 3PGMA 2PV0A 2GEUA 3PR1A 2CFOA 2ODPA 3QELA 5BXYA 1M76A 1OU4A 2H8KA 5HWSA 5HZMA 3LL4A 3OMXA 1B8UA 6LDHA 1GQQA 2UYOA 4W7SA 3LGXA 1GZUA 2PKYX 3C3DA 4IUBS 3EDRA 1CYEA 4A5OA 5IFLA 3GMTA 1QRDA 4RIFA 4JFAA 1F14A 4KR0A 3EEIA 2HD4A 2JIBA 4OMUA 5I7UA 1VMKA 3ITEA 4QG7A 4OF4A 2D59A 2NZ2A 2ZYAA 1LA2A 2IELA 2V8OA 3MGCA 2HQOA 4H60A 3CCFA 3K6JA 1B2LA 4MKRA 1N7JA 4OU5A 5A3VA 1YU6A 1LDYA 1F5SA 3ZHYA 4B87A 1Q3HA 3K16A 4FYVA 5JBQA 2ZZMA 1FFAA 1LJUA 2H2GA 3LPAA 4WSOA 3BMNA 2IP2A 5D2CA 4PF1A 1A88A 5J2TF 4EGQA 1T5HX 2WSSA 2X58A 2X40A 3Q2IA 2HW8A 3RRBA 1RNLA 1B2RA 1N8NA 2XI4A 4Q21A 3Q1KA 1RE0A 1YTLA 3EGWA 4YCSA 3KFLA 4C0JA 2YJ6A 4FOPA 3FCEA 5KVCA 3TRJA 3MAJA 3ORRA 4CNQA 3HU1A 3WBJA 1QH0A 1JAXA 1R8SA 2BE7A 3TJMA 4B6JA 4BNYA 1VA5A 1HMPA 3NH6A 1C0LA 1RU3A 1BCRA 2B5OA 1N2SA 2VDKB 2W6NA 3NEAA 3QEOA 1SXJA 4O8ZA 3II6X 3AI1A 4JWTA 4X7RA 5LXTA 2C8KA 3SIRA 4AJ9A 5CVCA 2JH3A 2SNIE 5T64A 1MQAA 4CI0B 1ABEA 1JZSA 2AOWA 3CONA 1EA7A 4C0BA 4F71A 3N7TA 4MAMA 2PMBA 3IP1A 2NXEA 1RIFA 1P81A 2R4TA 2PA0A 5KSYA 3AJDA 2EL7A 3FM9A 4JDUA 1JIIA 1Z3IX 3D81A 4Q7LA 5KNCH 2W2XA 2X41A 2H48A 3VYSB 1RWWA 2VSFA 2YJNA 3D7RA 4XARA 3HA5A 1ZVMA 4WE3A 5CT9A 1CUZA 2H5LA 4MQEA 5JJIA 2O57A 1VL2A 3KSZO 5ICSA 4YJGB 5TE9A 2A5YB 4D8TA 4EYQA 5FWNA 5C53B 1S01A 3LNTA 1TM7E 3RI3A 5FADA 4XGRA 3WDMA 1GCOA 1QR2A 3M5WA 4M6WB 1ZVJA 5LB4A 5B4TA 5LSAA 1WBJB 1BVHA 2FDXA 2ZSKA 4P4SB 1PR3A 2WW8A 1XEXA 2GAAA 3OC6A 2QJFA 1MB4A 3HCEA 4YCDA 4R8RA 1HE8B 4BE7B 3RH0A 1M0SA 4I1IA 2X2OA 2FFJA 3S99A 2X2EA 2BLNA 5JZSA 3TFOA 1MKYA 1MA0A 2YX1A 3DWIA 3LCRA 5DOZA 3B1KA 3AUFA 4JT8A 2BTQA 1DKUA 3W6ZA 3R0XA 2AV6A 3LX4A 4WD3A 3ELDA 3H8VA 1SCBA 2R6GA 4NH4A 4AN0A 2VYFA 2DBZA 1J42A 2QJRA 3I0NA 1PVVA 4Z1MD 5B6IA 1CR2A 3K9LA 1PEKE 1V9SA 4A3SA 4TLBA 4B76A 4GL2A 5AESA 1UBLS 2CUZA 1DKMA 2BCGY 2YIVX 3CQ9A 4Y2VA 1TT5B 1QHEA 1FSZA 1U1GA 1SVUA 1WW8A 1FTNA 2JCVA 2Q99A 1ZD1A 2XAUA 1M3SA 3FUWA 3KWMA 3GJ5A 1G5TA 4BQNA 5DHUA 4AN4A 4G63A 1MABB 5BSMA 3VBCA 1YDWA 1KPIA 4L5JA 3H5TA 4YP7A 1C29B 2IOFK 1T25A 2C3OA 2WVHA 2FR8C 3UK2A 3X2EA 4DV2B 5HBGA 2NZJA 1W46A 1X80B 4C0HA 2W22A 3ZTWA 2CYCA 1ZK4A 4LBWA 2I0FA 4CFZA 2H1VA 4U8GA 2A67A 4GQIA 3OLWA 1GRQA 1GTZA 3GFFA 2XSZD 1AF4A 1VRVA 1GG5A 3IQHX 3PR3A 2XVMA 2JRLA 3UQYS 4J1TA 2PQ6A 5BQPA 4QPJC 2BKXA 1ESZA 3Q5EA 4D5EA 2HA0A 3QPWA 4DDMA 5J63A 4BFXA 1UMDB 4OY3A 2RGNA 3SZUA 5KDLA 4J2TA 3P2EA 1X1AA 3D8SA 2QA5A 1ICIA 3WRWA 4GYJA 3ZDQA 2P75A 3KCNA 5JJBA 5LKRA 2Y77A 2OESA 1XTTA 4L27A 3UTDA 3AVVA 1FDVA 1KMNA 4B33A 4CM3A 1SVLA 2CUKA 4DBLE 4PNEA 1E9FA 1L5WA 2P5SA 2BFAA 1H5NA 2WJ3A 3FFWA 1VE3A 1JG1A 3GNTA 1EAYA 1XRSB 4U9UA 1LXCA 5EKUA 4JI1B 4U7JA 3WJ1A 1ZNWA 5C37A 4NU8X 1N3BA 5TDHA 3CXUA 5K3FB 3LZDA 3F5QA 4D8VA 2ATVA 3IVCA 4MW2A 3IB3A 4MW7A 4AJLA 2UZIR 2GK6A 1C8LA 1GAJA 1VMAA 3H86A 5M5BA 2QF7A 3X3HA 4CKBA 1YR7A 1RFLA 1G4UR 1RM4A 3GT4A 1HF3A 5BSUA 3FNHA 1R10A 1O97C 3EASA 3L5KA 2ORVA 2AE2A 1J2RA 2YZ2A 3M9XA 4RNDB 4N47A 3VGPA 1V3TA 1AUQA 1DEKA 1E2HA 1V25A 2OCYC 1PQPA 3BIFA 3SKYA 3T3GA 3TSCA 3I2YX 2I76A 4AYWA 5AW4A 4RD3A 3PQ6A 5ALDA 3VPFA 1I14A 4GGPA 4D4HA 1FMCA 2QG6A 3FE2A 4N9WA 2XTJA 4EI7A 3KETA 3RVSA 3VI4B 4IFIA 3WFIA 1FQJA 1ZJWA 4KXLA 1JUDA 2HO4A 3RC8A 1Z5VA 3EXG2 4XQEA 1QZTA 1WP9A 3W9UA 3TD9A 1Z5NA 3WSTA 2PZJA 3E7WA 3KT6A 2QZPA 3PL1A 3M83A 4ENRA 3JW8A 2K87A 1IBRA 1FUYB 3OZRA 3S2UA 2IU3A 2CGEA 1H4VB 2FSGA 3ME5A 4H77A 2P27A 1PTJC 4WL0A 2GF9A 3K6RA 1LY1A 4MVXA 1ZW1A 3OLCX 4ZQFA 2UUBB 1AB6A 1ZGZA 3FLEA 3N87A 4M8SA 3LIPA 2NYRA 4MO2A 3ONEA 3Q6MA 1AKWA 4NBTA 4TKMA 5GVRA 3V1MA 2FPMA 2GM5A 4X6XA 5ALJA 1JYFA 4DCCA 1GZSA 3AERA 1XA3A 2YV3A 1ZUWA 1N9KA 7MHTA 2A35A 1XZNA 3WWOA 3OEEA 4LNUA 4FBMA 5EXXA 1FFCA 3WL7A 5REQB 4P54A 3CX8A 1V16B 2OBBA 5YASA 1J00A 4BWFB 3ZWMA 3MMSA 3HXLA 3TH5A 3HDYA 3AF0A 1TCVA 1SCJA 4MPTA 3Q10A 3TTXA 3OH8A 2ZJ4A 1HORA 1CY6A 1UWVA 3NVDA 4PR0A 4XSHA 5KKNB 2Q7DA 2QUHA 3FBWA 1ZXXA 4PRLA 2GUGA 1N2JA 4P22A 1CJVC 1IE3A 2VPWA 1DEOA 4MOWA 4ARUA 3LUGA 4CKBB 1ZI6A 4D3YA 1GSIA 1VFNA 3V7WA 4TM8A 4UQOA 3TKLA 2AEJA 3P96A 4JB3A 2IUUA 1L5MA 1B8NA 3MFQA 4ER5A 4BE4A 3CZMA 3LW7A 3DUFA 1U94A 4JMPA 2C1ZA 3IQIX 3L7DA 1CJBA 4HLCA 3SE7A 1J8FA 1T0HB 2J3DA 5JCOA 4MAFA 4TQUS 3LYLA 4YCNA 1Q7EA 1RP7A 2GRAA 4TTIA 3RTEA 4UULA 1YBHA 2H5JA 2AN5A 1U0LA 3TQCA 1VG0B 3DDNA 3I72A 1I4DD 4QJ4A 3K72B 4NYMQ 4BO9A 2C2HA 1YASA 5GJVC 4DDWA 4UFNA 4JZYA 1NLYA 4D9MA 1CZNA 4OX9Y 5CFZA 1LNQA 1PZFA 1HT1E 2I1VB 1SKAA 3A9RA 3H9UA 1MEOA 2O7SA 3BRWD 5ICFA 1CUYA 3LUHA 1B6RA 2Q21A 4R0NA 4B43A 1UJCA 5B36A 1WKCA 2BY4A 3BQ9A 1T13A 4IDGA 4ENVA 1RQ7A 4PZCA 2ZWOA 4A0FA 3MCVA 1UCFA 3PTAA 1F9EA 4FLFA 3I5YA 3I2GA 1I2BA 3C0KA 3CF4G 2R00A 3P9CA 1NVXQ 1QNFA 4ZO7A 1ULHA 3P52A 3L1UA 4G4JA 2RB5A 4UNSA 1QDUA 3G2IA 4ZOLA 4AWXA 1RLIA 2DPGA 1QQ5A 1U7HA 3BGDA 3HK2A 2FRVA 1GGHA 3BJMA 1HH4A 4I9FA 5FXMA 1ULAA 4HWOA 1V5EA 2Z3WA 4JIMA 5J43A 2BGLA 2VRBA 3B5EA 4ASUD 1F7VA 5IXSA 1YBMA 4OUKX 3S8YA 4B3HA 2NW6A 4YH1A 2QD1A 4OM8A 3AF1A 1NC1A 1Y8AA 1Z7GA 4BVLA 3RGWS 3GFQA 4PG8A 2ZR7A 3Q7EA 5HRCA 1LBIA 3GEIA 1NNEA 1KU6A 2Q3CA 4FUTA 4YRRA 1Y80A 1JL3A 2BAGA 1HNNA 5HS6A 1GNQA 1JEJA 1Q57A 4F1WA 2I8CA 3RS7A 4YR7A 4B8YA 2DEUA 3RK4A 1F2UA 2K2QB 4P5PA 4NECA 2A9QA 2FQ1A 2GN8A 3C6XA 4KPUB 2A92A 2RI1A 3U5ZB 1A5BB 4OHCA 1SK8A 4F2DA 4G5SA 2QUAA 1GSAA 5K3FA 4OX9B 3QW2A 5CITA 4IAOA 4YCJA 4XVHA 3QI7A 1LC3A 1T8WA 4DPMA 5KJ1A 1BEEA 1EK2A 4C7JA 4Y2RA 3CNLA 4MUIA 1YZGA 4AMGA 4IV8A 4P4GA 4UMVA 4B2LA 1TA4A 2XHZA 3ANLA 3I6MA 3ELBA 4GP6A 3RFTA 1KGDA 3V7NA 5A5EA 2Q3JA 1COWA 3SP1A 1FSPA 3HYNA 3WO1A 4WCFC 4TV9F 3AL0C 3QMPA 4EOGA 1BQ3A 3NASA 3BGIA 2E85A 4BBZA 1YDFA 5FWYB 3TBHA 5GINE 1XWWA 3BPSA 1R5OA 3JQ9A 1VL1A 4M1TA 5FOVA 4MTLA 1ZNXA 3K1JA 1JDJA 2V9CA 1JNYA 4RDHA 3SR0A 3ZCVA 1NHGA 4MV8A 4B80A 1EJBA 4FI3C 2GAJA 3ENWA 3UK7A 4B6GA 4CMAA 1E7RA 1RFGE 1RQPA 1ZN2A 2JCXA 1JIKA 4YVFA 3ROEA 3GFSA 2XCRB 4JFRA 2PBRA 2QVXX 1QYIA 1UPAA 2GF0A 1G16A 2JEZA 1XZKA 3GJRA 5KHAA 4B81A 4B3FX 4F56A 4EHBA 1M34B 4R05A 4JVNA 4PFKA 1LF5A 3HUFA 3MBKA 3FTFA 4Y18A 1ML4A 3A9UA 3JR3A 4NHEA 2YYYA 1CQZA 2YXEA 4MO9A 4Y2YA 5BO5A 4X1YB 2WM8A 3HS3A 2B4TO 4MUMA 4URUR 3ZWDA 5JISA 3A7EA 4XQ0A 3U4MA 3CJRA 3LX5A 3LFHA 5J59A 2Q6TA 4AIIA 4A7PA 1NLFA 3HBMA 5BYJA 1BKSB 2R6AA 4D44A 2GLTA 2EEPA 5KVAA 1JZQA 2Y1GA 4PLPA 4HF7A 1XYGA 3ZVRA 3TUZC 3BBLA 1FP4A 2XY4A 4W5NA 2QV0A 3QITA 3CZ4A 2F00A 1Z5WA 2PL9A 2Q1TA 3OFND 1GCGA 4M53A 4RKRA 3VNRA 2NU7A 5LL6P 4E4YA 5JASA 1BU5A 3GNSA 3HU5A 5FYQA 4ZYVA 4QDOA 4DLSA 3FY4A 1IB6A 4YLYA 4XDHA 2O2HA 3QPAA 2EKBA 3WBBA 1HLGA 2HMUA 2IXDA 1VLMA 4LKRA 4XWOA 2JFFA 3CUYA 3IRVA 4D0GA 4RPCA 1GNSA 3EUAA 3IPAA 3MGGA 5DYGA 4AYXA 4BQOA 2JAQA 2J0UA 3R0JA 5LU9A 3TFQA 2XMCA 4HS9A 5IAGA 4CEHA 3EF0A 2HIHA 2IYYA 3G23A 3C3WA 1TJPB 3K4PA 5EE5B 5BSRA 2GLUA 2PYDA 4YRKA 1XPUA 2WZBA 1CRWG 1V3VA 5AUOB 3TQFA 5IUNC 4OHKA 3J81k 3KT0A 4W82A 2IT1A 4N3AA 2I6UA 2AFVA 1HFJA 2JJ8A 2O0JA 3FYUA 3R2JA 2GCNA 3DZHA 4OTZA 4Q9HA 2GB4A 3STXA 2YZNA 3R44A 1LI5A 4JA2A 4ACBA 4BBPA 1YAHA 4JI4B 4F3CA 3I3OA 1F06A 3DZIA 3DZKA 4PGAA 5J2UA 2QVYX 3VDRA 3ZZUA 2ZJ6A 5I5EA 2UZAA 3WKCA 4E4RA 4I4CA 4WKOA 2VK8A 1QK4A 1YDHA 1JVBA 3PQ3A 2CYAA 1XNRB 3TI7A 1W6UA 1Z2NX 3MRSA 3RTCA 1ZUHA 1WSBA 3HWSA 3FSGA 5LWHA 4OQFA 1GD1O 4JROA 3WGUA 2NN3C 5KPJA 1D0VA 3RGGA 1IFXA 1HR0B 3NVMB 4MS3A 3SHTA 1M7HA 2XUHA 4EJFA 3LS2A 4EP1A 4GG1A 5TNXA 4CF4A 1TLLA 2B82A 2KBEA 3D43A 2KLHA 1FUUA 3RAJA 5FOTA 3P4UA 4YWJA 4LQ4A 1CNEA 1GRVA 2I2WA 4A0RA 4AUMA 5KSZA 4I55A 3I5XA 2KWIA 1X8JA 3OPMA 3ORYA 4Q7QA 2SBTA 3LYHA 5HM6A 4X3CA 3CUSA 5JPCA 2RAUA 3EW7A 5M3BA 2VHEA 4RD1A 5IMSA 3ABOB 4RA9B 2BHNA 1UWLA 4UHFA 5JAOA 2AJ8A 3F5SA 1YI8A 3FMPB 3W4KA 3ZR4B 1ZINA 2HMWA 4OEHA 5BNWA 4JV5B 5ALIA 4IIJA 2ZXEA 1G41A 3C6QA 3EFOA 4JX9A 4RW0A 3UM9A 3WLTA 3ZQ6A 1QIEA 1Z28A 1NN1A 1RYHA 1UODA 2PZ8A 3FUCA 1CF9A 1O89A 2ZIFA 2I1WA 5EUBA 2WSSD 3PWSA 4OXNA 5FF9A 1ACJA 3ROPA 2Y66A 4M22A 3L9XA 3TQRA 2QJOA 4RVHA 4WGFA 4UHCA 3KVRA 1NT4A 2C2KA 1OVGA 2YNMA 4RKWA 2H4XA 5FULA 1RHUA 2PH1A 2PXXA 2RGEA 2BM8A 3LLCA 1TRKA 5GONB 1RWVA 1OR8A 2FW6A 4M76B 5EQJB 3SD7A 3CA8A 3DQQA 3CMCO 3D6MA 4FHGA 2V3CC 8OHMA 4BX9A 1T2AA 1KMQA 3V8RA 3P9SA 3S28A 3TOZA 2PUDA 3R3JA 2CFRA 1U2TA 4MQ5A 4CEIB 4BMVA 5LZ5A 4PC2A 2NYUA 1GO2A 3GEPA 2AKYA 1PIWA 3VV2A 4S04A 1NUSA 4MWCA 5ALGA 3JVVA 4EG8A 4YJ2A 3O2SB 4G1CA 5LOVA 2PUEA 1S2MA 1IUPA 3N6XA 4UZSA 4YAWA 2EG5A 3S2FA 1M6HA 2Z5VA 1QGYA 3JASA 3EGEA 4TWBA 3TEFA 1JHYA 2XJ4A 1HURA 5BT8A 2OUIA 3KBBA 4J1NA 4BECA 3FDZA 5CDUA 1QGUB 1QYDA 2UYGA 2Q1WA 1VB3A 2XUZA 1E2LA 1SU4A 2G7MC 3OM0A 2ZJ8A 1IONA 1NKVA 4C87A 4BNXA 2Z43A 2O19A 4H9GA 3FPJA 4V03A 1NSYA 5G3ZA 1QAQA 3NYWA 4LJLA 5G0TA 1OTHA 2A0FA 3WLNA 2QAJA 2ZXFA 1QIHA 4D0LB 1T26A 4KIFA 1AKNA 3IKJA 4TLAA 1Z6YA 2OV2A 3TX2A 4D41A 2D7JA 3PPVA 1WTAA 3V00A 2UXCB 4F9FA 1E7SA 1GQFA 4CGZA 3OQJA 3KLBA 3FJOA 4DEYA 1RC1A 5ITZB 2WTXA 1TO6A 4HQ0A 4MVYA 1P2BA 4D9NA 4LJ6A 4IMJB 3WB9A 3G5AA 1DKQA 3GRKA 3OPYB 4B7AA 1FDOA 2L82A 3WGHA 2H2DA 1W4RA 1MIOB 5IKXA 2QQ0A 1JKJA 3HN6A 5HDBB 4KFRA 5GONA 1C3OA 5GADl 3AR5A 3AVQA 3GIDA 1D5CA 1HFKA 3MWKA 1K6IA 2J7KA 3KSAC 4RZQA 4Y0AA 2BFFA 4YBZA 3B2EA 1KC3A 3STUA 1DTSA 5HYVA 4I1UA 5A05A 3GEHA 2C5SA 1JH9A 4NMMA 1B4DA 3NPAA 3DM9B 4X5OA 3EXHC 3T9BA 621PA 4KFUA 1NDHA 2XVZA 3FX2A 2I5PO 3FMVA 2HSZA 4JENA 4IDAA 1ORTA 3CW2A 5EZ6B 4BUZA 4EG4A 3Q7TA 1J90A 1NLZA 1RPJA 3Q3VA 4Q3EA 3S8EA 1PJRA 1I32A 2HF2A 3OFVA 5TV2A 5FDFA 2SKDA 4J0IA 1Z39A 4RHXA 5JD3A 1E8NA 2IEIA 4HH0A 2NO4A 3DQZA 4HX5A 3RAPR 2QTVA 3TTTA 4BVFA 4Q19A 3G8YA 3GZ4A 1N1EA 4ID3A 1XSEA 3FBTA 3BC1A 2E37A 3KUUA 1XDUA 2B30A 1Y3CE 2BMDA 2MYNA 2V98A 4WLUA 5EVCA 4YPFA 4OKNA 1L1QA 4BJ3A 5A04A 5C5IA 4ZCMA 2W6IA 2YWFA 3RU3A 3DC7A 1W75A 3VR6A 2BLLA 3WLOA 1BH2A 2PXAA 3L05A 1CHNA 4UBMA 2V1XA 1FMFA 1ADGA 1PJBA 2Q41A 4NYMR 3R3SA 1IM5A 3FDIA 4TMTA 5FWXA 2JIZA 4TZKA 4LWPA 2RKWA 1O4WA 1RBMA 4D25A 3FUVA 4DEXA 1E1CA 1ODJA 5A62A 3WOVA 3W77A 5AK5A 2WBLC 1VHQA 1FNCA 2W2OA 1OILA 4RHEA 1SVNA 2EZ8A 4WBSA 3WGOA 3WTCA 4D9EA 2A57A 2I91A 4CI9A 5LQMA 4ARVA 3WMEA 2RGAA 1Q44A 3E03A 3MWGA 4L8LA 5FHRA 4GPD1 3T7AA 4A23A 3RJTA 2X3FA 2IS2A 2G0NA 1JU9A 2FSFA 1JFFB 1KFCB 2OQRA 1UBSB 2EGGA 4MJLA 1XXLA 1GILA 4DCSA 1O3YA 1U8TA 3B53X 4UM7A 4M1SA 2P2GA 3TR6A 4E13A 2A4KA 2AMJA 2F2TA 3OF3A 3TKAA 3UMVA 4X9XA 3ZZTA 1QYVA 1EUCA 3IULA 4LGMA 4U7DA 1ZNZA 3OIUA 4ZVPA 4PGFA 4CT5A 3Q3CA 4F8JA 1L8OA 3T7JA 3V46A 2A6PA 1RWNA 1YQEA 2F3UA 4NK4A 4BNJA 4D6YA 1UBHS 5L51A 1U0NA 1S2OA 2ZR0A 2JS7A 4QM7A 4LWOA 1D9XA 1G6OA 3DXZA 1XLWA 4INZA 3MJ4A 1SZJG 3F6BX 5AVZA 2ZUFA 3FUXA 3EEOA 1IHXA 1RQXA 5DLEA 4IQ8A 1RXUA 2NPOA 2AZMA 4UVEA 2MSCB 3GBPA 2OFPA 2VYNA 1ZY2A 4DPKA 5AWFC 2F6RA 3HJUA 3WMWA 1SZPA 2W2QA 3KKMA 3TLBA 4NCAA 2REOA 3BHMA 2YVQA 4J7AA 4OSOA 5C7OO 2ZANA 4DIFA 3K0CA 2I6SA 4WINA 1DBIA 1XB2A 3NTQA 3H1GA 2Y1EA 3H2ZA 2A5FA 5CVVA 2ON6A 4N6NA 1RZRA 5IHPA 4QE3A 3G13A 2PX3A 4C7KA 4C5BA 2R3SA 4P4SA 2VKTA 3LGAA 3MQ2A 2NZUG 3ELWA 3I6QA 4FS3A 1WXEA 4L5AA 4MUXA 5DEIA 3VKFA 1YFLA 4KQJA 2GPJA 5JAMA 2RGBA 1YB5A 2JDIA 4QWWA 4A92A 1C7IA 1MR3F 4MRPA 3ETHA 3DGFC 1Y6GA 2X6QA 4IHJF 2IRWA