4ZYXA

Human gar transformylase in complex with gar and (s)-2-({4-[4-(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]-pyrimidin-6-yl)butyl]thiophene-2-carbonyl}amino)pentanedioic acid (agf117)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trifunctional purine biosynthetic protein adenosine-3
publication title Structural and Enzymatic Analysis of Tumor-Targeted Antifolates That Inhibit Glycinamide Ribonucleotide Formyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 65
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4zyxA00
3P9XA 1ZGHA 4EW1A 1YRWA 4IQFA 1ZLYA 4ZYWA 4QPDA 3GARA 4ZYYA 3N0VA 2BW0A 1FMTA 4ZYTA 1RBMA 1MENA 3NRBA 3Q0IA 1NJSA 2CFIA 4ZYVA 4YFYA 4YFVA 1RBQA 1RBZA 1CDDA 3O1LA 5J9FA 1C2TA 1MEJA 2GARA 4EW2A 1RC1A 2FMTA 1JKXA 1MEOA 4ZYZA 3KCQA 4QPCA 1CDEA 2BLNA 2YWRA 3LOUA 1C3EA 1ZLXA 4TS4A 1RC0A 3AUFA 4S1NA 4ZYUA 1RBYA 4Q12A 4TTSA 4ZYXA 3DA8A 4DS3A 4ZZ1A 3AV3A 4EW3A 4ZZ2A 3OBIA 4ZZ3A 1GARA 4PZUA 5CJJA 4TT8A 4ZZ0A 1S3IA 4R8VA 3TQRA 5J63A 3TQQA 4NV1A 1GRCA 3W7BA 3DCJA 3R8XA
chains in the Genus database with same CATH superfamily
4P31A 5T7BA 3VH3A 2PFSA 1YQQA 4V0SA 3ZI7A 1B8PA 1DRKA 3LQ2A 3D5EA 4A10A 2PL5A 2WC1A 1IY9A 3S27A 4CV3A 4CGYA 4MPTA 1JFTA 2G1PA 4WERA 1Q1EA 3I0NA 2A9KA 4GX0A 4AUNA 3JQ8B 1KFKB 5JAZA 4P3KA 2WHPA 2Q0XA 4JR0A 3HADA 5DBOA 1NY5A 5AI4A 3SEFA 4U7PB 2QROA 4DARA 5IG2A 1Y63A 1YNSA 3MG9A 1POXA 3OECA 1CFJA 5HFNA 1YKFA 1G1AA 3C6BA 3HMQA 3A7EA 3N6VA 3N9IA 3N75A 4I50A 1HOTA 1DU4A 1N33B 4JMPA 4LAFA 3BCUA 1QLWA 3V2IA 1DAOA 4L0MA 1YQUA 1XZJA 4PC2A 5B1SA 1KIAA 4FDVA 4D41A 4WBNB 1FYFA 2QUJA 3HJGA 2AJCA 1B4DA 4XD7D 1OYWA 3P2MA 2GKOA 5JNVA 4FHDA 4YAEA 1M1YB 2GTIA 3TJZA 3ZWCA 4IUDS 4U4AA 4EJSA 1U0LA 4LZJA 4YGYA 5LP6C 2C4NA 1P1JA 5LYJA 4LW8A 2GHQA 5T4EA 1OOEA 3ND9A 5J2UA 4FI3F 1CWUA 1CDZA 1P1FA 2A0XA 5ALPA 3ZPXA 4MQLA 2C04A 2RGUA 3DNFA 1OWLA 4ND7A 1C8KA 1R4MB 4EO7A 3N6XA 5L6MB 1ZH4A 3DUFA 4MKRA 2IP4A 1N1MA 2OFWA 2QYTA 3RS9A 5I9LA 2EJWA 2C2GA 2IXGA 4OXIA 4HMQA 4IOMA 2IHNA 1VPEA 1C3VA 4ZICA 4TN5A 5CMLA 4F2PA 5EUMA 1RXUA 4KX3A 1H3FA 5KDLA 2C5BA 2VT7A 5DNWA 3MIIA 4HDMA 1P2DA 2QTWB 3GJ8A 1UXOA 2XQVA 3GNTA 5JE8A 3NRCA 4N3BA 3KDSE 1EI9A 1XU9A 4HEA6 3V8RA 2IEYA 2WQ7A 1YTLA 3RVQA 5HCUA 1EHYA 2OG1A 1NR5A 3GX1A 4F4FA 1SQ6A 4HUTA 4BZXA 4ND4A 1EDBA 1RMTA 2OLJA 3WFIA 3W6PA 1S5PA 2HQRA 4PLYA 4X44A 3H8JA 3IT3A 5A1JA 4CM6A 5AFSA 5F2OA 4GLJA 1MAVA 5DNVA 3SZGA 4GS5A 4K3VA 1QWOA 4E3ZA 1B00A 3ESQA 1RJGA 5ALRA 3T7AA 1JALA 1IAQA 4RULA 4PYJA 5BSKA 4XR9A 2ZRNA 2EG5A 3AW8A 2NQTA 4X54A 1AN9A 4Z2YA 3L6UA 4G65A 4IJQA 4X20B 3UA4A 3KSRA 4MWSA 5NLLA 3L4EA 3C8UA 2WVJA 3GVPA 2I55A 3LY8A 4DABA 4DMFA 2X3UA 3ANMA 5E7IA 4X62B 4P3YA 3INTA 1PG0A 3VHRA 4M22A 4FT2A 1ZK2A 2H4HA 3JQRA 5CAEB 3ZNNA 3AEKA 4P9NA 1FMCA 4UZSA 1AN0A 1Y1KE 4EDFA 2MSNA 2DH5A 3I39X 1NW3A 2L19A 2B3DA 1TYAE 1GGFA 3KQUA 1U0JA 4DUYB 3G2QA 5FUXA 2VR1A 4OB8A 4JC4A 8ADHA 2O3QA 1A1VA 2FP4B 3JWIA 5KTTA 1M54A 2PX8A 3NDIA 2PL9A 3KVVA 3PEVA 3QU2A 1I51A 4FDTA 3RC7A 3WDMA 3TFWA 1F0YA 1G8HA 5DM4A 4F92B 3FFXA 5LUAA 2NTYC 4D9NA 4HVAA 3KSDO 3QRWA 4FD2A 3R3WA 5DN9A 2GWHA 3H1EA 1JNXX 4HSGA 2BW0A 3AM5A 3DOEA 4F8YA 3OETA 4CVNA 3C8ZA 1NXTA 3BL5A 5JY6A 4RYLA 1DRJA 1L9XA 4FNAA 3EXFA 3CUUA 2Q7OE 3EVNA 1SXJC 3UWOA 2DOKA 3BWMA 4NBWA 4QEKA 1U9IA 1P0IA 2F8SA 2IDKA 3WC4A 2VZEA 2P3SA 4EZBA 1QGAA 1RAGA 1T6XA 2XODA 4YR9A 5A4AA 2PMEA 4RANA 3RG8A 3WR5A 1O77A 2BKVA 2EAUA 1JAYA 4MARA 3HN2A 4CQNA 5BN4B 5LZ2A 3AR4A 4JXXA 4IDEA 1ST2A 3BILA 5CJPA 1G4HA 3IP7A 4YJDA 2Q4TA 1JVBA 1B7GO 4RQTA 5G1NA 1F06A 3N6RA 4MV0A 1WCYA 3WL7A 3Q11A 4ADSG 2CGEA 3FHTA 1KC3A 5IC5A 1ZRMA 3E1GA 1Z2CA 2X7XA 3W8RA 4NCIA 1L7VC 5HIAA 4I4IA 1TNDA 2Q2VA 1U98A 2RGAA 3KYBA 4YCSA 2JIQA 3FTQA 3M5DA 4BO9A 2NVWA 2EC5A 3DWIA 1NIJA 4PSVA 2P1ZA 3FTNA 4U7FA 4U3JB 2PZAA 4J7UA 3O3OB 2X6RA 5F33A 1QONA 4B74A 4Q6BA 4X45A 3L8MA 5BV1A 1EK2A 2YWXA 5A9SB 4KQFA 2VQ3A 4R2MA 2FUKA 5G2OA 4YMVA 2ZTLA 2OV6A 3C48A 1ZU4A 1J99A 1D0IA 1C1XB 3KETA 4CV0A 5TMBA 4NV3A 1YC2A 2CYCA 1V6CA 2ISQA 3RBVA 3ROPA 5DP1A 2YJ4A 1XXHE 3GGPA 4A2CA 3VZCA 5BNFA 4EZEA 3H6HA 3B7PA 3KLNA 3JQBA 5TGDA 3RASA 5A2QA 4QTYA 1B43A 5F73A 3KJHA 1AS2A 2FH5B 3JARA 2OMEA 4PR3A 1T35A 3LBAA 4Q9HA 4KTVE 5E9WA 4AMUA 4CQMD 1OF1A 4Q48A 1OFIA 4A15A 1CRQA 5JNTA 5EJ7A 3CRZA 2QRKA 4RK0A 1IK4A 1OI7A 3ZDQA 5JPDA 2MSWA 3RUFA 4M88A 3VSAA 1D03A 3DL2A 3NHZA 5DWVA 3JVEA 2BDEA 3EZXA 5CXSA 4F38A 1BX0A 1DHRA 1E96A 2CDCA 3F9CA 5LIPA 1ZAYA 1WXEA 1A76A 4MWGA 4F9FA 4JVNA 1L5VA 4OHMA 1NVTA 1W9MA 1K98A 3CW2A 1U2GA 3DTVB 3RVOA 4CQJA 2XB2A 1UBNA 4ZZ3A 2HGZA 3SR3A 2M6LA 2WD7B 3C6KA 1KZGB 3HBFA 3A3YA 2GN0A 4B35A 2RG1A 1BMFA 1O97C 2I1WA 4INAA 1V8BA 3WBKA 1EHIA 3PHLA 4X6UA 2C84A 2CEAA 2BFDA 2SKCA 1G38A 3AM1A 5B3LA 1NJ1A 3ZV7A 4IYJA 2UZ1A 1T34A 4N40A 2I66A 5EHQA 1GCAA 5G1PA 4W99A 5A6SA 1EZ4A 2ZQYA 2IEBA 5CK5A 1G8FA 4G4JA 1RI5A 3ZIDA 3AVWA 1FW6A 1FUYB 1N5KA 3IVMA 3MLAA 3KYDA 1X7DA 3UNXA 4GWGA 1Z12A 1BWPA 4DV6B 1RU3A 2AG8A 1UQRA 4M2LA 4TT3D 4JLWA 1YK1A 3F78A 1VJCA 3C8MA 3L7DA 2ZAIA 1QHIA 1U5CA 4GSLA 5ES3A 4ZAGA 1WSDA 3KWJA 3NBZC 1YBVA 4OO3A 3DL0A 3TVYA 4V24A 5EQFA 4MQEB 1TUBB 4R9NA 3TLJA 5KAMA 2PS1A 4BLQA 4XYEA 4BB9A 3SXUB 3R7AA 1TIBA 4ZVUA 2FLKA 2GHRA 4X7MA 4AZ3A 1QG4A 3G5LA 4F6LA 3O84A 5ESWA 2OAP1 5D87A 3ZCVA 4Z3DA 3U7QB 2ZSHA 1MB0A 3TNDA 2NN3C 4E5YA 3R9XA 5LLSA 1FP2A 3SFTA 4EL5A 4HVCA 4JXZA 1XL0A 4R1NA 1PFQA 1N2CA 2JLAA 4HLDA 4LV5B 2IYTA 1PG2A 1JPNA 1FFEA 3PDCA 1K6XA 2OAQ1 4UJ3A 5DK6A 1JPJA 1NASA 4G0WA 3TEJA 3RYIA 4B9AA 2WBLC 2WUEA 2A9JA 3MTJA 5CXUA 3H0CA 1FL9A 3TTWA 4PX9A 4GL2A 1X14A 4K2HA 3BF8A 4AKHA 2PX5A 2A59A 1UZLA 3FZQA 3L4BA 4MZXA 4Y9UA 3S44A 4YIHA 2Q1UA 2H00A 4M0CA 1N75A 3H4IA 3K30A 3NRJA 1K8YB 2W00A 4LRWA 2PUTA 4DTCA 3DQZA 2IHJA 3F97A 1DX9A 2JGFA 2VHQA 2FJ0A 3CB2A 3MUOA 3KCQA 4HQFA 3EVDA 1T43A 1MH9A 3CGWA 3IFSA 1TCCA 2NXWA 4UE3S 1UBSB 1CUJA 1TK9A 4B6OA 3ZJ4A 2F59A 3K9BA 1LQ2A 1Y9EA 4BE4A 2QXTA 3TMAA 1CR4A 1NUSA 3T0GA 1DX4A 5CFPA 2NZUG 1GKIA 3GCZA 1BX3A 4BLSA 3DVLA 4HFJA 5BW5A 5LQCA 4YY3B 1P5JA 3K6KA 4PQYA 3SJZA 4NMWA 5LQAA 1T6BY 2ZE8A 2FK8A 4KDEA 4L8VA 1DINA 3IPYA 4LBWA 2FGJA 3VAYA 5K8UA 1Q83A 2QY9A 3IAS1 2A3NA 2SKDA 5GJCA 4ALJA 3K5IA 2ZWPA 5JC8A 1BZYA 1DVRA 1TKBA 4LSZA 3OE7A 4ZVMA 3SHOA 3ONWA 3DKRA 4JEUA 3TJMA 5BV8A 5C80A 1KO7A 1JMKC 3L3BA 1FXSA 2C2WA 3OQ6A 4OM7A 4W6QA 4MKGA 3TXXA 1E32A 2KWIA 3M7IA 4B44A 4ZDJA 3R2JA 1JWBB 4IILA 4TS3A 1XX6A 1B2LA 2RJNA 4Q39A 2UDPA 3KJZA 4OMFG 5FL7D 1YJBA 4MPDA 2IIPA 2Q6VA 2UKDA 3MRVA 4AG6A 3FNIA 3HB4X 3ORQA 2F8MA 4RGVA 4J0FA 1D7AA 2O5CA 2XT9A 3OM9A 3NOOA 5I6DA 3LLUA 3ROKA 1KVQA 2EFYA 1WJGA 3D8TA 3ZZMA 3TFOA 3ZQ4A 4QDTA 5FHRA 4J91A 4MVJE 3BGIA 3HJFA 3CZAA 1GZ6A 3Q7EA 4HH1A 3FMVA 4ZWNA 4B7UA 2ID9A 2C7VA 2CVOA 3PFKA 3R3ZA 4RABA 5DLPA 5A9TA 3HVIA 4MMZB 1HNNA 5EMHA 2W8BA 1U3FA 1QPZA 3EQ6A 1SCUA 4E5DA 2AOUB 2OO5A 4H3KB 1YTUA 4WXMA 2HM7A 1Z17A 1G9XA 3DHWC 4HJRA 1A5SB 3GARA 4D4HA 4JP1A 3AUXA 1EU1A 4TMFA 3LK7A 1YF3A 3WHPA 1W87A 1LU9A 1GPLA 2DH6A 3K9HA 1SEPA 2CHVA 4LDZA 4F3NA 4BMXA 3AESB 1CY6A 2PYZA 1VPLA 3FYCA 3KO8A 3R23A 4LNUA 4PWZA 3WTBA 1FJXA 3JSXA 3F1KA 3M5PA 3Q2IA 4TQUS 4ND8A 2PUGA 2RHHA 1SXQA 2ILTA 2V9PA 3VZSA 4FFOA 1W44A 3UVEA 4BLTA 1X77A 4C4AA 5KVCA 3VR2D 1YS9A 2R7KA 2CKDA 2JD2A 3QBVA 2YN2A 2C2ZA 4HYQA 4LDQA 4O4LA 1XYGA 3UPTA 2IEAA 3RUEA 1PFWA 2BR5A 3CXUA 1E1RD 2RH9B 3GA0A 1QDEA 3WGUA 1BVRA 1ONSA 1M34B 2HPHA 4GNRA 3CX4A 4YO8A 4AKGA 1FFBA 1Z13A 4L5YA 1WBBA 2PUFA 2KHZA 1GQ2A 1IRXA 3H6GA 4PHFA 4OXRA 1OU4A 4RLQA 4ZJZA 3PLRA 4E13A 1D5CA 1T0PA 1X13A 4FFRA 2J85A 3W3AH 3WWOA 3SJCA 2G3YA 4B7CA 5J9FA 1E9EA 1RHMA 4IW3B 3IQIX 1PGOA 2VPIA 3PU6A 3VR3D 2Q2QA 4UMDA 3B48A 3L84A 2XZOA 5KOHA 2E55A 5TSDA 3BGSA 1RQGA 2VWQA 1KDPA 4PBTA 3OM1A 1SXGA 4DSUA 4BFVA 4FFBB 3JWEA 5CDSA 2OV2A 4JI4B 1ICEA 2C0PA 2UAGA 2ONJA 1XRNA 2HSZA 4TTVA 3V8NA 3AF5A 2FN9A 1U3GA 4ZPJA 3RFUA 3QKSB 4FOSA 2LGJA 1A9ZA 2YJ5A 4G1EB 3ROEA 3UG7A 2AX4A 3WZLA 3GLHB 1E3IA 4DKJA 3OPMA 3QFFA 2H1LA 1Q77A 2WA2A 2ZPTX 3B51X 4WKCA 4EJFA 4OP1A 5CURA 4LJLA 1RQLA 2PG3A 2XXJA 3E0XA 4DNPA 1B1AA 3PYXA 4MRRA 5EQTA 4N7JA 4C3OB 4O4IB 1YRQA 3V7FA 3P2YA 3R6LA 4H6WA 4OXNA 3F47A 3P0FA 3TFQA 2OHXA 3ZKWA 1T5IA 2O7SA 5FTNA 3AONB 1SU6A 3WRXA 2VK4A 3FYUA 4JZKA 3HJRA 4LA4A 1T9ZA 3MT8A 4PS0A 4QHYA 3WS7A 7GPBA 3MCAA 5KBYA 3PYLA 2QZZA 3D59A 2CLOB 1D9XA 1KVTA 3KOMA 3FKSD 1I5RA 3EG5A 1LW7A 3LRPA 4KK3A 4QYTA 4AO6A 1WZNA 5KNCH 5M5BA 1CB0A 1WNTA 4RY9A 3C87A 3KZOA 3ZU2A 5DXAA 5EJ6A 1W4ZA 4QU5A 1JQAA 4DSNA 3L1IA 3B6JA 3AEQA 2L82A 2ZW9A 3HDVA 3EPJA 3DHEA 3BMQB 2HH9A 2V7WA 2H4YA 4QNNA 2PZFA 3EC2A 3GRAA 1K06A 3MJDA 1MQ9A 5KSWB 3BRCA 5IM4F 1M0WA 4NAUA 4Y6QA 2Q5JA 5CW2A 3NR2A 1Q1BA 4PZZA 4AP5A 3OJWA 4PCAA 4BEJA 5CD1A 4KACA 4FINA 4WEOA 4INJA 4LFAB 1RAAA 3ADOA 1ZIPA 4IDHA 4K9NA 1NU8A 1R9NA 1VE6A 2FVXA 2VP9A 3E22B 2VK8A 3C7DB 1L1EA 3W6ZA 2VJNA 4CM9D 2X1HA 4R7ZA 5I48A 2XSZD 4Z4HA 4IFEA 2YV5A 2I4NA 1LLCA 2QTHA 5EIAA 4OAQA 1U7UA 1EX7A 2A94A 4IH1A 2R8YA 4RMGA 2FFBA 3V5NA 3VPCA 1UZAA 3D8UA 5JNRA 2HBRA 2J0QA 4AZVA 1XRPA 1CHDA 2BM8A 4EMUA 5BW8A 3K6RA 4XQ0A 3WO1A 1ISRA 3ROMA 2H2GA 4AMYA 4DLVA 1QNFA 1THMA 4B4VA 1WXDA 3AM4A 1SUFA 4HX9A 4EY3A 2BOVA 3V4SA 3PNYA 1RE1A 2VEOA 1XTBA 2FW1A 2GRJA 5KU7A 1IJKA 4U9IS 4EVQA 4A5SA 5I7FA 3DDSA 5TR9A 3S1SA 2X9LA 3QYPA 3I2IA 4X94A 4L16A 5DASA 1WR8A 1WS6A 4A0GA 2GYYA 3UN1A 4XKJA 3ANXA 4UUQA 1EUCB 2DE0X 4AG5A 4ARBA 1MJ5A 1EINA 1ZIXA 1ZN9A 2Y2UA 5B3JA 1NBHA 1BW9B 4M1MA 1Z2OX 1VYUA 1E6UA 4JHLA 3SLGA 2FWMX 1YU9A 1KBQA 3CCCA 3CPSA 3EZGA 3HYLA 1US8B 3KZKA 4RH0A 1BWQA 3THXA 1JW9B 1C9KA 3H5WA 4ZVPA 3HC7A 1IHYA 4Q6WA 4FIZA 1SUDA 2Q3JA 4TSFD 2R6HA 3WMRA 1VPWA 1BQ3A 4FU0A 1E99A 1BN6A 2FEXA 1SCKA 3SEAA 1LPOA 2FNAA 3RWMB 3DFKA 4KPEC 2TECE 4J4TA 4FOTA 2HWWA 4LMPA 3BA6A 4ZXPA 3U31A 2ZU6A 2IUSA 1H2YA 2GSDA 3VDNB 3N2KA 4V0ME 5JMWA 5K51A 3ELDA 1U7WA 3JD1A 2EBFX 2HRZA 2XUDA 3H1BA 4H4DA 1IIBA 2J3LA 2GZ1A 2NW6A 4M1ZA 1E3LA 4OMCA 2AI3A 4RWEA 3R7FA 2R8RA 1XL1A 2H1RA 2I3GA 3W6OA 4Q3NA 1DTWB 2NUTB 4JI1B 1EP1B 4GX5A 3AGPA 1JHXA 1Z15A 3ZOZA 1XPOA 1NQTA 4L27A 5MGBA 3GOQA 1DRVA 1XMVA 2EYQA 1A1SA 3EOZA 4G5GA 2WWRA 1L7MA 3A6KA 5LLTA 2PJZA 2GZSA 3T3GA 2HLNA 4G4GA 3GWGA 4YPVA 3FFTA 1AUOA 1R8QA 4II3A 1PR6A 2FK7A 4JL6A 1MG0A 2W2KB 1P6QA 4OI2A 3QOWA 2BYTA 1ECJA 4EKGA 1OFHA 4XDYA 3VO1A 3OESA 4QGFA 2QAIA 1SU4A 3HXLA 4DREA 2QL7A 1JSZA 3PC2A 4HNSA 1V4VA 1VCOA 1KH2A 1CZLA 2JLRA 4OXXA 3LC1O 4MP6A 2C94A 3BIWA 2GJ4A 3VR1A 1HEIA 2QTVA 4CW7A 4D6XA 4EYGA 2B7BA 1DP4A 3EDQA 1XPUA 1G5PA 2KW5A 3AF1A 2JS7A 4IDNA 3HA7A 2WM3A 4KXNA 4FLEA 4ID9A 4DB2A 2EFHB 1E7YA 4RV5A 1ISJA 1GHTA 4JUAA 1P1KA 6PFKA 5KC8A 1PV4A 4DXHA 5E8RA 4A8PA 2CHGA 4N5IX 4J3NA 1XDSA 2ZAMA 1ZK3A 1V2GA 1CYEA 4JWTA 4RDXA 1GRQA 2PGLA 3GRZA 3H0EA 4G56A 5MN4A 4OLAA 2I3DA 3HG7A 3JQ8A 4UZFA 3ESDA 4DM3A 3CMCO 4YC7A 1K0FA 5SY4A 4PYNA 1ZW6A 1U8EA 1PQUA 3G9UA 4FSDA 3V6MA 4OATA 3G0CA 4KQJA 1HBJA 4MR9B 2HXSA 1ULZA 1X42A 3GLRA 1T5LA 4ZRMA 1YJQA 4GYJA 4PE5B 4R2JA 5AK3A 3U5ZB 1MIOB 1D7OA 3ZE2B 3WDSA 4D46A 2L17A 1E7WA 1P5ZB 2H4FA 1CZRA 3AG6A 3ZWBA 4CF4A 1WQ1R 3MUEA 1MW9X 3MGKA 1WCWA 1U90A 4ENVA 1VE5A 3B9QA 1XN1A 2MSLA 5EFZA 4JEIA 2YMQA 1T10A 2WU1A 3JQ7B 4LYDA 5K01A 3TD2A 1NUPA 2HMVA 2ZJYA 5E6UB 3DVQX 4RK4A 1Z7YA 2G04A 2BGUA 1UMDB 3TW8A 5CCBA 1GGEA 2W43A 1V8DA 2O50A 5A7HA 1WB4A 2JFUA 1L4FA 3H2KA 5J40A 2O8BB 1QUFA 3LPLA 1JT2A 1CUSA 1L4BA 1XKLA 2O23A 1QO7A 3ENVA 1XCMA 1ZVKA 2DGDA 2AK2A 3LI2A 1JV2B 2B4QA 2XD4A 1J06A 4N8EA 1XP5A 2N0SA 4YDQA 3NPAA 2WMDA 4B3TB 9ATCA 1JZSA 4BRUA 2C8KA 4NFHA 3H17A 4RHEA 5HMLA 3BB4A 5HKBA 1K7XB 2BTQA 5DHUA 3CUWA 1GNPA 2QN2A 2WHYA 4EB6B 1TJ3A 5FWNA 1DDGA 1SXJD 1Y98A 2F1KA 4DY6A 3PLAE 4CKBA 1T4MA 3RSZA 4L5AA 2GAFA 4NNJA 5AKZA 3OM0A 3A6FA 5J4VA 1TVKB 3SQXA 3ED1A 1UXJA 4DLRA 1FS4A 2H1VA 2R7MA 5BPHA 4KGXA 1XKQA 5DHSA 1P8AA 2HL6A 3HBMA 1GNTA 4LE0A 4EKNB 4BGDA 2BM1A 4QYIA 4UE6A 5HQTA 2VPZA 3HWX1 2VYVD 3D7NA 5FYDA 4C22A 2G70A 2YZKA 4NJMB 5LBIA 3EDRA 5CVEA 4YDSA 1PQWA 1AKWA 3L8GA 4BNGA 3AFHA 3TZLA 1IM8A 5H1YA 5EE9A 3IUNA 2K5UA 4KAXA 4FYHA 2F3QA 1TF7A 4OJTA 2OFFA 3OIWA 4RF3A 1N32B 2J6IA 3HJAA 5HFAA 4W7HA 2IH2A 5LMZA 1X80A 1A2BA 2Z04A 3FKJA 3ADKA 4ACAA 2G7MC 5DNUA 3OTHA 3MWJA 3NIGB 4PY2A 1NPYA 2L0XA 1YVDA 3U13A 1J5XA 5AJUA 3FAZA 1JEDA 2OGZA 4OHKA 1QFMA 3VU3A 4DT1B 3FCEA 5KYKA 2HA6A 4GUAA 5LQRA 1KI6B 4AD8A 3K5HA 1OA1A 1KR2A 2B1RA 3W4IA 1QH1B 1C81A 2FSSA 1NULA 1ML4A 4MQ4A 3WK5A 4MYDA 1ULUA 2J9FA 4MYRA 3T7CA 2R97A 3PE3A 5FA8A 2BFEB 1RDFA 2X19A 3EH1A 2OCKA 4V2IA 1U02A 3K2IA 4LSGA 1TE2A 3F96A 3FBGA 3NBFA 5D1NA 3JYHA 5FJIA 1OIWA 3KAKA 2AEFA 1VSVA 4ZU6X 2ONCA 3RWBA 1DAPA 1L5HB 2IYEA 2ZQ5A 3D7LA 1D1QA 4GE0A 4RKWA 1RPAA 3SX2A 1EYZA 3VTZA 2GKGA 2HOQA 4EVIA 2OK7A 1L1RA 4X1YB 4CMEC 4TTIA 4W63A 5F4BA 1BGVA 1LF5A 3IE1A 1SXHA 4YLEA 5K0FA 3UB3A 4JOSA 5JVDA 3GDOA 3PQ8A 3OC0A 1XPJA 3L0ZA 3VU1A 5BNZA 4C76A 2AL7A 2PUVA 1JR6A 3CM0A 2YBEA 2R7LA 4RJTA 5I45A 4NJEB 3M9WA 2OBMA 4LYEA 4BNXA 4R6WA 3MFYA 3KD2A 2F00A 1NVVQ 1W52X 2FN7A 2H4WA 4N7MA 1SOUA 5EA2A 3UTCA 4LGCA 3PFFA 2IVFA 3ESXA 1ODJA 2X0JA 2QI9F 4BFWA 3JD2A 1YDMA 1O97D 1TW3A 4DJ5X 1VYTA 2GF2A 3W9SA 4UPEA 2F55A 3R1IA 1T6NA 4MLZA 1ZHHA 1L6IA 3ZHVA 1BX1A 1J1ZA 1DPGA 1Q0LA 2PCLA 5E3JA 4MS4B 4ZEMA 4MCAA 1RBQA 3RI3A 1XI2A 2WVGA 2C7RA 1MRZA 2PMFA 1XMJA 2OV4A 1IL0A 1B6TA 2VT3A 1VLHA 1C0IA 3OMXA 4RZQA 1W0JA 3UXHA 1U5BB 1XEFA 2JVIA 1E1NA 1WMBA 3B89A 4DC0A 5CG2A 3HLTA 1HRKA 1RPTA 3A9UA 5A9SA 4D3FA 1WHTB 2QRQA 2WYHA 4NV0A 3HNPA 4EATA 2YASA 3A9RA 2YS6A 4U39A 4AF7A 1AF4A 1HSOA 2KJQA 4V03A 4DWWA 4NEQA 3OCVA 2RAPA 3C7TA 5EWLB 2W42A 2PQMA 2HHAA 3TIGA 3Q0EA 4IRMA 3LSTA 3F1LA 4UBLA 5KNDA 1FQKA 1ZD8A 1ZXXA 2GEUA 3AIIA 3KEQA 1WUKS 2RBEA 2WHRA 4HK4A 3LA8A 4OHBA 4ARAA 4S1NA 4YRNA 2B9EA 1N9KA 2PZGA 1JP7A 2IW3A 3DZFA 4FGWA 5LWQA 2UXDB 4HDKA 1E2JA 5C5DA 2CJXA 2HA5A 2ANBA 5F2EA 2NNLD 3TQIA 4BY9E 1RJWA 2IDMA 2QZ4A 1Q14A 5LP6B 2YCBA 4YMTA 3AVQA 3BC1A 1V5FA 2IEGA 2ZUTA 3U9TA 5B36A 4MGZR 2PR7A 2ZE6A 1T36B 5CA1F 3BE5A 2MIIA 3M4XA 2H2HA 4ND2A 4NC9A 3GB9A 2GCOA 3S7TA 5B7GA 3E2PA 3TN7A 3S55A 1P1IA 3OTQA 1J0EA 1H6AA 2EEPA 4HP8A 1KC1A 3BXGA 3KPUA 3KQMA 4IXMA 2I6GA 3F71A 1V3UA 1J9ZA 3L7CA 4RJJA 4G1UC 3DZ8A 5EAIA 4UTNA 3AIOA 2GETA 2QVXX 2RI6A 1ATZA 3A32A 2FV8A 2EFDB 2QQFA 2QX8A 1C9EA 3GY0A 4RD3A 4B75A 3WJ7A 3U56A 1KAGA 2BV3A 2JA1A 4EBFA 5AKYA 1OIVA 1Y33E 3PGLA 2O2EA 5AK5A 4CU2A 1T25A 2E6UX 5AM4A 1WLYA 1CKEA 1RM4A 4UCQA 4UHCA 3L5OA 4BV9A 3USZA 1JAZA 2IWRA 5CYPA 1LJ8A 3UMRA 2O3TA 5CNIA 2XT6A 5JMPA 1C9DB 2PKCA 4TV9B 4D43A 4YJ3F 4IDGA 2VP3A 2FZKA 1AGPA 1E4OA 1RQ7A 3EDMA 2RIPA 5JAPA 4BKMA 1Z0ZA 4HJXA 5CNKA 3HE3A 3ETHA 1I33A 2VUUA 5DISB 3JRWA 3KTAA 2BR4A 4GEGA 5J2TF 3GQBB 4HGZA 1ZHFA 3G5MA 1VIVA 1ZMOA 1KFJB 2FWPA 3RREA 1JLLA 4Z4IA 4J0IA 1MMFB 1IN6A 3GJZA 4JGGA 1P0CA 3RVKA 1QP0A 3INRA 5BN5B 4EG7A 1EH5A 4NE9A 2X58A 2GN6A 5BOSB 4E1AA 1C3OA 1NJGA 1WMFA 2WDZA 3ECCA 5HIJA 2OV1A 5IDVA 5IVHA 1QRUA 5I3ZA 5IMSA 1FQWA 3EDOA 1O0BA 3QELA 4RIFA 3URKA 4WGFA 4D80A 2PUBA 1NDUA 2Q9AA 2YW9A 3MHPA 4XJVA 1KY4A 2R25B 5AJYA 9LDBA 3S81A 1E5DA 1NRXA 4JJAA 3I52A 5IANA 5LPNA 4EUFA 3RARA 2MSEB 3HYCA 2Z8XA 3UF0A 5IW8A 5TC4A 1K4MA 5I7SA 2JGIA 3S3TA 3G2OA 1FYXA 2D13A 2BZ1A 3O4IA 2NX2A 5K0GA 4YPOA 3IALA 5BWLA 2NV2B 2XCTB 2C7OA 3IV9A 2P2CA 2DJ5A 3F7NA 5KEIA 2GRUA 4B3MB 4K6HA 4Z4EA 4GOOD 5BWNA 2PBLA 2V97A 3HGTA 4ZU1X 2RKBA 2CNNA 1LDGA 3H5IA 3G7SA 3IUSA 1SBQA 1YB5A 1XCLA 4XUGB 3ITKA 3ZCUA 3BTSA 2R6DA 3FVQA 2ZBVA 5I4KA 2A0YA 1ECPA 1GJRA 1B0PA 3LL4A 1QU3A 3FPSA 3U81A 3NYQA 4QDOA 4AUMA 3IAS6 1K7CA 2DBQA 4PEVA 1EGHA 3BDIA 2IYFA 5K0EA 1Z37A 4ZARA 3WL6A 2JHAA 3NIBA 1LK0A 5JG7A 3IO5A 2IYUA 3TTYA 4MS1B 4REQA 4CUJA 4FBMA 2DQSA 1EVYA 1S2IA 1BS1A 1GA6A 1U1IA 3FZNA 1XCBA 3HO6A 1R6AA 1F5SA 1Z2AA 3BERA 4QG7A 4GFDA 3LPAA 4PYKA 4MB0A 2XNDA 3WQHA 3KP1A 5ESRA 4CMBA 3AVOA 3O2JA 4ZA2A 5C3UA 1DO8A 1JYFA 1PLKA 4XYGA 3B3FA 2HB6A 4CQMB 2YC4C 3KX2A 2IH5A 3IQZA 2R4TA 4MVYA 4C6HA 1FMFA 1O5TA 1SPBS 2EFCB 3B5IA 3U9LA 1N2IA 4LTDA 2XZLA 4BC1A 1P5FA 4INZA 3KQWA 3EXHC 4FHGA 3HUUA 4TGLA 3UGKA 1L4MA 3EPPA 1NW5A 2JI7A 4MUGA 4TRMA 3B1VA 3ROXA 2V03A 4LXXA 2OHHA 5DO9A 4RA9A 4MQMA 1L5SA 1KDTA 2ZIWB 3BCSA 3UC9A 3L6DA 3J81k 1LLFA 2MT9A 4I08A 1BAPA 4BMPB 1A5TA 4G07A 2PY6A 1LVHA 1FIUA 2V6JA 3Q8WA 2AQIA 3WHKA 1JF8A 2QQEA 2ORIA 4PG4A 3T3DA 2CK3A 1ESZA 1R0SA 4RXTA 1R0KA 2R47A 4J16A 5FOSA 3GJSA 3ZDDA 3WV4A 1ZZGA 1ZLYA 2I1QA 1FDWA 3LX5A 4X95A 2BKXA 2WWVD 1DEXA 4BV8A 1DFIA 2I6FA 1E0KA 2GEKA 2GCPA 1JQBA 2QTLA 2XRFA 4EP1A 1AMNA 1YOVA 1YJCA 2SHKA 1VRCA 2D2VA 1FYEA 3DUWA 1ZRHA 1Y7HA 2HF2A 4EAQA 5EYPB 1EFVB 3O4HA 1HYGA 3PGXA 1OIXA 1PHRA 4ASUA 2W2TA 3NMUF 4W5OA 4XYMA 4PV7A 3WY9A 3KOYA 2G6BA 3DDCA 4IFBA 2HJGA 1QRRA 3PZBA 4E4TA 3W9UA 2GBIA 2QMYA 4G09A 2VJOA 4PGHA 2W22A 2V5VA 3QF4A 4CMGA 2MR5A 2II6A 3OH8A 3OM8A 3UW1A 4DSZA 1VMEA 1CUZA 1FRQA 1AKQA 3LVQE 3ZGOA 3W04A 4OYYA 2ZG6A 5EMKA 4AJHA 2CSXA 2PQ6A 3QX3A 3II6X 1RKBA 4KWCA 2GVNA 5DNAA 5CA1B 5LOVB 5JH7F 2O1WA 3DZHA 3F4BA 3S2SA 3C3WA 2XDQB 1T2CA 2IUEA 5AW1A 1K6JA 1M74A 3EDYA 4BUZA 1QTRA 3BRWA 3AFMA 4QGBA 1QHYA 3QE0A 2WT8A 1UAGA 2DB3A 5EUCA 1V37A 2D00A 2BBWA 3DXYA 3ZDXB 5EJ4A 2FLVA 3UWPA 3LQQA 3K0EA 1R6DA 3C1TA 2PUAA 4W5QA 2JGEA 1B8NA 1YL6A 1TTQB 2A9VA 2VDQB 3SIWA 1E69A 3SF8B 3MWDA 2XMRA 4P32A 3NKFA 3RDPA 4C4RA 3U19A 1BXRB 2FFHA 2PX6A 3F98A 3BJZA 4HEHA 2NVUB 2DEUA 3CLKA 3IBSA 4ZQIA 2IYQA 2OO7A 4ZT3A 1NBOA 3OEEA 5D5HA 1GP2A 3U7HB 1EFLA 4QQNA 1W4RA 4J3FA 2QAGB 2VC2B 2VPYA 1N2CE 5HYVA 2BMDA 4QVGA 1P8JA 3BH0A 1G64A 3GP5A 3ER8A 4RPCA 4UREA 4FYIA 5J2TB 4KQ9A 3R7SA 2PUEA 4HAZA 4O4HF 5ALNA 1OXUA 1I4LD 4G1MB 1CZNA 4IL5A 3FUWA 3VZBA 3DA8A 2DKNA 3OY7A 1Z0AA 1ZUIA 1R6TA 1SCNE 5DX1A 1YCDA 2V7GA 1SZCA 3MJCA 1KNXA 3RIMA 3WIOA 4QODA 3ZQKA 1QHHB 3QG1A 2QJWA 1CR6A 1P7YA 1EESA 4KVAA 1V0JA 1UDBA 4G3XA 5KHLB 1AKUA 3DS8A 4RACA 3BH7A 4WJZA 3JYOA 3BMNB 3GLGA 5H3HA 4KFTA 2VRCD 1AHNA 2H8KA 3NV9A 1PT6A 1T5OA 1BXZA 3X1ZA 3HRIA 4E5NA 5DFAA 1SXIA 4BE9A 3X1JA 4UTOA 4B48A 2ZSAA 3OZWA 4EYOA 1EA5A 4LWPA 3I73A 1KXJA 3K35A 1TJ4A 1NJ6A 2YUIA 2GEJA 1WCV1 3Q6MA 4V02A 3PI6A 5DYGA 3CWZA 1E79D 4PC6A 5JBQA 2OSBA 3ZIAD 1HZZA 4WLFA 1GUFA 2DHQA 4NYIR 3BZWA 5LKRA 3UMMA 5TARA 2F8TA 3EGIA 3O9ZA 4N12A 2AF3C 1RWQA 4KRYA 3LIIA 3WMFA 4FDUA 4P83A 2EKLA 2ZIXB 3QJYA 1XA0A 4B6GA 1ADFA 4KV9A 3VOAA 3WQSB 4L7VA 4ZYLA 3LBFA 2P5UA 1DOZA 3IH5A 2WF6A 2QRUA 1SD1A 2WNSA 5HSGA 4G8CA 5FIUA 2WB4A 1J5PA 4PLPA 2GK6A 4AYWA 3QK7A 5JJLA 3WLOA 3PQ7A 4DR2B 3QM1A 3BSWA 1OXKB 2IPLA 3WGMA 4E51A 3PUVA 1T9DA 3THSA 1H6BA 1PZGA 3CW9A 3HUDA 4D8WA 3DF7A 4FTWA 1MAWA 4DNFA 3EIUA 3O8BA 1ISPA 1NVGA 1V4NA 4OL9A 3STTA 3R5FA 4D26A 5DF1A 5FHQA 3G88A 5GJWC 4BU0A 4JVMA 3T3HA 2WWGA 1TJPB 1ATIA 1F6DA 1GCUA 4JJIA 2ZYRA 3IHTA 1IEWA 4PG6A 2OZVA 1X8XA 3OQIB 4QQRA 1OZAA 2CD9A 1J1IA 1KYWA 3FLBA 2FRDC 4EY4A 5LP6F 2D8MA 1DDOA 1PNOA 3HB1A 4PZLA 1UPXA 3WLPA 3BB3A 5A06A 1OX5A 1V43A 4BJ3A 3G5TA 3L4SO 4N3GA 5LB4A 2C2YA 4HF7A 2H0QA 1GKLA 3FDZB 2IOYA 4DLKA 1BCRB 4A26A 1OROA 1V1RA 3A7DA 1J2JA 3H5RA 1FDIA 2A1UB 2C97A 2JANA 3CGGA 3NJ8A 2R5WA 4GI7A 4H7FA 1OI3A 4KQ2A 4WKNA 1ZJJA 5JQGA 3A4MA 3KAPA 4Q3OA 3FUTA 1LKZA 2WOJA 4HN4B 3QPWA 2CFSA 1D4ZA 3VRHA 4Q9IA 4K8OA 2H1FA 5KHAA 2LTAA 1CUBA 1GADO 1V4BA 2H1HA 3KZ1E 1PW7A 3RVNA 2PZEA 2XDWA 3LLCA 1ZONA 2KLHA 4ZK6A 3MF4A 1OLOA 3EIHA 3IMKA 3S2IA 4ZO6A 3MBOA 5JI3E 1FS5A 2Y1OA 3ZQJA 3FWYA 4KO4S 4KPYA 1GGNA 2GD0A 2X13A 1J23A 3P26A 4QUAA 5EE1A 1LBIA 3GLFA 3R0QA 1AK1A 4H1VA 4BKQA 3FSEA 2BE9A 3NHBA 4CL3A 3C41J 3C4JA 2N75A 2CVPA 2GK4A 5KQRA 1L5FA 1AZLA 1RBYA 2XBMA 1K8RA 1LW6E 3O94A 4XQEA 3LDAA 3KQOA 5JSQA 1JJFA 3D6VA 3SICE 1XE3A 3IUJA 2BSAA 2BGLA 2H0RA 2NUTA 4GYYA 2ZDQA 2DCMA 3UHJA 1U2TA 5CVVA 5EZ6B 1ZEMA 5JY1A 4BNZA 5CVJA 5A9RA 3F3SA 3I8OA 2YJNA 2VDLB 2I22A 4RD4A 2I2DA 4DDTA 1X8KA 3H2BA 4IX9A 4ZQCB 3UAZA 4GKBA 1ZSVA 1EXDA 1K7SN 3NHLA 3RWOA 2O8FA 3N2IA 3KKEA 3DZGA 1K6IA 1P6UA 1U2SA 3BX1A 1PK9A 4P53A 1O95A 1FY2A 3FTDA 3OLWA 4Q9AA 5DBHX 2DT5A 4AZTA 2JI6A 2GNAA 3LWBA 2XVAA 4B3JA 4Z54A 2NNWB 2ZRKA 2GJ9A 1G7TA 5JH7B 1IM2A 2GMWA 5LVAA 5G0SA 2PLNA 1I4OA 1UK6A 2D0IA 4YK7A 4Z9XA 2GN1A 3G8AA 1K08A 2QF7A 3KT6A 1XWWA 4MCJA 1UT5A 3D3JA 5IARA 4EL0A 4B83A 2H11A 2AJTA 3CSUA 3F5DA 4NYIQ 4XVRA 5BXQC 2EIXA 1EDOA 1Y4DE 4XEHA 4O1IA 3VXKA 2BGWA 3ZK7A 3K0SA 4JT9A 4CM1A 3WVNA 1U2DA 1XTQA 1PYGA 3BWVA 4R2HA 3VBCA 4D96A 2QLNA 2PJDA 3ZGYA 2Z6UA 3PFHA 1J33A 4F96A 2HDOA 3I9OA 2RH8A 3QTLA 3CLSC 5EE3A 1KJZA 3WG9A 3CHYA 3DYIA 1AH2A 3OZEA 1VFPA 4IWXA 2A3RA 2Y1FA 2Q5IA 3O21A 4UVDA 1Y48E 5GM2A 3SC2A 2WQZA 5HWSA 3AUJB 4JJ7A 1JBKA 2AHOA 1Z8DA 4X8OA 3EZYA 1LNSA 4EPTA 3I76A 3OCUA 2J09A 5G1OA 5I9MA 2PN1A 4EI8A 1USVA 1KQFA 5CB0A 1W25A 2A92A 4NCXA 2Z95A 4OA8A 1ZMRA 3KKKA 1DKPA 4RCVA 1MC5A 1O1YA 2EL9A 1SVOA 1K89A 4GLLA 1JSCA 2JEOA 2V5AA 1E7RA 3G17A 4KYTA 4QTZA 1CS0A 1Z6QA 2XI4A 2J4CA 2Z3ZA 3ENZA 3KZCA 4JC8A 1K1EA 1SQ0A 1XOIA 4MA0A 4MUNA 5A0TA 5DBFA 4JBIA 3PITA 4IR7A 5BWOA 2O8NA 4YJ2F 5HOEA 2C5LA 2E48A 5CLIA 1WABA 4MS3A 3CNEA 4PC1A 5KYYB 3EF3A 1ZGCA 5JNSA 5MF6A 4TMVA 1U3VA 2D2IA 3QHAA 3DE0X 2AT1A 4G01B 1QIJA 3MAJA 1IFXA 2C54A 2GEBA 5K0SA 3GRRA 3GWZA 2QW8A 3P2OA 3UW3A 1I3CA 3ZU6A 2H4JA 1KE2A 3A4LA 2ZIVB 3LNCA 5K8TA 2N42A 4FYXA 2QUKA 1W36B 1T2NA 3R7WA 3EYAA 2Y4NA 1KEUA 3BJMA 1T1IA 3AHDA 1CJSA 1FFXA 1E2HA 1QVRA 1J2EA 2VTEA 3AGQA 2MMCA 3GU3A 2CCGA 4M1KA 2UV8A 5JLAA 4FHCA 3TVTA 5A04A 1YR3A 5TPWA 4BFXA 2FG7C 2PJRA 4P98A 4I4TF 1CJKC 4KUEA 4YPFA 1Q7TA 4WEQA 1A5ZA 2VPQA 3DBVO 5CK4A 3AVPA 3DW3X 1ZUNB 4HZGA 3L7JA 3GBSA 3KSMA 4R16A 3OVMA 4LCJA 5EINA 4GXNA 4Z7NB 3E7WA 4BNYA 1WXFA 5IFKA 3I4LA 4QXMA 4DS3A 4UUNA 3CZ4A 2FJUA 1F2VA 1C5KA 3AU9A 1JSLA 5IMBA 1WB9A 4HN9A 4GICA 1AHHA 2RCNA 2EJVA 1T2AA 1FLNA 5DZSA 2VBCA 2JDIA 1IE3A 3OZUA 4G5RA 4OUDA 9LDTA 1UXIA 5DEIA 3DHYA 2QDXA 3IUYA 2YFHA 3QPCA 4PG8A 4LYHA 2B9VA 1F2TB 2QVGA 2YXLA 1OVGA 1QGDA 1VGQA 2PGNA 3CF2A 5AM5A 3TLXA 3L8YA 4K9DA 1OBHA 3K09C 3QXCA 5BQ3A 3CISA 1QPBA 2ZZKA 3BA1A 5JYBA 5DBIA 3UGJA 3MS4A 2NPFA 1NFQA 3H5AA 4A8JA 5IS2A 2PZMA 1L7EA 4U7GA 3C3CA 3RS8A 3BUSA 3F5QA 1YD7A 3H11B 4LY6A 4YI3A 1OTYA 1PTJC 2H92A 5ARBA 4I19A 4NG5A 4TLDA 4Q1VA 3USCS 3LCVB 4P35A 2WV9A 5IT4A 4RV9A 5CD9A 1N0UA 3GCXA 3VR5A 1UT8A 3IOBA 5KQPA 2GM4A 2J46A 1T3GA 5ED0A 5AVUA 2G4CA 3LPMA 1D4FA 4ZCTA 1KU6A 3OJFA 2GZRA 4N9QA 2ZI5A 3VC3A 1MZVA 4JSTA 1VP9A 3IS3A 4AMGA 2GA8A 4LUCA 3CQ9A 3UJ7A 3NI2A 2H2AA 1MENA 2FCAA 2FPKA 4KKXB 3ZE6A 4DMKA 4I1VA 5IZ4A 5LQUA 5T41A 1T5TA 3GMTA 2WIKA 4X1OA 3BMXA 5FYQA 3RG2A 1NJFA 2CUZA 4ZCPA 1KVUA 1CP2A 1H05A 2G4LA 3JWGA 1EUDB 3UO8B 4NU0A 3UUEA 4RPHA 2WRZA 5EHNA 2K87A 5BMOA 1QTQA 1X94A 1DKLA 1JXOA 1BTOA 1RIIA 1RYMA 4R2LA 1H2ZA 2QU7A 5CLQA 1EFKA 3LLVA 4IM7A 3R5XA 4R69A 1BVHA 1KXZA 4LVUA 3DZKA 2CCJA 5ALJA 3NM5A 1QVZA 3ZX5A 2O7VA 3TF5A 2XUJA 4PZPA 4XD7A 2J9XB 3SQMA 5JCXA 1NDQA 4P0PB 3LQFA 4TUYA 1BHQ1 2IXBA 3K8QA 3ML1A 1SUIA 4GP9A 4EJSC 5EJ8A 3F7TA 3FPKA 3RS7A 4FSXA 3AP3A 3CRMA 2JBAB 3OPYB 5CDTA 3ENKA 1E2KA 1UT6A 3PCRB 2PXXA 3B6ZA 1UWLA 4RTNA 3ETJA 2WUFA 3K0HA 3PG5A 4BRWA 4CEIA 1GCOA 5FP0A 4Y6SA 4IIJA 3T5TA 3AMVA 1DZ3A 3EG9B 3L8CA 2O2HA 4LY0A 4KLZA 3RANA 1DWQA 5B6JA 2VP2A 5F78A 3SN6A 4HS4A 2PCJA 2NXJA 4UDNA 1M2NA 4B45A 3T1OA 1RTTA 2B4KA 4NK4A 4V1CA 1GNQA 1A7JA 1YS6A 1SXJB 2XMCA 3GT0A 3H7AA 3JVDA 4R1QA 5H82A 2YOHA 1XAJA 2QUIA 2I03A 2A7XA 3RHZA 4LJ9A 2WB2A 4Z9YA 2QRGA 4ABTA 2XYPA 3GA5A 4A6PA 1ZNYA 2YCLA 4RIEA 3K6SB 4XB6B 4X85A 3A4YA 1FSGA 4P7JA 2XB9A 4RZUA 3P97A 5E7MA 1Z8HA 3LC0A 3O38A 1VPVA 3L6OO 3E3NA 4FXPA 3T1NA 5JPCA 2WQ6A 2BEKA 4YJFA 4HGRA 5C7OO 1LSJA 2ZB8A 1FS6A 4CFSA 3HB5X 4Q4HB 3I8SA 1SCIA 1PKEA 1GXSA 1UM9A 2B5WA 4HLQB 4DA7A 5EP3A 2IHYA 4OSPA 1W7AA 2JFXA 3A3NA 2J7PA 2PD3A 3G0IA 3WRVA 1GRCA 2DPGA 2O3UA 3CX6A 3FAKA 4Y6LA 3GEIA 1L5LA 3JYLA 5FUQA 3U5TA 4B4WA 2QT0A 3DVRX 3I72A 4XUEA 4YECA 1XNQB 1SIUA 1FYVA 2B6HA 4CL2A 3A3KA 3REQB 1C8BA 4TMWA 3SYRA 3ZHTA 1RS0A 1WG8A 4KQMA 3HCWA 4TV9A 5AKXA 2KB0A 3V1TC 5KINB 5EJGA 3HR8A 1ZJ5A 1WUTA 1R8XA 4G6ZA 1P4SA 2KQUA 4J0DA 2TS1A 3TOVA 3K0FA 3JQQA 5BNWA 3ZS9A 3H1AA 1KJNA 1D07A 4I4TB 4UKDA 1M5RA 3IJRA 1FFHA 3F0TA 3N8IA 4RF2A 3GQBA 1SA0A 4ABYA 2DQZA 4LZAA 4XH9B 4FB5A 1TEHA 2H7CA 5GZ3A 2UUBB 1L3BA 2IU4A 4MVJD 2IK8A 3QXXA 1Q57A 4TM7A 1GPDG 3NYRA 2QSUA 4FN5A 4PHTA 5JNLA 5JSUA 10MHA 1FJGB 4R9VA 5BN5A 3OX4A 2GZMA 4C7KA 4JX8A 3MQ2A 2PGJA 1GSOA 3RYCA 3OEHD 4TROA 1E0AA 4WA8A 4YAWA 2QE7A 2B1JA 3FA2A 2J07A 2J0VA 2OXTA 4KO3S 4CCSA 1QUEA 3NPMA 1LTQA 1R0ZA 3K1AB 4JCCA 3GBVA 4MWOA 2XNJA 3WL8A 3O4GA 2XMPA 3TRDA 1FOEB 1L2TA 2FX2A 3RABA 4JNKA 3GRPA 2TMKA 3ILYA 1IN1A 1GCGA 3LAWA 3LWZA 1R0WA 2A4MA 2OBBA 1MG5A 2A88A 2N9UA 2VS1A 1B6RA 3L1VA 1RT9A 1IONA 4Z1MD 4BBZA 4D82A 1JU3A 2W6OA 5K0CA 5C1DA 1E9SA 3MWGA 1LD3A 3GLVA 2RKWA 4RL4A 1CVLA 3RRYA 5HJ5A 3I30X 2XRYA 2PS3A 5JSFA 1AMOA 1KKMA 3W7AA 3M4ZA 5A3VA 5ES4B 1DMRA 2C3UA 4QUKA 2CBXA 3OZDA 4HWGA 1F0NA 1OLXA 2H5JA 4RK7A 3FW1A 2YVQA 4L0DA 4BNFA 4Y7DA 4ICIA 2R6JA 3ASYA 4O8ZA 4DADA 3VFDA 1IPEA 1T26A 5AJHA 4I9FA 4M98A 2YZMA 3RTEA 2HUPA 1QYXA 2HRBA 2WOOA 3DD1A 3A1FA 2ECFA 1W8DA 5GONB 1TYEB 2RH5A 5TMPA 2WIJA 3U4QA 3AIKA 1OYVA 4XB2A 3RFFA 3PVSA 3GCGA 2DERA 2IVZA 1Q0PA 4TKUB 4LGVA 2ZFUA 1VHLA 1KI4A 4PTZA 5AO9A 3LP8A 3O8QA 3TOSA 3KDAA 5P21A 4ESEA 1SKMA 2J41A 4NARA 1OCEA 3WFJA 4A2QA 1E8MA 2YJGA 4GMDA 1LFAA 3VJLA 4Z49A 1X86B 4I4NA 4PBRA 4CU5A 3GLIB 5BQ5A 2JCXA 4TL6A 1AO0A 1DXHA 1U94A 2WZQA 3A37A 3CO0S 3QYAA 1DEKA 1G0OA 1M8KA 1BU5A 4HFNA 4ROSA 5TGTA 3WYAA 3OURA 1NUHA 2AMVA 5IVKA 1VPTA 3MQ4A 3CYFA 4U2KA 3B85A 2ZSFA 4FYYA 5IULC 1DC6A 4I55F 1CY1A 3TQQA 1QKJA 3BIJA 4C3VA 5G40A 2MINB 3JSAA 4NCBA 5K0JA 3Q4GA 2OQ2A 1U2GC 2W6PA 3RS4A 4TXNA 3RJ5A 1DZIA 5JSHA 2QRHA 1U1DA 5E7QA 2BT4A 5IBQA 3JQAA 1K2WA 4QQKA 3E1KA 2G67A 4D8VA 1X7XA 2JFOA 2PUHA 5AM1A 1Z2PX 1XRJA 4F3RA 3FJYA 1L0BA 4L1KA 3M3DA 2F17A 3I9FA 3KUDA 3P9CA 3K9WA 2D7JA 1XMQB 1OXTA 4M0LA 3CKKA 4RESA 3TCKA 3K5PA 2HDNB 3AYXB 1X8LA 5EZYB 3I23A 3ER6A 2W70A 1BROA 1TADA 3E35A 4P4LA 2OEPA 1S3FA 1G41A 2ZRBA 4TT3A 5KJ1A 3JRNA 3VKHA 4H3VA 1Q2UA 4UHJA 3VSCA 3QJ5A 1Z29A 2VZ9A 4UNQA 5HQ3A 2BMVA 4UMVA 3QV1A 4S3MA 3EX7C 2ZRCA 1EWYA 1TKCA 5DPMA 2BEUB 3DV2A 1E7QA 1UDAA 4IFIA 2MCFA 4HTFB 2XCSB 5K7SA 4P5PA 4HDSA 1KMIY 1X3LA 4BVHA 2FZ4A 2P9TA 5K3EA 4U7WA 4PCLA 3STYA 2YFKA 1YA4A 1Z22A 3OX1A 4PHHA 5K2MA 2QPTA 4BEVA 2A1TS 2JRCA 3AHIA 3MRSA 1Z5PA 2NV6A 1YIAA 2SCUB 3CS3A 2OHFA 3AHCA 3BD9A 3BG5A 4DVJA 1KL7A 4L2IA 1S8OA 1NW6A 4RTLA 4WW0A 5JSYA 1ZQ1A 2RB5A 3VNSA 3VV3A 3S8EA 1D5WA 1SAYA 3CX8A 3G0DA 3OFSA 1TJ5A 1X1CA 5D7NA 4A92A 3EIEA 1U0RA 4GH5A 4GOKA 1Y0BA 3AOGA 3W2EA 1H1LA 3HL4A 2HW8A 1QTIA 5A2GA 3V46A 5JADA 2HJRA 3FKQA 3LSYA 5A5VA 2OUIA 5BNTA 2IZOA 4O0LA 4FFDA 5I7WA 3IB6A 4FFWA 2DFVA 3L4BC 1Z18A 4ZCLA 4DDMA 1JEYB 4FMDF 2EGUA 3EFOA 5U4XA 4JEHA 4LVOA 5JATA 3IR7A 1VM6A 3J7TA 4Y2HA 1P1CA 2QD3A 1DLJA 5LFAA 3RBXA 5DW3A 3FN4A 1FJ2A 1X7WA 2J5RA 3LA6A 1F8UA 3BKXA 1QFSA 4NZ9A 3URMA 2ZKLA 3HBNA 5I47A 4O33A 1XLVA 5H80A 5CFZA 4U1RA 5B4VA 1T13A 2VXOA 2IY8A 1SHLA 5BWCA 2FFAA 1KETA 1R0YA 4DJEC 3CNHA 2V3WA 1FVOA 1XGKA 4AZSA 2JJQA 1U99A 3GGOA 2W2NA 2OCPA 2P3OA 3DBIA 3AY0A 3LV8A 4XWYA 4DAOA 5LIRA 3U44B 1A7UA 4MAFA 5D1HA 4LYAA 2PIDA 1EE9A 1T9AA 4QUIA 5C4GB 2HEGA 1L5OA 3JALA 5HUQA 1YZFA 2ZJ6A 3FWHA 3MMNA 4QHSA 4RD0A 4JQCA 2ERCA 1Q21A 2C8VA 3IUBA 3O8LA 4GMKA 4JODA 2J3EA 1A2QA 4KQIA 3WKBA 4EMSA 4AKIA 2O8VA 4MEAA 1WPQA 3QVJA 4POAA 1ZD4A 1PGPA 5DNEA 1L7AA 3V97A 2VJCA 3PL1A 3LUGA 2NWQA 3TEFA 5FL7A 2GBCA 4M36A 3ROFA 3F73A 3R3HA 2ZJOA 4PYOA 3MILA 4NBUA 2WDPA 5EP2A 3DCIA 3OQHA 2B83A 1X7YA 1RKUA 3JASA 4G97A 4HWPA 2QR3A 2OKCA 4J2OA 4WKBA 3WP1B 2QY6A 1FYDA 3EGCA 5EMJA 1OU0A 4MLPA 1QLJA 1MQAA 1SUSA 3U4IA 5FLYA 5GTDA 3HCOA 3IUEA 4ILKA 4JBWA 1DDIA 1O94A 3P20A 3OF5A 4R8KA 2EIHA 3JD4A 4DL9A 3AX6A 2X3YA 3T9DA 1H65A 3ITEA 4KI0A 1WAMA 2ECPA 4L8GA 4Q15A 4ECEA 4BVEA 5C5CA 1TZMA 5IKEA 1DHTA 2BD0A 3KXKA 3THYA 1ITZA 3KOUA 5ALOA 1T4CB 1F2DA 4JVSB 2JLBA 2OO5C 2QTZA 4MW5A 5C8VA 4KNYA 2QMEA 1I5OA 4JC5A 2VYQA 3H99A 2J1LA 3O95A 3T7SA 2PGAA 2ZZNA 3R0IA 3QA9A 4GRIA 2YXPX 4PINA 3NTXA 2AYYA 2G28A 4UPVA 4J90A 2R4UA 1JR4A 2J3IA 2NYUA 3WBBA 1H23A 4DC9A 4F2HA 1PFKA 2AFHA 2XQIA 1K8XB 2FI1A 1E6EA 2A30A 5FPPA 4PF1A 5TPZD 3DMNA 3RHSA 3DOIA 4U02A 2M9MA 4RKRA 4WN9B 5DX8A 1SULA 1OLSA 3VR2A 1E89A 4WACA 3NHUA 4R84A 2W90A 2CLCX 3CH7A 3JQEA 3RHFA 3DP9A 2DM6A 4XX1A 3STHA 4KPGA 2I91A 5IAOA 1LY1A 4KBFA 5TQ2A 4WFKA 3SVTA 4I55B 3HACA 2HHJA 1VSTA 3OLCX 4QSHA 4EHIA 1YE5A 3X2EA 4YAIA 3RVRA 3CLSD 3C6QA 3CINA 2Q4OA 2Z2XA 3HS3A 1Z4LA 4BZZA 2P2GA 4NCJA 4H16A 3HA3A 2BLNA 2CLKB 3AFIA 4IDOA 2HA7A 3C6ZA 1T5DX 3DWEX 4JASB 4S12A 3SKVA 2VVTA 4HNTA 5F9FA 3ROTA 1MF7A 4FUQA 3DL7A 4S1PA 3I5AA 4Z0HO 2AC4A 5T4HA 1K7YA 4MUHA 5ALHA 2MOKA 1ILEA 1APBA 1L8QA 1JXQA 3QVTA 5L3QB 2G76A 4UASA 5EIBC 1OREA 3IPAA 1CUFA 1D6SA 2DZDA 3STUA 3WMGA 3CN7A 3PICA 5A7GA 1R66A 3AETA 3BS4A 4UU8A 2WICA 1SKYE 2PNJA 2JEZA 1LQTA 1NMYA 4GRAA 3RIHA 1B8OA 3C6YA 4ZOAA 1JIXA 1FRNA 4L22A 4TTPA 2E85A 4DF3A 1U3UA 3A25A 3CR8A 2C1ZA 2YJ3A 2WJIA 5FQOA 3RU2A 2NTNA 1AA9A 4GYKA 4QD3A 3GZTB 4YRPA 4IOJA 1YQTA 1U0GA 1WOYA 1Z7EA 1ZQ9A 2AIRA 5C3MA 1N57A 2QG9A 4R54A 4UC0A 2XWQA 4ZIRA 1M5UA 1SN7A 3UCEA 1XCGB 3O0DA 1N0VC 1SFRA 1ZN7A 1YRAA 3AO0B 3FYUC 3WRXC 1OUMA 2EFGA 3INGA 4NR0A 4IFTA 3T3EA 3W9YA 3P5SA 3BQMB 4BVKA 5HHTA 4FQ5A 3ERCA 3FKSA 1BMDA 2GJSA 1D3AA 4D9EA 1JLMA 2BJWA 4MRMA 3JD0A 1VSQA 2EX0A 5I7AA 2TMGA 4EFLA 1GPAA 5CFLA 2QM0A 1RRGA 5JXIA 5AT1A 1DEOA 1K6EA 5H81A 4ND3A 3QQ5A 4YP6A 1XDBA 2NZ2A 4D4MA 1JB9A 2BWJA 2GXUA 3EXIB 1BXGA 3H8WA 5BYJA 3M3PA 4RF4A 4AFNA 2FR8A 4NATA 1EVKA 1YMVA 3LPNA 3HCAA 4TN1A 4BTVA 3VVLA 5SZKB 4ZGBA 2ZB7A 3UFXA 3TSOA 2Y05A 2E5FA 4LRSB 4FMDB 4US1R 2PA0A 4BCDA 1W5EA 3ZHYA 2IUYA 3W0LB 4A2PA 1IOLA 2TRSB 3GLGE 1FMJA 4AY4A 2GJKA 3WKEA 4CM9A 1UJNA 2FDXA 3VPGA 3HBAA 2XSZA 1GYRA 3QMVA 4KZKA 2J33A 2FHPA 5GGYA 4C5BA 4AO7A 3LUKA 1P1HA 3QZUA 2JAXA 2NIPA 5NULA 1NLYA 4RENA 4IVQA 1IOWA 4G81A 2JI9A 1SBCA 5T64A 1LSOA 2P91A 2CSUA 1N5DA 4JU9A 2ODNA 1IWBB 2XE8A 3NKVA 1VLMA 1YCGA 2HN9A 1W2WB 3TM4A 1JDVA 1JDTA 1PR9A 1T3HA 2FOLA 3KQTA 3AKCA 5DIFA 4A16A 4KFUA 4TXLA 4S04A 4EGFA 3OOSA 1BIFA 2ZM5A 4GKJB 4AXBA 4X1KB 3EARA 1KFEB 3OE5A 6ABPA 1ZIOA 2CMDA 4FQ7A 4QWWA 4ITRC 3KPVA 3QI2A 3K31A 4OBBA 4PHGA 3OG9A 2PXHA 4Z7OB 4H17A 1U4NA 3DBHA 2QPOA 3OO1A 3AUKA 1I3NA 1Q50A 5EKTA 1VE1A 4RHYA 1F2UB 4YVFA 3SX0A 3R6WA 2B4TO 3WRYC 2ZPUA 2BIFA 2DR3A 3BE6A 3DOFA 1YMUA 1NVEA 1D09A 1YFZA 2GCEA 2QUBA 3PIIA 1RXWA 5KDOA 2FZ5A 3VX3A 2JATA 3E05A 1Q6ZA 2WKPA 5JXWA 1LJLA 4M1OA 4MR7A 4UM7A 4DJFC 2CE2X 3HQ4O 4UNRA 1A8PA 2I71A 3V8VA 4TSFA 4PC7A 3LD9A 1AGRA 3R3XA 4R2XA 1BGXT 2X40A 3MXTA 2GXAA 2I7VA 4B5KA 1HNXB 4BO0A 1X1TA 4IXNA 4X3OA 3TL2A 2DBRA 5CFNA 2HYDA 1RI2A 1NIPA 2YIJA 3SHWA 3O9VA 1JYEA 3E03A 4NHOA 1CNEA 4P84A 3SSOA 3AL2A 4OQLA 4W5RA 1Y1QA 1VMKA 2ACEA 4PZ0A 4Z86A 5IAGA 4DEXA 1JPUA 4RGQA 1TIPA 4N6GA 1CQJB 3PRKE 3AKYA 3UWDA 2BMEA 4DLPA 4ZK2A 3KLPX 1HDEA 2GHIA 4KOEC 3SFVA 3L82B 1TZKA 4CTKA 1SB8A 5CXQA 4BNJA 2YL2A 3OIGA 1GN9A 1WCXA 2VZLA 3M81A 4ALIA 5BXYA 1IUPA 1NLZA 2PGOA 2Q3HA 3PHBE 1HQCA 2B6NA 2B2CA 4YLGA 4BC0A 3JWPA 4P82A 5KYXA 1GG2A 4F4IA 2QVYX 3V1KA 5C7LO 2ZB3A 2ZCUA 3GMIA 4RETA 1ILWA 1TU3A 5EGNA 1DAEA 3N58A 1T3ZA 3FGOA 2OHOA 3GFOA 5FNZA 1BWRA 2HBYA 1ZICA 2Y0PA 5AW9A 1BVYF 3BWEA 1LI7A 1SQ5A 3SSAA 4BYGA 2G9VA 2XLCA 2DC1A 4UEQA 1Q91A 4RQBA 4KXYA 1XZ8A 3P96A 4D6YA 5HS6A 4XTRA 4M0EA 2IOQA 1NQOA 2QDKA 3DDOA 3IP8A 4P80A 3SYTA 3W6NA 5AVVA 4RSMA 2XZTA 1Q1GA 4QXPA 4X0EA 1K4YA 4TWZA 3CG0A 3G02A 1H1TA 3ETNA 2YXNA 2WA1A 3OWXA 2QMQA 3SIXA 4CHTA 1JAHA 3HP7A 1AHIA 1MFPA 4JL8A 4XIJA 1C4XA 4OF4A 4Q9DA 1JKJB 4J2TA 2Q29A 2X9GA 1TPZA 2ZBFA 1F3LA 5ELXA 2GDZA 1M72A 4F5DA 1CQXA 1HA3A 3LUCA 2C61A 4EWLA 1XZGA 3SKYA 4QUEA 3OX3A 2W6QA 3EVGA 2XHEA 1NFRA 4PLHA 5ERYA 2I7DA 4EUSA 3KR0A 3QBEA 3ET4A 2AOTA 3CZCA 2QT1A 4XCXA 2CW5A 3DV0A 1JDNA 1ZR2A 2GN4A 1KERA 1B42A 2IV3A 5REQB 3KL4A 4P0QB 3CPHA 3GP8A 1B0AA 3SZLA 1XJQA 4CODB 2HU7A 2J3HA 4RKQA 5FBWB 4II2A 2PLFA 4MJ7A 1JG3A 2DAPA 3K6JA 4FX2A 2ZWOA 2RI0A 3RUDA 4AZ0B 4EIWA 2AH5A 2AKAB 1CY8A 5AYVA 4C0AC 1VDMA 4R41A 4ER3A 4D0LB 2ZREA 2GESA 3WJAA 2I7CA 2O8EB 3MLEA 1H4QA 1BNCA 1VMDA 3KFXA 5A4JA 5BSHA 4D0NA 2IGBA 3FFWA 4PYMA 5D84A 4CLRB 1MEJA 2IKSA 1XZFA 1EDDA 3BXOA 1UBCA 1JFFB 3D02A 2QA5A 4IHJF 1I7QB 2XDYA 2LCFA 3HY4A 5DOVA 4D9JA 4QGSA 2JKYA 2I1LA 4YUAA 5J4KA 2IPMA 1CEYA 3JTEA 2GK7A 5K8IA 1M83A 2RHMA 1ZCBA 4PXYA 1DRUA 1EUQA 5EGSA 1UL1X 1A9RA 3WJ2A 5CM9C 1EP9A 4XVCA 5F5XA 3HLKA 3Q3CA 1C9NA 2AZDA 3V48A 3QXJA 4MLCA 5B64A 2HYIC 5AXCA 1KYTA 2WJHA 5J4HA 3UPDA 4BGEA 3TL3A 2C9CA 5CT5A 2ERYA 4WPGA 1W59A 1GWNA 1OASA 1HYHA 2V7EA 1KYQA 2HFJA 1Y4AE 3IPCA 4BJ1A 2VJQA 1Q1ZA 1AQYA 4YRLA 4YAJA 1X7GA 5KI6A 1JDBC 4Q3LA 4R0NA 5EERA 5E7JA 1SUBA 2VHWA 1C1HA 1QFXA 2BBOA 3G59A 3L77A 4K6GA 1EK6A 1G291 3Q8LA 1GPMA 1VTKA 2AJLI 3D4PA 3KPJA 3ONNA 4YP9A 2Y3IA 4XWKA 5C46F 1RYFA 5C32A 2FSHA 4N47A 4YUYA 4HNUA 4YS6A 4CKWA 1SIBE 5CYGA 1DCFA 2Q07A 2GASA 2G5PA 4MVCA 3NHJA 1M2OB 1TOAA 3I32A 1XBTA 2WM8A 1QM5A 3MT0A 1UBHS 1CY4A 2VYVA 3H97A 3O92A 4G5FA 4LNHA 5E2AA 4F4UA 1JHPA 4UVGA 1XDUA 3EA0A 3UFBA 1VHWA 3LT0A 5K1ZA 3EW7A 1HG1A 4R8VA 4OQZA 1K8QA 3QFTA 1QVVA 3DNPA 1JVNA 1SIWA 2VLBA 3TTUA 1PNVA 3R0VA 4B6JA 1QGYA 2JFGA 4IKPA 4IQGA 1R6XA 4JYAB 3R5TA 3JQCA 4XX0B 3ZV5A 2MYNA 3ZDAA 4UTRA 1OC2A 2HEIA 1CHNA 4XUDA 5AW4A 4R1PA 2HF8A 2P90A 4YHBA 3DLHA 3B6EA 3Q87B 4RZSA 3A1SA 4X8MA 2Y77A 1RPNA 2PWZA 4W8OA 4L9SA 1JTVA 3E7DA 1R6VA 3EMKA 4L5IA 4GBGA 3RYFA 1RJEA 2Q6IA 3TWOA 4KXLA 2ZYWX 4BGIA 1ORDA 4JKOA 4ARVA 1GU1A 3A6EA 1SCJA 2W2LD 1QIKA 3KB6A 3L49A 2G8LA 4YQFA 2I4IA 5IT5A 4GPTA 3GG2A 1QS0A 1Z6GA 3FCOA 4CEJA 3VHXA 1N7IA 1PS8A 3B1WA 1W76A 2B1QA 3TNLA 5BN3B 3DFFA 4FMBB 5CRIA 1MJGM 4B31A 3KQQA 3T35A 4Q4LA 2Q4EA 3SJBA 4FE3A 3WOHA 3KNZA 3VYUB 4GM1A 2FPLA 2D8AA 2VZ0A 4HADA 5TGZA 2RKOA 2X0FA 3GEMA 4L95C 1WX1A 2GKSA 5B1YA 4R4JA 2O05A 1JSXA 4CHGA 1BDIA 4G5YA 2R1VA 4MKFA 4DV7B 1FLDA 4RFVA 2GUWA 2VT6A 5KSPA 4F97A 1MJGA 3CLUC 3ZDEA 2GPSA 2ORED 2B69A 1N3IA 1GNLA 1CDDA 1XRSB 1Y1PA 3SX4A 2C59A 2QG4A 2YHIA 1CUCA 4AY3A 2XBLA 3PSAA 5G0TA 3G9QA 1JKMA 1BMFD 2Q2NA 2XD9A 4S2UA 1YR6A 4QQ8A 2YQ5A 5HG0A 3E7XA 3ZU4A 3IP6A 4HV4A 3BHIA 1XZEA 3BE4A 3AVXA 4LOAA 4E94A 1TTHA 1DCTA 5FFMA 3UJPA 2AG5A 3I42A 1G2OA 2I4RA 4HQ0A 4Q3DA 1Y8RA 2GM5A 2JH9A 1W5SA 4JQZA 1YAHA 1I0ZA 1U1EA 2WJGA 1U2QA 1VKJA 1V8OA 3VPXA 5H16A 1P18A 3KT3A 1Z73A 3LCCA 3WYEA 4F8EA 1JH9A 2OAGA 3LRTA 5BR4A 5AMXA 3P9KA 4GM0A 5K3FA 4WZBA 3DGEC 1J09A 1ACJA 1TVEA 3CLRC 3MGCA 3PC6A 3N87A 1YHZA 1A5AB 4TWBA 3HDYA 4MWBA 1MO3A 3SS7X 4BX8A 2ZZMA 2PSDA 4O1MA 4ZVQA 2C7GA 2DPYA 2B30A 2G5TA 4EQ6A 2NV0A 2VEDA 3AH8A 3ZLVA 5SZHB 2JHFA 2XRZA 2XQJA 3I6BA 2ES4A 4J4HA 5D2CA 4HWSA 4ND1A 3UK0A 4BN5A 3SQWA 2OHIA 4QPPA 2YXDA 4NY1A 1E2IA 3GFRA 4QDJA 4WXPA 3SFZA 1SY7A 3NC4A 5CR9A 2HHCA 5CGZA 5FTKA 3QVGA 4ND5A 3RT9A 2QVLA 2ATEA 1HPLA 1PL0A 4B4UA 2B4YA 4FP9A 3TMYA 3NT4A 3B9PA 1CJCA 1ADJA 1CV2A 1NUAA 1VZ3A 2ID4A 4OH1A 1JECA 1G3RA 2HPZA 3SCZA 1OLUA 1QQ7A 2ZI6A 3PDWA 4MO2A 2Q5QA 1JE1A 5JPIA 3U4CA 4L5JA 5FQNA 5J58A 2CMHA 2L2QA 4QTUB 2YW2A 2AXPA 1KK3A 2BELA 4U5XA 5IKMA 1G8GA 1USIA 2FN8A 3M5WA 3GZNA 3KT8A 1NF2A 4K2AA 1UP7A 4QLAA 4CKEB 3DE2X 2DECA 3PHGA 4HWKA 3T4UA 1AKRA 4IHJB 3WB2A 1YIDA 4F9TA 2XOXA 1SXPA 3DO6A 2G5CA 2CXRA 3GA7A 4FDMA 5KTMA 4HTAA 1UBFA 1J8MF 6Q21A 3LMKA 3G89A 2XKKA 1NQ5A 2Z9BA 2RD2A 5KJFA 3KJGA 3KUUA 3EEYA 1DL5A 5D3MA 3OT1A 5TJHA 3C7CB 3C6MA 2E4YA 1LZLA 2Q49A 1LI4A 1PQ4A 2Q50A 2W0MA 1NN1A 2AMYA 2H48A 8ATCA 3KKOA 3UG6A 1V16A 2VO1A 2WFZA 3ZG6A 3DC2A 5ALSA 1HQDA 5KC9A 1XD9A 3KSBC 3AILA 5EZYA 1FZTA 4ZVLA 4DLTA 1JEOA 5JDIA 4AJPA 2PZBA 4IOLA 4M8LA 4ZVOA 3NOQA 3W5SA 3W4JA 1J97A 2JA2A 6REQA 1OGJA 2IOFK 1BHJA 2C5GA 3IRVA 3C70A 2W2QA 1X1QA 3OE7D 1QHEA 2PRJA 2XNCA 4AY6A 5AQ1A 3MINB 5L3SB 1Y9JA 4TRJA 1O2DA 3AY7A 1TAHA 3H1TA 3PV0A 5SV2A 4FGJA 5AVOA 1KZ9A 4B81A 1OWMA 1O5IA 3IMEA 1R16A 3EK2A 5LA6F 3ZY2A 4FYKA 4M4SA 2B21A 3GZ4A 4YAUA 1WP9A 3D8HA 1W94A 1WV0A 2OHGA 4MUKA 1QKIA 4GPIB 5HCNA 1ETHA 3MTQA 4PQFA 2ZATA 1JJAA 2DWPA 1M76A 4CNBA 1CE8A 4PRZA 7YASA 4UNPA 5A5FA 1L5RA 1P7VA 4HWRA 4XRRA 4AKEA 3M6LA 1A8HA 1U0FA 4LC0A 1PR3A 4HUQB 5LZ7A 1JJVA 4B4KA 4UTXA 1FDUA 4XASA 1LB1B 2OWEA 2YWRA 1TLTA 2Q3MA 4RTQA 3NYWA 2C4WA 1I1HA 3PC8C 1YE3A 4F0JA 4P08A 3I5UA 3W79A 1TF5A 2F1IA 2HKIA 1M73E 1VL5A 3GELA 4ZEOA 3ZLJA 1WEKA 5HF6A 5KMGB 1AQ6A 3ZJVA 3C14C 2C1XA 1N4DA 3CH4B 3R24A 1H0SA 3MMZA 3A3PA 2EF0A 3EXG2 4EENA 1JFRA 1OB5A 3LO5A 1HDXA 1C1DA 1Y3BE 2NVBA 3QKRA 4FR2A 4IO1A 4DZRA 4BXOA 1ZH8A 5CH5A 3KKNA 2M98A 3LY9A 1L8LA 2P4HX 2H0AA 4UQPA 1MJNA 2ZJAA 2ZJ4A 4Y2YA 1P29A 1G8SA 5AI5A 4W9MC 1HFJA 4X60A 4D3DA 2WJAA 4KSCA 4NMHA 1GRNA 3IO3A 1U6JA 2WILA 5ICFA 3FMOB 1DKRA 1GO2A 4MKXA 2LDXA 3AZOA 4LHXA 5AHWA 4Y3UA 3AXSA 5EIFA 4DA0A 2JRLA 5FWXB 1B0ZA 4GSYA 5ERGB 2W83A 4A1OA 1GM5A 2V7BA 2QVZX 1SOMA 1L4EA 2H08A 4DMGA 2Z08A 4X66B 3ZKAA 1M7BA 2ZDHA 4TPKA 1W4AA 5F5LA 5UKDA 1XRLA 4F3KA 4ENTA 2ISCA 3SF0A 1FSFA 4Q3AA 3K71B 4YB8A 1TF2A 1I80A 3PGMA 4KMOA 2PQ2A 3ABRB 3G79A 4ZOLF 4F3CA 3ZHBA 4CT5A 1TO2E 3I05A 5BQXA 3NIWA 2B61A 5AW3A 2P4UA 3ER9A 1JR2A 1KMHA 2HT6A 1E2PA 3A9SA 3EQ7A 5A62A 4W1QA 2H1SA 3O5AA 2C2MA 5E0KB 1E3WB 1RWOA 2ZBEA 3TRJA 3UJ6A 1Z3CA 4DJJA 4BBAA 5EIXA 1KMQA 4KSYA 2J4FA 4LDAA 1ZO8A 3WIEA 2YVUA 4IIVA 3MJSA 5EIBD 2QBYA 4MV8A 2GQ0A 1B1CA 2ODQA 4IH4A 4UCWA 1KPIA 1W93A 3FWZA 4L9WA 1AU9A 1TYDE 3L7AA 4HFRA 2UZAA 1FTWA 1U9ZA 2ZRMA 3N7UA 2OBNA 4J16C 1KZ4A 3WB1A 3L79A 1NBAA 3AB3A 3FMFA 4L8LA 3LWNA 3LT2A 4N3AA 3EVTA 1Q1AA 3OZTA 5AI9A 4TVSA 1GFZA 1U0OC 5CCDA 2FWBA 1XQXA 3GJRA 2WKSA 4H7KA 4AQYB 2W6IA 5DI3A 3R44A 1PSWA 3CIOA 1TJNA 1WUYA 3O31A 3HKDA 2ZR0A 2CDAA 3PUIA 4IV5A 2ZJ1A 3OUUA 1A04A 1J24A 2DFLA 3LIPA 5HBRA 5IDYA 3NVDA 1JI3A 4PFQA 2WE8A 1RTKA 4ZDWA 4KIJA 5AWFC 1DS6A 2FWJA 3M4YA 1FXWF 4K28A 5C2JB 3PWZA 3R09A 8ABPA 1WSBA 2GXQA 3KJQA 2YWFA 4HDNA 4JY7A 1NZJA 3BMCA 1YOBA 4I66A 3G8YA 1O7JA 5HIKA 2V45A 2O8CB 2ZT5A 1E5QA 2JCGA 4INPA 2GILA 3HKBA 2RCYA 2PBRA 4G0PA 2H59A 4QBTA 3W7VA 2CC2A 5JCPA 3T9CA 4P4UA 1M2HA 1V5GA 4PLGA 4R01A 1UJ5A 4OB6A 2YINC 3KVYA 4JLPA 4Q4AA 4DCGA 2CMKA 4EF4A 4XJXA 1ZL2A 3IEKA 3LUAA 3R75A 5E38A 2I6QA 3MYYA 2FZVA 4PPGA 4ZO4A 4DMMA 1AQIA 1GPJA 3DMFA 3F6YA 4O8CA 4A7PA 4W7SA 2P1RA 3WXMA 3BRQA 4EI2A 2P6MA 4EGAA 2V6BA 1P74A 5ITZB 3PNSA 4EKYA 3KJFA 3HKCA 2J59A 4J1QA 3VU9B 3GW8A 3M9XA 2A5LA 1ABFA 1HEUA 1U1CA 1UBKS 2WF8A 2SECE 4XWGA 4ZO9A 1CQIB 4M9XA 4DDKA 2ZROA 3E9ZA 2OD9A 2EW2A 4KFSA 1MBZA 2P41A 3OY2A 4KL8S 2JAUA 4FSHA 1KVSA 5HF9A 3T7EA 2GPWA 4LHYA 4M0FA 4TTSA 1SBIA 2Q99A 3C3JA 4D0SA 1ULHA 1SG6A 3KC2A 4WHMA 3HO1A 3QNMA 2LRHA 1P2SA 1DG1G 1ZD2P 3QU4A 2O2GA 2B0JA 3BOSA 3GUHA 3KB2A 4G0QA 3NW9A 3VKWA 4F8JA 3CVXA 2I6TA 1YT5A 4Q7EA 1OH7A 2I7XA 2J3JA 1CCWA 4MMYB 1G6Q1 4IG4A 3FGNA 2R6CA 2F1RA 3DEYX 4HN2A 2F3TA 4MUBA 1NXOA 1QNLA 1QAQA 1SVKA 1PYDA 3C24A 3DJYA 4TVBA 5CHYA 3TRIA 3C3KA 2Y66A 3CPEA 3I2HA 1CFZA 4V0QA 4A6DA 4I1UA 3KQNA 3FYHA 3VZPA 2GZ2A 4AS1A 2FEOA 4C43A 5I5EA 3EZ2A 5LA6B 4C03A 1EDZA 5K3OA 2G6TA 1FX0A 4LMBA 5C52B 2P7HA 5FNVA 1SBZA 5I7UA 3IELA 1N2BA 1SBNE 3L8FA 5HK8A 1QK3A 4UXIA 1L3IA 5DTJA 5AJXA 1SVUA 3EBPA 2WAOA 3NU1A 5GV8A 4E6PA 5JEDA 4Q24A 3ZY3A 4C2UA 1VKNA 3AC0A 1MXFA 1MJHA 2Z1MA 4DQXA 2R8EA 3O82A 3TLCA 2TYSB 1G3QA 5AHKA 1ISFA 2YJ6A 1C30B 1N25A 2V54A 1R5OA 1GVNB 3C5VA 2CY0A 1BJKA 1NNI1 3KYCB 4Q3KA 3L8ZA 4UVHA 1EWQA 2XYRA 1MC4A 2YJTD 3DZJA 3R20A 1MZPA 1NG9A 3GI1A 1N2SA 4OOEA 3ZIAA 2ZYVX 4CIAA 3UXYA 3RYHB 2WJ4A 3PQCA 4OFXA 1YBAA 3FWPA 2Y4OA 5CVTA 4ZQFA 5EWMA 3MCVA 5TVGA 2PKEA 5DM2A 2A58A 1TQDA 3PQFA 2VBFA 3AR8A 3QOYA 3L0SA 4GSKA 2R7NA 3H42B 4GMXA 4WKGA 2FA9A 2OZLB 3O4JA 2FAXA 3FGPA 4GZMA 2Y1XA 3OIDA 1U7ZA 3ACBA 3LQ1A 4URHA 3ZW7A 4ZDKA 3H75A 4XUCA 4HQKA 1NF8A 1G20E 2FUEA 4MX8A 5EMLA 1DQRA 1LDNA 1QIIA 4WH0A 5MGNA 5JZOA 3RT7A 5E6SA 4J7XA 4TV8A 4I50F 1TLFA 4L8YA 3M0EA 2ZR7A 4FMPA 1MO2A 3QY0A 1MQSA 1HTTA 1PBNA 1DBSA 3NHPA 3PGKA 4C4XA 3E58A 1M2VA 3EBOA 2WD9A 2Z1NA 3ZH9B 2O1XA 5KQGA 4KFCA 2OG2A 4J75A 4BWVA 3A1EA 1IH8A 5AICA 3BXZA 3QUSA 3QBDA 5IJ0B 3E3AA 3NC1C 2R65A 1BEEA 3QEKA 3G13A 1BA2A 3LZDA 4JK3A 3TOZA 1VCNA 5F7XA 4JI2B 4NDZA 2FJPA 4ZOLB 3IAXA 4E32A 4Z7QB 5EE5B 1KZHA 4F4CA 5LYJF 2WPNA 3BL8A 4EKDA 4IAOA 2DBVO 3UEOA 5J2UF 4YJHB 4AROA 1E9CA 3EODA 2KMLA 2DWQA 1Y6QA 1GFWA 3ICVA 2VAVA 3U6BA 1N6RA 2DQ4A 1Z6PA 3E5RA 5AK0A 4ETNA 3VH1A 1H85A 1QANA 1Y4SA 3B7WA 4AJKA 2HSGA 2YDXA 5BT9A 3I01A 1LNZA 3O74A 4J49A 5ALMA 4C6RA 2GEFA 2R1ZA 1MP0A 4AB1A 2Z58A 4B2IA 4IMIB 5A4MS 2X8JB 3FHOA 4PZYA 2A5JA 2VAWA 3GJ6A 3RS0A 1XWIA 1R6BX 5SZIA 4JT8A 1DO0A 2B5OA 1E4VA 1T1SA 4IS2A 2TSYB 1FP4B 4JUIA 4H3HB 4ZAFA 3T9FA 4V0NA 3IAM1 4UU0A 3TLAA 4C7OB 1JKFA 2BGGA 1R12A 1UJCA 3DLAA 2OZPA 3OUZA 1DAFA 3DQPA 5CFMA 4GOXA 2IL1A 2ZRLA 4LKRA 3ZV3A 4KH1A 1RYZA 2OD2A 1LEHA 4MKIA 2FYTA 3D3EA 3FJOA 2HU2A 3RNLA 2J87A 2IDJA 4L15A 1G21A 2WUVA 1JMYA 3QVKA 2D7DA 1UC9A 3IIKA 1ZOPA 1NI3A 3NM4A 2Z98A 3VZRA 3HKEA 2XGJA 2FW6A 7REQA 3MUFA 2I6UA 5EXPA 4KH0A 2YFYA 3M6AA 3OHSX 5KQMA 2WE7A 2A7QA 5LMNB 2V4ZA 4J3JA 5B37A 1QDLB 1VP3A 1DUVG 1U28A 3I8XA 4BP3A 1RRCA 4QOJA 5IWAB 5T3UA 3SDBA 1QLHA 2B5VA 3K72B 2INGX 3STVA 5H02A 3DMHA