4ZZ0A

Human gar transformylase in complex with gar and (s)-2-(8-(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)octanamido)pentanedioic acid (agf147)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trifunctional purine biosynthetic protein adenosine-3
publication title Structural and Enzymatic Analysis of Tumor-Targeted Antifolates That Inhibit Glycinamide Ribonucleotide Formyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 66
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4zz0A00
1RBQA 4ZYZA 4NV1A 1CDEA 1RBYA 4ZYVA 1FMTA 1C2TA 4QPCA 3TQRA 3P9XA 4IQFA 4QPDA 3DA8A 3LOUA 5J63A 1RBMA 3Q0IA 4TT8A 4TTSA 3W7BA 1RC1A 4PZUA 1ZLYA 2CFIA 4S1NA 4ZYXA 2BW0A 1MENA 4Q12A 4ZYTA 1RC0A 1JKXA 4DS3A 3TQQA 4ZZ3A 4R8VA 4EW3A 3AUFA 2GARA 3GARA 4ZYWA 1YRWA 1MEJA 4ZZ2A 1MEOA 3O1LA 5J9FA 3DCJA 4ZYUA 1S3IA 4YFYA 4EW2A 2YWRA 4TS4A 3R8XA 2FMTA 1NJSA 1ZLXA 4EW1A 1C3EA 5CJJA 3KCQA 1GRCA 3AV3A 3NRBA 4ZZ1A 3N0VA 4ZZ0A 1CDDA 4YFVA 1ZGHA 2BLNA 3OBIA 4ZYYA 1RBZA 1GARA
chains in the Genus database with same CATH superfamily
3KSUA 3R1IA 2A58A 2O54A 2A14A 4JLUA 1LV7A 1B0ZA 3R20A 1RU3A 5F2NA 3BK2A 1JG7A 3SIRA 1T3HA 3N2KA 2VHTA 3QFCA 4DRXA 3KZVA 3AVUA 1IUOA 4A73A 3Q85A 2ARKA 4MCJA 1L7AA 1NC3A 2XYRA 5AESA 4HBGA 4YS6A 3R2JA 1KXZA 4YBZA 1QV6A 2FN4A 3PQCA 2YRXA 2B5VA 3RABA 3NBYC 2GERA 4RJ2A 1B6GA 1EK0A 3BG5A 1PSZA 3ZKWA 3C3DA 3SCZA 1TNDA 1MQ9A 4JVOA 2AQKA 1UMBB 4P2GA 3OJCA 1B6RA 1COZA 2H2GA 2HN9A 3HP4A 4CMKA 4YUXA 3FUTA 3OY2A 1P4SA 4LJRA 3ZGZA 1N6IA 1S3FA 3BB4A 4QXQA 4UBKA 5EUQB 2O1EA 4DHEA 1AF7A 1KPGA 1Z15A 1TFRA 3FZQA 4L2IA 1VMEA 3M6LA 4X44A 4FB4A 3ZCVA 3SIPA 3GGOA 4A5SA 3V9AA 4C4ZA 2C5FA 3KD2A 4PC2A 5LQNA 1ZCFA 2B69A 1DX9A 5JSKA 3RT1A 4EHFA 5B1EA 3ZWQA 4M6WB 1U7XA 4P22A 1ADJA 3FF1A 1AXGA 1EVYA 5ALYA 5JWOA 1Z6TA 3LCJA 2J4DA 2WLTA 3QU2A 4B73A 3VNVA 3DONA 1K3FA 3HSYA 3HM9A 1ZMTA 2H9IA 4I0WB 2WKSA 3ILVA 4MKZA 5AKJA 4E22A 2A3RA 4H4DA 1SOWA 3ZWNA 2IF0A 2A33A 1PLJA 2VJBA 3Q3HA 2NZWA 1I6MA 2NPOA 3FOBA 1K06A 1WHTA 5CHEA 2ZBEA 4PWZA 4OL0A 1H93A 4NU5A 1U2GA 3ZK8A 2AN3A 1J8VA 3O38A 4ZHQB 4KACA 5DCWA 1CX9B 1Z0JA 3TLEA 4HQKA 3CYFA 4UVHA 1BFKA 1I32A 4FGZA 3OO0A 3DAPA 4H7KA 5EZSA 4QL3A 3ZHSA 4MV9A 1WOMA 4IXWA 4OJKA 1E62A 3MHPA 4MW4A 4H6PA 2Z56A 4Q3LA 4BFUA 1HLDA 1O5OA 4FR0A 3E1KA 4GE3A 5SYMA 3TD9A 1P1HA 1F4PA 1KR5A 3AEUA 1A9XB 2QPAA 3PKIA 4CEIB 5GINE 4KIUA 5C4GB 5KWJA 3VPAA 1N2SA 2LPMA 4WZAA 2N3ZA 3IKLA 2C4VA 2G9QA 2YN0A 3PX7A 5THXA 3IPAA 2GVDC 1ZD5A 4YV1A 3H1GA 3G0HA 5K8JB 2CV1A 1LDBA 2FX3A 3O21A 4HYEA 4P36A 4G0NA 3GRFA 1WETA 1KJYA 1VCHA 3QVSA 1A1VA 1FP7A 5LU8A 1B3RA 1DLJA 4RZ3A 3NBAA 1D1SA 4Z9FA 2H4XA 1JG1A 3G2PA 2QTNA 2QRZA 3MCAA 2M6KA 4R9VA 3L41A 2IYRA 2B2XA 3U7IA 4BP1A 1DQRA 4RTJA 4D92A 4D4MA 2ZI7A 2B8TA 3GCZA 3OIWA 3QLVA 4OGGA 5K51A 4C30A 4XJTA 3UAWA 3UG6A 4B8YA 4XWAA 5DU2A 4H31A 3FIJA 2UUOA 1VCIA 3CNEA 4N3GA 5DP1A 1IPFA 1MQSA 1IM5A 1UOOA 3AQ4A 1QIEA 5C1PA 3PQ5A 2P90A 3D6VA 4IQ0A 3DOJA 4UXIA 1YCGA 1Z4QA 1ZG3A 1ZRSA 3HYTA 3Q3EA 4LXYA 1EFLA 1XK6A 4DLAA 4MP3A 2PMBA 3WGYA 1IATA 3G5UA 4A7PA 4TV8B 3K8QA 4FGUA 4G0QA 4JOBA 3BRSA 5K8CA 1M2HA 2VHXA 1KIAA 2A9RA 4G84A 3HBLA 2NO1A 2VPQA 1T5OA 3CLRD 1OU4A 1BS2A 2I3DA 5K0SA 4LZNA 2JIPA 1PJSA 3KVYA 4GC5A 1CQIB 2BGKA 3EFBA 2C9YA 5DTRA 3ILYA 1NW4A 4EB6B 1SUSA 3FMGA 3ROQA 2JLYA 2P9CA 5LB4A 4BFZA 5FWNA 3M9XA 3L9XA 1OXBB 3RRYA 2RHWA 4KXQA 1W4BA 1UJ6A 5BW8A 3BWDD 1S8FA 1P0PA 5SY6A 3JQFA 3NG1A 2VLBA 4GHWA 2AEJA 2P5TB 2IEZA 2LWIA 3ME5A 3FBGA 3NBUA 1K08A 4N6GA 1XZKA 4PLCA 1FJ2A 4RK7A 1ONSA 4RADA 5IZ4A 4KAXA 4YAGA 1X1QA 4TXMA 3GAZA 4JR1A 5IYZF 5KWSA 2CLDX 3KPWA 2QRKA 5KKCA 2BCJQ 3P9SA 2CDAA 4KGVA 4RNCA 3EGIA 3W5HA 5K7SA 3KNZA 4MPRA 2CCGA 2RK4A 3QJGA 4B32A 5BYAA 4QIHA 3IURA 3T9CA 2W22A 3BT7A 2F64A 2FWPA 3W5DA 3QVKA 3LPNA 3TPCA 1WTAA 421PA 2JJMA 1VIAA 2IS4A 2LGJA 2RGYA 1Y3IA 4TMWA 5DBEX 2IV2X 3O0DA 5ALMA 3SC6A 1QLJA 4K6KA 5H82A 1PQUA 5DBOA 4RIFA 4B4VA 4ES6A 2BDTA 1ZVMA 1AMOA 2I33A 4GQIA 5I9IA 3DLTA 4IF6A 4Q12A 4QGBA 2ZYIA 3VOBA 1W35A 2FWNA 1QG4A 1U0EA 3CBQA 4TL7A 4A0SA 1TTHA 1YRHA 1XCBA 5B7GA 5KNCD 1EI9A 3TSCA 1OW3B 3GU3A 3OJEA 4QHSA 3ZCTA 4BAUA 1CUEA 1V2HE 1PDWA 4CT4B 2ZB3A 3PE4A 4QVGA 2GHIA 1JH9A 1JBEA 4W5WA 4RPKA 3LV8A 2IK8A 2JK0A 3GFBA 3TLJA 1KDOA 1BE6A 2QJWA 5C1DA 5G4KB 1Y1QA 2CD9A 2XOXA 2XQKA 4R05A 1GGKA 4LYAA 2ESRA 2JG3A 2XB2A 3AY3A 2CK3A 2DP4E 4EI2A 3NQ41 4JUFA 4L8WB 2G1AA 3C1TA 3AT1A 2MOKA 3KLNA 2ZJFA 2WT9A 3B1KA 3MRTA 5DWVA 4A92A 1JLLB 1D6MA 2YCBA 3FNGA 3BWCA 2Z4RA 4IKEA 2CVFA 2AJBA 1HE1C 2P9ZA 2PX2A 2QQ0A 2JIMA 3DJFA 3G2QA 3H87A 1U9IC 1XI2A 2AFIE 3A05A 1M75A 4TS4A 4Z6KA 5JSZB 4DR1B 4MYHA 2REBA 1Y89A 4DQLA 2VTEA 4IVQA 1U1CA 5COBA 3EPHA 2FPGA 3FWHA 1ZL2A 4J43A 1AX9A 3VO9A 4DZRA 2Q9BA 1A5AB 3TIVA 1HYBA 2ZJ3A 2J09A 4R2IA 4I3HA 5B4UA 1PBTA 3AHCA 5ICCA 5FNVA 1Q0LA 4LFCB 4MZXA 2IF2A 3FCUB 3NI2A 5FWAA 3V00A 5BNIA 3F4BA 4N5IX 1F14A 1U8YA 2Q0QA 2MCFA 3ORRA 2Q5OA 5MFPA 1QQAA 3C98A 3KYBA 2QU8A 4IIVA 4PRYA 4FGLA 2CD7A 3KJXA 1SRRA 1BD4A 1WHSB 1B1AA 2Q4TA 3ACBA 3HUEA 3KJFA 3L9WA 3ERCA 1KKLA 1P17A 3K73O 2RBKA 4P54A 1KI4A 3P97A 4AJOA 4YY3B 4NK4A 1US8B 1DHRA 3IBSA 3CINA 3PCTA 1ZI8A 4BMYA 2AEMA 4DLWA 1PL8A 1MJ5A 1G16A 4M83A 4BRZA 2KE5A 2RKWA 3K9QO 1GN9A 4EPXA 1Z12A 3B1XA 3HZZA 4IGFA 3SSNA 4LCBA 1VXRA 2GOYA 3H2KA 1C3LA 3TIGA 4WJLA 3E5HA 3OECA 3UHJA 3RR2A 3QXJA 2HCFA 3K15A 4BNDB 1JEOA 1GTSA 3VR6A 3IPRA 1USWA 1G8GA 1WXFA 3CLUD 5E9WA 4UM9B 5FB3A 4Z7QB 3T3OA 4RO0A 3RIXA 4F3NA 3G9QA 2PKQO 4RMJA 1R64A 1PZXA 1P81A 4I99A 2PGJA 3JYPA 3MQFA 3H0KA 4Z3OA 4Z4IA 3OFNA 4PZYA 1FE8A 3H3XA 1JU4A 4J3FA 3ROFA 4OXQA 4DG5A 1VLLA 4HDKA 3KZ1E 4MWOA 5HF5A 5C80A 2D1YA 2XNDA 4HYYA 4WFKA 5AM2A 1U0SY 3CN7A 1XSEA 4R1TA 1KE2A 3UUWA 4MR9B 1FU4A 4GX0A 1DRUA 1U7HA 3HL4A 2PNJA 3EBPA 3D8NA 3SS8A 1AM4D 1F17A 1DG9A 3K5IA 4HEA1 4I5GA 4POOA 3THYA 5AW0A 2Y1XA 4JP8A 5A4DA 3ZWPA 3U44B 5DN6A 3WLAA 3EVCA 3IJEB 4I50A 1JLRA 1G20B 1NNI1 2NNLD 3IUNA 3MAJA 4U6NA 1DP4A 3EXG1 4UOEA 4UNPA 2UVPA 2EEPA 1VE7A 2HDNB 1NW7A 2R1ZA 2WD8A 1PJQA 2XUZA 3G9ZA 4IZIA 2VNJA 4RMIA 4L72A 2EL9A 5K0ZA 1EWRA 2PZFA 2ZIVB 3MJFA 4RV4A 4CIVA 4LDZA 3ZHOA 5ER6A 3KSZO 2BGJA 1O95C 4F5EA 1Z7YA 2EARA 3OCVA 2R8ZA 2XBUA 2WQ6A 3I76A 3PWTA 5FUWA 3P2KA 4EG5A 4XTRA 2A1TS 1SZPA 2IYFA 3AG5A 1PEKE 5BW5A 1N36B 4KBGA 4Q9AA 1FVOA 3MELA 5ESXA 1M5RA 4IUDS 3VSCA 1XEXA 3A4LA 2YJNA 5I4CA 1RWWA 3L8HA 3BSYA 1KZ1A 2AHRA 4XYLA 1KQPA 1BS1A 3BBLA 2P62A 1TC2A 1XL0A 1T5HX 2CHUA 2WVAA 4RXTA 4EEXA 3O1IC 2OHVA 3Q5EA 3NAZA 3RTBA 4ERNA 1DX6A 3NJ8A 3QW4B 4YO8A 5JNTA 3JWIA 3PC7A 4LJAA 3ZBTA 2OG1A 1YJCA 2JZNA 2PTGA 1UDRA 2OBXA 3ZY2A 4P92A 5L51A 1TUBB 3NTVA 4KQMA 1KSGA 3QFHA 3RV3A 2ZR8A 2GFHA 4MWSA 5LBUA 3SC4A 5IASA 3ON5A 5F98A 1W73A 1YRAA 2Q1UA 1GP2A 1UT6A 2A1UB 1VHWA 2QRVB 3GJXC 4O25A 3VAZA 1O96A 1PVVA 3UAGA 3TL6A 3E3OA 2Y0EA 5LFAA 4LV8B 1N7GA 1VSQA 2CXPA 1IJBA 2OZVA 3KVRA 4KQHA 1R5OA 3GEIA 5GM1A 3DZGA 2EQBA 4AKSA 4WI1A 3Q9SA 1F5SA 2ERXA 3KAQA 4UAUA 1BSVA 5GIOE 3ZIAD 4ND2A 1ZGJA 4RE5A 5DLYA 1NQVA 2FMIA 1A82A 3U62A 8AT1A 3KRTA 1ECCA 2H59A 5LWQA 2GQ0A 5A1TA 1PTJC 1V1RA 3Q5DA 3O8QB 3O3MB 5FA6A 5B1SA 4UEKA 4CLRB 3KQYA 4NE7A 1X1DA 4PS1A 4MUXA 4OMCA 3EQZA 3QKSB 1JI3A 5DISB 3WL3A 5JNVA 3K35A 7MHTA 5DW3A 5AW5A 1T1RA 1OE0A 4PV7A 5LJLA 4QDUA 5CA0F 4KR3A 2YWBA 1MX9A 4GT1A 5I6DA 1H05A 2OB2A 4IHJF 4BNHA 1E5QA 3MXTA 2CLIB 3AETA 4QT0A 1ONOA 4C05A 4RA6A 2ZT5A 1BX3A 5CHYA 4IM7A 3C2QA 4S0XA 2DTXA 4KITB 4E03A 5DEOA 4B2YA 3ODPA 4AO8A 4J7AA 3SBDA 1G17A 1CIPA 1QH8B 2JAPA 2HWUA 2QX8A 4B3XA 4KREA 3PT9A 2QYTA 3CW9A 3F5DA 2MSKA 4NOJA 3WFZA 4B48A 1H85A 4JL5A 1YXMA 2R84A 5CJPA 2PS3A 5TMEA 4D79A 4COOA 3DYIA 1DRVA 4C7JA 2VHZA 3FCCA 3KIPA 1Z62A 4KTVE 3O2SB 3DAOA 1EAMA 1G5PA 4FZRA 4JT8A 5EIWA 4MUEA 1ZCZA 1N5LA 5JSHA 1A7AA 4UULA 1Z6GA 4F38A 3BSFA 3BD9A 2MTBA 1Z26A 4DEXA 4RHYA 3IP6A 2CHGA 3U3OA 2EFCB 3RYCB 2JBHA 4YLYA 4IDBA 3UOWA 4NE2A 2OZLA 3U3MA 2ZCUA 3QF4B 4D82A 3FRHA 3JWPA 2I1LA 4YIKA 2XQVA 2J3IA 2VDMB 4GQBA 5BQ5A 3DGFC 5BMVB 1AD2A 2I65A 2MR6A 3KDSE 4CYMA 4JWTA 4X92A 4WXMA 3NM5A 4BMCA 1FFDA 4LY6A 1NN3A 4RPCA 5JEEA 1QYRA 2AJCA 1DC6A 1LLUA 1N2IA 4F2WA 1DS6A 1XAGA 3U0BA 3IPYA 3WI7A 2HWKA 2ZBFA 3D2AA 2HMYB 3C6YA 1IUPA 5FRDA 4E4TA 2IW3A 4C7OA 2ACWA 2VCYA 4EJ0A 1U4OA 2HLHA 5I9MA 1LK0A 5H0IA 1LY1A 5HZMA 5CK4A 1B1CA 2IE0A 2OFXA 3UM9A 3AKZA 1JEYA 2QROA 1YTUA 5HMLA 5IVDA 1TGVA 2ZU0C 4GI7A 4OVKA 4TWIA 3SKVA 3VR3A 4DMHA 2OHHA 1JQDA 2VQ3A 3EDMA 2ZRLA 4AJJA 3UCXA 4WACA 5AOAA 2BHNA 1ZITA 3HA2A 2C9DA 2R85A 4LDNA 2H17A 4Q3KA 1OA1A 1OD6A 4EYSA 5A2QA 1AOXA 4ZEWA 4I9HA 1XU7A 5IJ0A 4BNVA 4A8HA 1ZHFA 3P2IA 4FLFA 4H0FA 2OQIA 2XUKA 4GKBA 5GWXA 1ZO8A 3UJAA 4OBBA 4FJ2A 1NLMA 8LDHA 2HA5A 4TV9F 1NT2A 3WL8A 1WD5A 9LDBA 2DLDA 3A1NA 1TO2E 4K9LA 4TROA 4J1TC 1XPOA 3BJEA 3LC2O 1MN6A 2VI5A 3IIEA 1JLHA 1KDTA 3IS3A 2YIMA 2D0PB 4S04A 2YV4A 1TD1A 3ES9A 3K0HA 1Y7TA 2W6JD 1LS1A 1LPSA 2JFFA 1SCDA 3PTZA 4NH0A 4Q3CA 1IZ7A 2Z4SA 3ANTA 4YCJA 5EHIA 4TQ9A 3VOSA 1KRXA 1RW4A 1PZHA 1YDHA 4M1KA 4E14A 4JJ7A 3EC7A 3QBTA 4PLHA 1S2OA 4R3NA 2L0XA 5DHUA 1UM9A 4MMZB 3FFTA 5CFRA 3ZDAA 5JJ5A 2H1SA 1X8XA 4MUJA 4LQDA 2DPLA 4NEHB 3ZHQA 4YV7A 4DGSA 2G9VA 3O2JA 2H3HA 1QHXA 1UFVA 4NJEA 3AMVA 3JRXA 4PQRA 3H13A 3ZV5A 3EWSA 1WMDA 3K32A 3M6IA 4PYLA 2GJ4A 3G88A 5DNDA 5EZYB 1JSZA 2ETXA 4B3IA 2WSYB 4BVKA 5BRAA 4QPJC 4CM6A 2WJHA 1NZFA 3PL5A 3PUXA 3FVRA 1WDLA 1T8WA 3BGDA 5D3QA 1KP2A 3ZW7A 1TEHA 1XWWA 1ZPDA 2YWEA 1JAYA 4LK2A 4TKVB 1RZUA 1HKHA 1P0QA 1QG2A 1UDWA 2SKCA 2AT1A 1Y9AA 3A7DA 4BJ3A 5JC8A 3G1WA 1QZ3A 3F71A 3KOOA 2CY0A 5LPNA 4L22A 1S9HA 1PEDA 2I8AA 4KK3A 1TTPB 2GCPA 1Z6XA 1PL6A 1IQPA 4PG5A 4P80A 3V97A 1DV1A 1GGEA 3EEYA 1GN8A 1PYGA 4MNTA 3LLCA 4J6FA 1CR2A 1QRRA 3BOSA 4QDOA 3DKKA 3VVCA 4BU0A 4WOBA 4RTKA 4BXOA 1PWXA 4OA5A 5FWYB 1MB9A 5KTNA 3G0CA 1GGMA 1I7PA 2OTCA 1YL5A 2FN9A 3ZZUA 3NVKI 1G9TA 3NEJA 4I6GA 1ZW1A 3D8SA 4REMA 2HX1A 1DEHA 4UEWA 4CKWA 3B48A 1U94A 2EIXA 1N33B 1CEEA 1KBZA 1NOJA 5AVVA 4EA6A 4G9BA 1DBPA 1UPFA 2CBZA 4MWEA 1FX0B 5K4GA 2OAEA 5KX5F 3UT6A 1IOWA 4JBXA 2HTFA 3DL7A 2Y66A 2NU7B 3IDZA 1GNTA 1VP9A 2IHUA 5A4KA 3U3ZA 5KQPA 5KUTA 1XPUA 3W2TA 4C03A 5CB8A 3AVWA 1A5ZA 2AWNA 1PFWA 1PS0A 1JQKA 4HGZA 4OD0A 4O2BF 4DCVA 4EJ2A 3JQ8B 3GLFB 1ZVKA 4KV9A 2FFRA 5HQ3B 4LZOA 1GWNA 4KJZA 1KIMA 5C8DA 4YNBA 3MQ2A 4F8EA 4BBAA 1V8ZA 1GPKA 3RS7A 4N5DA 1SULA 1CRWG 1J7JA 3DFFA 3IQDB 2H11A 4G1FA 3FSJX 4QOFA 3IV6A 3A9UA 5LA6F 3DYBA 1KTIA 4YT2A 1DMRA 5AM1A 5JCOA 4ARBA 4WY2A 1WABA 1L9XA 1U1DA 1RCUA 2K2WA 4KXUA 3O75A 1A3CA 4WTOA 1JIUA 3RYHB 4MYRA 1V4NA 3MQ4A 5DOVA 4ENTA 2AN1A 2WSLA 3DV9A 3HJGA 5JYEA 4QWWA 3IAS1 3TINA 4CQLB 2B5OA 5FJIA 3RS0A 4O4IF 1H1LB 4CN9A 2W58A 3AB3A 1IBLB 1OGIA 3RUEA 2O3RA 1GTG1 3DWEX 5FBWB 3ABRB 1WG8A 4IFBA 1YBAA 4KN9S 5BSUA 2ZJ1A 2RJNA 3GVXA 3CHYA 4CKEA 4YMLA 3L1UA 1INLA 1IJEA 1ZBDA 2X58A 1E2IA 2E1RA 1NBEA 2HXYA 2J33A 2VH2A 2Y0PA 3MD9A 3A9CA 3JW8A 3MAGA 1C9YA 3OZSA 3KLBA 5IFLA 4WWHA 2H1CA 2YWDA 2ONJA 2WWGA 4BNJA 4UZEA 2FHSA 5F35A 2VKQA 3WWYA 3HJNA 1E2KA 2PFSA 2XWBF 4MHTA 4DSTA 2H29A 4D7AA 2O07A 3W79A 1YQEA 2C3MA 4XTCS 1G8YA 3HUTA 2YMLA 4ZTBA 2XNSA 1VJ0A 2NV0A 3FUCA 5D3KA 1YJ5A 1XUOA 1CY1A 1X7ZA 3CO0S 4JEUA 2BFDA 2QN2A 4CKBA 4R0MA 2H54A 4RD6A 3HLTA 1QGUA 2ECPA 1I5RA 1WZCA 2C0CA 1TIKA 2WRZA 2X41A 3UV7A 1C7IA 1O08A 1YBFA 3L7JA 4ZOLF 4DSNA 4WDRA 4MPPA 1PV4A 3NFYA 1BU8A 1AE1A 1RKBA 3COWA 1WXQA 3N87A 3T5BA 3BE5A 1JDJA 3AK4A 2IU6A 4KWTA 2J9RA 3ZW8A 1R2QA 1XA4A 4NSNA 3I53A 1TVCA 4ZKEA 6Q21A 3ANMA 1PUXA 3FETA 1UPUA 4MVXA 4HUQB 3RC3A 4XVUA 3ABSB 4C2BA 4GMDA 4OHKA 2A4KA 1HZJA 3CE9A 3MJEA 5BUSA 2XUQA 5K3FB 2PEYA 4CM4A 4DDKA 2O1XA 2YWXA 4TLLB 4QYSA 4YRIA 1VLZA 4U2EA 4LWQA 4MB0A 4ZRMA 5EKXA 1EE1A 1GLGA 3IR6A 4Y6SA 2ZM6B 4DR5B 3MMSA 5E2AA 5LC1A 4DMFA 1Q7EA 2IEAA 2OAQ1 5AUOB 2F1KA 2XRMA 3AESB 3M70A 3U4QA 1DT3A 3TRFA 3ESXA 3QBJA 5F21A 5DFAA 4K0RA 1WDTA 4NBNA 3QNUA 1CE8B 2NVOA 8ATCA 4NENB 2W48A 1HR0B 4ZRNA 3M8KA 2CGEA 2H63A 2I55A 2H4ZA 3IIIA 2AOUB 4LKRA 1G3MA 5AKYA 1JF8A 5JWRA 1B93A 2C9MA 4XGKA 1TCVA 4W5NA 5KJCA 1CK4A 4XCQA 1A4XA 1J24A 5AM4A 1FXWF 2GAFA 4ATNA 1ORTA 5K09A 1Z0ZA 1QTIA 1BEUB 1IWOA 2V5UA 4O5OA 4TX1A 3T9DA 5KDOA 2R00C 3LZ6A 4E1AA 3WWPA 3I5XA 2VJAA 1X92A 3WL4A 4RLFA 1Q7CA 3MCZA 1GT91 3HJBA 4LX8A 1XQ9A 4TMYA 3KZCA 4YGXB 4GSYA 2QSJA 3FI9A 4UUBA 3G9TA 4BO0A 1AGNA 5KC9A 1XAIA 4L7VA 3UXEA 3VO1A 1AT1A 5KTPA 1C9NA 1U8TA 2F67A 2YZKA 1MC8A 2Q3BA 4MWGA 4JXJA 4MW7A 4RQAA 2Z3WA 4X45A 2Z2ZA 4E5KA 1ZM4A 4PO8A 2D5IA 5ECDA 3NC0C 1DVRA 4R84A 3NGLA 4EWLA 5I3ZA 1EG2A 2JIDA 4C76A 3I52A 1O95D 1T0UA 2ZKIA 1GO2A 3Q41A 4KE6A 4YP9A 2IIVA 4P4GA 4FZJA 2EZ9A 4L8YA 4ND8B 4NV1A 1M1YB 4PTYA 2BN4A 2JLSA 3IRVA 1Z29A 3AU8A 4PE5B 3PKJA 1D5WA 1EXMA 3WTCA 1OXVA 4U7PB 4U7HA 1E7YA 2DYKA 2ZPTX 4YJ3F 2WYWA 4TN1A 2DR3A 3PJGA 4UNIA 1XU9A 1U0JA 1YJ8A 2XQIA 3U4AA 1BMTA 4CM7A 3GA0A 4ZJYA 2J7KA 3TQTA 1CY4A 1NMQA 4XVCA 3P9YA 1AA6A 3AYXB 3WLOA 4XVRA 3PBKA 3NP7A 1SQGA 5TMBA 5BOSB 1CUSA 3BZUA 1EX1A 3F9CA 5A03A 2WVJA 1U2QA 1I3OA 1EZ1A 4O4JF 3UAVA 1L4HA 2SKDA 3OTIA 2GCEA 1KEEA 2Z57A 2P2LA 3FPJA 5IPFA 3RJ9A 3I04A 4B7CA 1R1DA 3OPVA 3DBLB 5HR5A 3FFXA 1AJEA 2HY7A 1EESA 1NBME 1UMBA 5F77A 4PC3A 1P2FA 3CIFA 1ACLA 3RUHA 4J07A 1DWOA 4DQVA 5FORA 2FKAA 2CSUA 1E1CB 3A4TA 1Z4OA 3TZBA 3NNDA 1KXJA 4F6RB 4ICIA 1KYXA 4KSCA 1BW9A 2IX3A 3ENNA 2ZT6A 4DHWA 5JMOA 1WA5A 3SM3A 1D1TA 4KQCA 5A6SA 2YY6A 1I5EA 2C07A 3VC3A 1E92A 4B84A 4EITA 5JRJA 3F3YA 1AF4A 3TL3A 3W0LB 3T7AA 3OX4A 1RQ7A 3TPZA 3D6TB 4OXNA 4DT1A 2HNBA 3DHYA 2C5SA 4G85A 5CMLA 4EF6A 2C5HA 3F6RA 2GAAA 3E5NA 4LY3A 4RCZA 3KJIA 3SC2A 1L5OA 1XDGA 1GTRA 2O57A 1SXJC 2PX6A 2P41A 3OH8A 3QK7A 3K16A 3B1WA 4OOFA 2EIHA 4DC9A 5JARA 5JO0A 4RK4A 4M9XA 1UJNA 3LDGA 3NKFA 4YJFB 2R66A 3X44A 4X85A 2O8VA 1HG0A 4ZHQA 5CB0A 3ZKAA 3IE1A 2YOGA 1HE4A 5AR1A 4DR6B 3BDVA 3ADDA 2XDWA 2XWPA 4LJYA 1F3LA 4QNRA 4BO5A 3L18A 3OD5A 5CDTA 1H66A 4Q5IA 2PWBA 3Q7RA 5IH7A 1JB9A 5HKLA 5IDVA 1UXOA 4HAYA 4D9IA 3WGHA 5EA2A 4LJ4A 3GD7A 1Q77A 3R5JA 1KY4A 2MSCB 1HURA 2IW1A 4RKWA 4ZQHA 1QKJA 1BFDA 2IQ5A 1CUUA 1WMBA 3DHWC 1N5JA 1Y9JA 2IRWA 1ZNXA 1B6SA 3LFTA 4YMHA 1X1AA 2KW5A 2YYYA 4QBKA 4EY5A 2C9OA 2CE7A 1MB2A 2LTAA 3DHEA 3HFSA 4HYTA 3QM1A 4AG5A 4LJSA 1EP2B 2JLZA 1JFLA 3CR3C 1MO5A 1E9CA 2OO5C 5FBLB 1F06A 1RYMA 4RY9A 1CTQA 1RFLA 3KLPX 1R4NB 3N76A 1Z34A 5EKDA 5CX4A 3L1VA 3U1VA 3WHLA 1KWGA 3KQNA 1I7DA 3ELBA 1YE8A 4O4IA 2PA0A 1JE1A 2HF8A 1TMKA 2GTPA 2IYWA 1I24A 3BF8A 3II6X 2IYVA 3EIHA 3AEKB 3VPBA 1V5IA 2I9PA 4WLOA 4Q48A 1QHNA 5ALIA 2HHJA 3T35A 4MTLA 2NLOA 1PT7A 1E1QD 2WNHA 2I87A 2R11A 5DHQA 2ZSHA 3DZHA 3HV0A 1V8BA 2PCJA 3SYKA 5EZ5A 1L1QA 3MVEA 3IP1A 2QAIA 4YT4A 1TEXA 2QP3A 3F6BX 4B81A 2NP7A 1YE5A 1QCYA 2FWRA 3FVTA 1USIA 1FNMA 4KI0A 4DDMA 4MRSA 1E3LA 1DUIA 3P9XA 4L4UA 4OUDB 1TK2A 4IGKA 4V02A 4EHLA 3UBTA 3T99A 1U2PA 2OLKA 3GY0A 5H70A 1ZEJA 3BK7A 3UF0A 2OGUA 4A8JB 5CVTA 3B89A 1NW6A 2O2EA 4QXOA 2QR2A 3FSGA 5TB5A 4JENA 4IJWA 3BN3A 5E2BA 3T7RA 3RJMA 4ER0A 1FNSA 1JI0A 2C8VA 3ZDXB 1L1FA 2JAOA 2ACEA 3PUKA 4NU6A 2FAXA 3I1IA 3U0VA 1JHOA 1JJBA 2D62A 5JD3A 1L4NA 3OM0A 3L7MA 4CF5A 4OP1A 5SZIA 5IRCD 2PYIA 4HGQA 3I83A 1D7OA 4X63A 3SZGA 1ZM9A 1JIXA 1NPTO 4LI3X 4HXYA 1P6QA 2QM0A 3UT0A 1GSOA 4X61A 4RSRA 1G4UR 2JFXA 5HFNA 2VTVA 2BONA 1K6JA 5T7BA 5ALOA 1Q2UA 2GCNA 4PTLA 2FWAA 3NLLA 3IJPA 4TMZA 3BA6A 3AGPA 1T2FA 2MIIA 2GEFA 2F8SA 2B4RO 1PGJA 2ZRCA 5ITWA 3E3NA 2HR1A 1UF9A 3K2QA 2ZJ8A 3HRIA 3KHTA 3LUAA 4P32A 2VJYA 3WQQA 4BQOA 3T5PA 1H9AA 4QJ4A 2B78A 3OT1B 1X2BA 5GP1A 4B7XA 2JI7A 1S3GA 2FOXA 2WHPB 3MCVA 3EB9A 3QEMB 4ALIA 1SXQA 3EMDA 1AZSC 2VJOA 3EN0A 3D0OA 3K1JA 5H3HA 4U2BA 1I7SB 2IBTA 1ZJ4A 5EJ8A 4WJKB 2FSPA 2G1PA 3IUSA 2X0RA 3K09C 3LDAA 4KWHA 5H59A 5C1IA 3N2EA 3UJ6A 4CKCB 4P4NA 3IEXA 4ND1A 1PEAA 5BW4A 3AKEA 2EWVA 3BWMA 3SN6A 4FD3A 1UBSB 5G53C 2GBGA 2H85A 5A4AA 3DVQX 3L43A 4BV9A 3TG2A 3EVAA 3LUGA 2GZ2A 3VU9A 2HD4A 4L9RA 4GPIB 1OT5A 1R6DA 4YP6A 1S2IA 4AUEA 5IYZB 1C1DB 2XMQA 1WE2A 3KLMX 1DFIA 2H8GA 4AJHA 4OUKX 5J40A 9ABPA 3LL7A 2VAPA 1XDZA 2V0NA 3A3PA 3GWZA 3NR2A 4V3CA 1U7PA 1NVDA 2QTGA 1FSZA 2H1WA 3UA3A 3DO5A 2PO5A 2XTMA 3GT0A 4JKOA 4PYRA 5IJXA 2GD0A 1AS2A 4K26A 4QSHA 4ZO7A 4CEHA 5B30A 4BOYA 2QTMA 1PJTA 3V2HA 4AWXA 1TK9A 4KLCA 3OKFA 5ITSA 4RE6A 5CTJA 1UEXC 5KAPA 1LI7A 3THOA 2ZVQX 5THKA 1H9CA 2XVMA 2IHTA 4L78A 2IU4A 3ONNA 1XMOB 2AG0A 4S2UA 1NDUA 3BCSA 2SKEA 3PITA 3V4RA 3COSA 5H1YA 1HDXA 1JVBA 2M1XA 3TVTA 3VYTB 4BZWA 4DDWA 4ILEA 3Q5GA 4ZXPA 1FDSA 1WCWA 2HBRA 2W6ZA 5I47A 4R7GA 4OQQA 4YJ3A 3RGGA 2JJ2A 3B5EA 2C2HA 1VLVA 4L9AA 3T7JA 2MSEB 3KJNA 2FX2A 1CIJA 3RLFA 4CMEC 4DAEA 4BQEA 3M3PA 4JL8A 5DHRA 2XX3A 1G8SA 1V71A 1O3YA 1YZLA 2CFSA 2VAMA 3BJZA 4AK9A 1XTQA 2C2XA 5KMGA 4M0FA 2QEQA 4C4YA 5BRJA 4FT4A 2E82A 2WSSA 3T61A 3N3BC 1NQWA 3W8RA 1BDJA 3AG6A 4UPEA 1JVNA 2F1OA 4W5QA 3RIGA 3QJ5A 4IS3A 5EFZA 2EGUA 5FL3A 1Z0AA 2QOEA 2DCMA 1AH2A 3DXXA 4M76B 3HO1A 1XDUA 1IHXA 2GJSA 1K88A 3OZ7A 3LLSA 4OHCA 3IRUA 2NZJA 4H1VA 3QKUA 4KPFC 2VK1A 4P4SA 3T9BA 5IWCA 1VZ3A 2ORYA 3E1GA 4MQFA 2WBLC 2RI6A 3QEBZ 1Q15A 4LS3A 1H2WA 4ZCLA 4M0DA 3TR0A 4QX6A 4LCJA 1JLSA 2FOIA 3BRCA 1FXSA 2NVWA 1Z16A 6GPBA 3VI3B 4F4FA 1SHZA 4DR7B 1MENA 3GJZA 4YQZA 3RF6A 3TBKA 4O1IA 5IH3A 1CQJB 1A04A 4BWYA 5BSKA 1OLSA 4W5JA 5K99A 1YZKA 4XLLA 1T10A 3KKQA 4FS3A 1O94A 5FL7A 5JXGA 1JGTA 2C2BA 2FJ0A 3IUPA 2WDZA 4MEJA 3RH0A 3E15A 4AJ4A 1JMKC 3GZJA 1E2LA 1KMHB 1ZUHA 1ENYA 3B7PA 3GRPA 3L8FA 3OM9A 3DDNA 4L15A 3RVQA 3W1EA 4BNTA 2BF4A 4NYMR 4PAWA 4UDOA 1BE1A 1FTSA 1SCUA 3E22A 1FRNA 3WOHA 1H0HA 2VFAA 4I66A 3LHKA 3MUOA 3FWPA 5FNZA 1EYZA 2X0FA 3A1CA 4MUHA 4UCQA 3PCXA 1NJGA 1ST2A 4QUDA 4EENA 2P6UA 3DMYA 2ZTVA 2QGZA 3K94A 1A2OA 1BOFA 4R2JA 4F6LA 5FLXA 1NSYA 5C8YF 2Q27A 4MA0A 1IMOA 5EKSA 1QFYA 4MVWA 5E38A 1GGJA 1K8XB 5AOBA 4NWIA 4XX1A 4NZYA 2OYCA 2IEGA 3HU3A 5GTDA 1TXGA 1H8ED 1J0DA 2FZGA 1YR8A 2NSYA 2YRFA 2ZUBA 3IVCA 3CEJA 3HJHA 1N2ZA 1QCZA 1YL6A 3FVVA 3P5SA 4LJ8A 4X1YA 3UATA 5GADl 3H7IA 1JHYA 4H77A 4IMIB 4R1UA 1KYTA 3G2NA 1O2DA 1Z4MA 2E3JA 2K2QB 3Q40A 4W1SA 1YB5A 4UCFA 2BMWA 2VZ9A 1CDDA 3ICOA 1R37A 4KRFA 5AJWA 1LK7A 4FOSA 2P3QA 3ORSA 2VT7A 4BVBA 4OQEA 4EOGA 1T9BA 2B3DA 2A7XA 4OFWA 2LCQA 2WFLA 3RUAA 3INTA 4QATA 2WD7A 5GONA 2WPDD 4RSHA 1N57A 1GUFA 2CNNA 2V6GA 3SVZA 3KBBA 2A7QA 2PV0A 2D59A 3DEKA 4XSHA 1OKKD 4CQMA 5IK2A 1Z5NA 4GZLA 2GZ3A 1X8LA 1Q6ZA 3DBHA 2ZIUB 2I2AA 2GFQA 1RZ3A 1ZD2P 2FEWB 3GFQA 3KKZA 1FYWA 3KPYA 1DSSG 4X9XA 5FL7D 4PZLA 3VU1A 1HGXA 2P0AA 3A3YA 5FA8A 1XDWA 3SGLA 2QPOA 3IEKA 3VVMA 1FC0A 3WRXA 3GGGA 2PSFA 1F0PA 3LBYA 4KQ6A 2Q5JA 3TLGB 4Y6GB 2R62A 2Y1OA 3ZC3A 4O29A 1MJGM 3I5UA 4RKRA 1TAGA 2ODEA 3IDFA 4Y18A 2HYIC 3KSBC 5BMOA 3HKDA 2O2XA 4NJMA 4YCAA 1PAUA 3TGLA 3IIKA 3ZVLA 4R1SA 4RMHA 3CZ9A 3HCDA 1Y7HA 3MJHA 4EKIA 2P9JA 4DQKA 3WNBA 4HUTA 3AFNA 3F3KA 4R2HA 4ZEXA 5J5VA 4QQNA 1WXHA 3IL2A 1II9A 1KVUA 2Y76A 2V58A 4PSDA 4OP2A 1H2AS 3SZUA 1IIRA 1DCKA 4DJFC 1YL7A 1V3VA 3RUDA 1GG2A 1BVRA 1QH1B 2HL6A 1X7XB 2WHYA 2ZSAA 2I3AA 1WULS 3NOXA 3JQ7A 3TRDA 1E7MA 1QHYA 5EJ6A 4MKRA 2E55A 2J32A 3INNA 2C04A 3RWBA 4RQBA 5JMTA 4EVQA 1D0SA 4Y1EA 2H8KA 4U7JA 3EXFA 3HYLA 2G8LA 5CUQA 3A1TA 3AR6A 3BK1A 1JA9A 1MRZA 1RRMA 5FTMA 1E6WA 3TVYA 3NHMA 3TLZA 3KSAC 3TR5A 2XDQA 5AHWA 5T64A 3NATA 3RWOA 5L7TA 3LIIA 5F3WB 5LXTA 3NCTA 1Y7PA 3GFSA 4KWEA 1JDNA 1YUNA 2PJUA 4A2CA 5HIAA 4DUYB 1BQ4A 2WU4A 1LRKA 3BL8A 1JQ5A 4ZCQA 5CA0B 4MS3B 2FN7A 5JWHA 5SY9A 5AVWA 2ZBPA 3BJMA 3AR5A 2AWOA 4IHJB 4Y67A 4YALA 4JYAB 1P77A 3RBXA 2JH8A 1PR4A 3A36A 3SS7X 1FDWA 2VHUA 3MJDA 4BNXA 1KC1A 3K0KA 2GPJA 1OJLA 2ZRFA 5H16A 4HVAA 4Y1GA 2FP3A 3OLQA 4BPRA 4DSUA 3ZDRA 4XWYA 2B1QA 4G81A 4KWCA 4O02B 3WOVA 2BP7B 4EB8A 3LF2A 3LJKA 3OJFA 1P45A 1TYCA 3LQQA 1PT5A 5D7BA 1HQKA 4UM8B 3SFZA 1EX6A 3FCYA 3WLPA 1JE0A 4D3ZA 1X9IA 2FSVC 2XMGA 5TPWB 3OM1A 5EP4A 1DRKA 5HUHA 1OB5A 1N6RA 3SQWA 1RM3A 4WGFA 3EGDB 3RRFA 3GVCA 1U0HC 3PQDA 3JQPA 4M7PA 1RRKA 1YR1A 3BE8A 3O31A 4JWKA 3UHAA 2RK6A 1G8FA 2W0MA 3FHCB 5C0OE 1RTTA 3L40A 4HN2A 1MGOA 3JWJA 4LDAA 3I3SR 1MJGA 3NHUA 5DX8A 2G36A 1NN0A 5ALFA 1ZJZA 3OQHA 4B6EA 2GO7A 5GJBA 4WW0A 4HD8A 3DDUA 4QTUB 4GPAA 4MR8A 4PX9A 2I8LA 2B1IA 2WU3A 4OAPA 5AK6A 5AW6A 2G82A 2PS1A 4N0QA 1N9GB 3GDFA 1JEEA 2P6NA 2RGEA 2NTJA 1VLQA 3D4LA 3FDJA 4MMXB 5EEHA 4EEZA 1JJ7A 4TTQA 1NI4A 4YR9A 1SXJD 4JJKA 2J48A 4S1TA 4UKDA 3QU7A 5ILGA 1VE3A 3FROA 3K0FA 4MVJG 1XELA 5AXBA 3AEQB 3VR4A 1GUYA 5EXEA 3QLEA 3O3CA 4E32A 2RC5A 4H7DA 1U0LA 3LW8A 5KJFA 4D8TA 5J2TB 2PBRA 3PJDA 3QVGA 2RGBA 2QW1A 3ITNA 4LYFA 3CLKA 2WUEA 1W76A 3O2QB 4LVNA 1NDHA 3V3KA 2P11A 4C4RA 2JEOA 2A1IA 2VR1A 3VJMA 4KK4A 2OM6A 4ZDKA 4JXXA 2RHOA 1HT2E 3I72A 3NT2A 4GL4A 4XARA 1P9OA 4NDNE 1E1KA 2HA7A 1V25A 1O7JA 4YECA 3ZH2A 5DXFA 4PC6A 1OWMA 1WS6A 1SUDA 2IZOA 4HAZA 3IQWA 4GI5A 1B43A 1UAYA 1CRLA 4DWVA 4UMFA 1KYQA 1CDZA 2IXGA 2VQDA 2WM3A 3WMFA 3ZVMA 2W4QA 2X4LA 1OX4A 3KZXA 4ZJUA 1T4GA 4TV9B 2V3WA 2IPMA 3C14C 3DDHA 2CJPA 1C1HA 4K1XA 3BSWA 3GH1A 2CFIA 1T36B 1T8RA 1XAHA 3TSAA 3ZUGA 3DV2A 1VBMA 3V8PA 4JI0B 3MLBA 3V34A 3WYFA 1E0KA 4AFNA 5KTRA 1H8HD 4B31A 2HRDA 4RVSA 2HOQA 5CG2A 3VHXA 3AP1A 3BGVA 4R68A 1W87A 3D9QX 3RM3A 4YUYA 3KM0A 2VP6A 1HDOA 3ZGXA 3VPCA 2GDZA 3I42A 3CVOA 4LSMA 1GFWA 3DAYA 1NG1A 4WK6A 3SK0A 3T06B 2IXTA 1EFVA 4PR0A 3JD4A 2QTLA 1XNGA 5D3MA 5HKKD 4DXAA 1HXHA 1M2NA 1RLMA 3NAMA 1CP3A 1L5HB 1UXKA 2ATIA 1IOVA 1T2CA 3T4PA 1ECFA 1C1XA 1HDZA 1QTNA 1T0JB 3Q2IA 4KQKA 4RPGA 1OPXA 5HRCA 1R0LA 3AU9A 2Q3MA 4MQ6A 1DAFA 2DJIA 1DEOA 4F0JA 4ZGWA 3HZHA 5BVGA 4RLQA 1XRRA 2GBPA 3R23A 5E1MA 4DQXA 2D2IA 3PEVA 1TCAA 1S4QA 1O0SA 2F3UA 2H07A 1S1MA 2P6OA 3PA8A 2BVNA 4UMVA 2QL5A 4QA9A 2YJZA 2GN6A 3H5TA 3TMYA 1Y8RA 1A77A 2PWYA 5GVSA 5C8VA 4DGQA 1P1RA 1SBHA 4MW2A 5C8YA 4C3OB 1EWVA 2Z1MA 2EKLA 3VISA 3LXUX 4TRRA 4FFNA 1WLSA 2F3PA 1PEYA 3C3YA 3EF1A 3NTLA 4P3YA 1W36D 5BUQA 2BZSA 2OSVA 3ZYZA 3J80A 1APBA 2J9FB 3UJHA 1FDOA 2QT0A 1TOAA 3ORQA 2ZTHA 4FVTA 2WHQA 3BKXA 3F78A 4WZBA 3JATA 2OAP1 4JLKA 4EY6A 1TT5B 3W78A 1HLGA 1W34A 3K0AA 2HIHA 2JLVA 1J2TA 1SN7A 2Z58A 5TF4A 4P6VF 4B09A 1POWA 4YCLA 5C5DA 3L7OA 3P1JA 1T9AA 4Q3DA 2X0EA 3DKRA 3DSRA 4CGZA 3BB1A 4HTFB 2ZJ2A 3SXJA 1ONNA 2ZSFA 3NTOA 2QZ9A 4XUCA 4E5DA 1UBKS 4QFMA 1B8NA 4MUBA 2ZUTA 4JP1A 1WV0A 1Z0KA 2OHFA 4NP6A 2XR1A 4N6NA 4WBSA 2JGJA 2HTEA 3CTPA 5MDHA 3FI0A 4ZOQI 1XEWX 2FG6C 2ECOA 4GZMA 4L1KA 1J56A 1T0HB 1VHDA 1E89A 2YYSA 1TZJA 2J0QA 1VM6A 3FUWA 2HWXA 1M8KA 3DLCA 4R3WA 3SP1A 4CCYA 4QC2A 5CVEA 1UK6A 4O2BB 4F9FA 1OAOC 3KWMA 4G4GA 4K9KA 1CR6A 1I30A 2NXCA 4WCFA 3OHMA 4WKNA 2AMYA 1JHRA 1K9SA 1OWNA 2BBOA 1JB1A 2QJOA 3PDHA 3CSUA 3TSOA 1TCBA 3DF7A 2QMEA 3BERA 1SA0B 1A7KA 1P4AA 2V96A 3EZ6A 3MCWA 4DC0A 1SQFA 4KR2A 1NJFA 2ZULA 3W2EA 5LA6B 3H1AA 3WYEA 5DBFA 1Z3CA 3FZYA 4DJAA 5JMWA 2L18A 2NUPA 4QM6A 4ALKA 4HLUA 3PI7A 1XBTA 3TLYA 2IPNA 3U26A 1AU9A 1E2FA 5H3CA 4JLSA 3RSSA 5JBIA 4EFLA 3UMCA 4IDQA 4IG9A 2O2JA 4JNKA 3DQPA 3S1AA 4F7DA 4MGZR 1BTOA 2TECE 4H08A 4BL5A 1CUJA 3L8MA 2NZXA 4W9NC 4DTCA 1FFCA 5AJZA 4KFCA 1D3AA 5CM8B 2H2AA 4B1FA 5M5BA 5BWLA 1JLKA 1EFPA 1B42A 4HAOA 3LLUA 4Y6QA 3ZXYA 5BVHA 4PLTA 2EERA 3HWSA 2I1VB 3LT5A 4W8OA 5THQA 3OU6A 4YRBA 4R2KA 1IXKA 2QVLA 1K5HA 1Z2OX 3ONDA 3ZOKA 5LUBA 5GZ1A 2HNKA 2JKZA 1KQGA 2ORED 3TNFA 4TYQA 1UDAA 4X1OA 2XLBA 1JA0A 3L0OA 4AY5A 2I3BA 2G4CA 3B20A 2MHCA 2QA5A 5ALPA 1QP7A 1ADBA 1FB5A 2O8FB 4EEKA 1Y3AA 1PN3A 3I8SA 4MULA 3D5EA 4LOLA 4XIIA 2VLIA 1XRNA 1ZU5A 2GZDA 2JCGA 3Q7PA 4HDQB 1JKJA 3ENWA 4U2FA 3NMUF 3A4YA 4PYIA 3IV7A 3CGGA 3NNNA 3T7CA 4ZOLB 5EVJA 4L02A 4RMNA 3DPIA 2F1JA 1JHAA 1NVAA 2QNRA 1GPLA 2G07A 4HNGA 3OO1A 4ARUA 4DLPA 1ZU4A 2O2SA 3TQHA 1T3LA 3Q3GE 4PNZA 1ZGAA 2Q4EA 3HKBA 1BN7A 5AJVB 4F4HA 1EDBA 1YZYA 3O2NA 1Z08A 4N8SA 1JKMA 1Q12A 2P75A 4F3KA 5TEVA 4BQRA 1CY2A 2JRLA 2NMVA 2Q5LA 2VRWA 3A2KA 5F5XA 1BHO1 1DL5A 4FFBB 4NEGA 1QMPA 1BA2A 3DPUA 4CMJA 1Z5UA 1T6YA 4EMSA 1RI4A 4BV8A 3RPEA 2OY0A 4H7EA 2AFHE 3IMKA 3TDNA 5IANA 3U17A 2OZPA 3QXGA 1XYVA 4N5HX 4EPVA 1RS0A 2B3TA 2HMVA 5BP7A 2K87A 2F8TA 3KXPA 1KJQA 2R65A 4GOND 3I62A 1S3SA 5SZKB 4DNPA 3DF9A 5JZVA 2Q2NA 3MWKA 1TVKA 4GL2A 4GOOD 4G0XA 1W4LA 4I81A 4U2KA 4BNFA 3HA7A 5L40A 2WOOA 2CYCA 2P9FA 3F4KA 2QAGA 2HAEA 1E6UA 2B61A 1CF4A 1EK1A 4LXGA 5ABPA 4NBSA 3RADC 2FPUA 2X9QA 2CJXA 1U81A 2X5OA 1Y3CE 3L7NA 1OFVA 1JHZA 4FDUA 4FIZA 2WF9A 3WKCA 5KKNB 4M3NA 3PC8C 2B5WA 4M7OA 2R6DA 3I8OA 4P83A 2GN2A 1BVHA 1V4BA 1SUBA 2NZYA 1IN8A 3DFMA 4U39A 5HKKA 1B4DA 4R9UC 3EOBI 5AOVA 4MKIA 3H2IA 3KO8A 2FUEA 3LY8A 3EXIA 1JQAA 3PFKA 4BVGA 1V6SA 1HMPA 4ZREA 1Y6QA 1XVIA 1M9NA 1N9KA 1QHSA 1UADA 2UZ1B 2OHXA 1W4ZA 2A9JA 2ORIA 3OSUA 3U39A 1PGNA 4Q39A 4AO6A 4YMTA 1M54A 4H3VA 4MITA 4WERA 3V9PA 4I08A 4MKFA 1ZA2A 2RGRA 5ICGA 1U8ZA 2XTNA 3SYNA 3KWJA 4NBWA 3UMFA 4UQOA 1T0PA 2PZLA 4FFSA 4LF4B 3E03A 4BVLA 2HK6A 3W05A 5YASA 3SC3A 3LVFO 4DR4B 3K6KA 4AKEA 1QO7A 1ELOA 1A4IA 3QG1A 1TQDA 3CXRA 2OXCA 3OICA 4RZHA 4QZVA 1UXIA 1GPJA 2P6PA 2WMDA 4NV3A 4DS3A 5FHQA 3EQ6A 4NL4H 1UBTS 3A06A 1XN1A 4EUSA 1G3QA 1B0AA 3IUEA 3K1AA 3JAKA 3KKEA 4G8DA 4UTXA 3UFXA 4D6PA 5LP1A 5CEEA 5ITZA 4RY2A 3IHKA 4WLEA 4B45A 2FUKA 3NOQA 4JVLA 2YHAA 2Q8PA 4DJJA 3KB6A 1HDYA 1NJ1A 4D25A 4RMGA 3FGOA 2X8JA 3WGMA 3O4IA 1C2YA 2GJ8A 3KTFA 3B36A 2YINC 5SV2A 5KWVA 3IX7A 4G56A 2ACKA 1HSZA 1YZNA 4O4JB 5ALJA 4D6XA 4HQNA 2GEKA 2ZZKA 1EINA 4HF7A 4IWYA 2HJGA 3U37A 1N5MA 4QYWA 2LV8A 1GSHA 1FVFA 2R5WA 3ADKA 3QU5A 5EXDA 1Y80A 5FULA 3UMVA 1ISMA 2QN8A 1EFCA 3UJ9A 4A26A 2CJWA 2WB4A 4G0WA 3CW8X 4XR4A 1U9JA 3O8LA 2G9RA 3ZHUA 4EHNA 3EGEA 3KAKA 3PNQA 1N1DA 3HCNA 1RHJA 2AMJA 2I2XB 4BC1A 2QLTA 3CUTA 5AW4A 1FMJA 1THGA 5IVIA 5A9TA 1ODCA 1TMYA 1XZBA 1YZFA 1I2DA 1E2PA 2R7NA 5H02A 3TLCA 4RVFA 3WLSA 3VBEA 2UUAB 3EMKA 1R18A 4FSXA 2BLNA 3BZWA 2FEPA 3G5AA 3LHFA 1Q16A 3TAXA 1RMYA 2Y93A 5C5IA 4ADSG 1H5QA 1KJJA 2OEPA 2QVZX 3LLVA 4UD2A 4F8JA 2H4JA 2HPHA 4X91A 1CDOA 4L27A 4PAGA 5LOVA 5L8VA 4EVRA 1T2EA 4MLCA 3H11A 2HB6A 1P8JA 1T4MA 3EFOB 3I0NA 4IIGA 3OX2A 1NOKA 2WP8J 4PU0A 2KLBA 3VPGA 3JYOA 2UZ0A 3UCFA 3FGNA 3LH5A 2H57A 2HO4A 3ZY5A 1E2BA 1LZLA 2GH1A 1M83A 5DB4A 3ZTTA 5TQ0A 1D4AA 1AKRA 3R75A 1VA5A 3M6UA 2VK4A 3FNRA 1BYUA 2CVOA 3E7FA 4FUTA 4ITVA 4P3KA 4WSOA 5ILQA 5TT1A 3T3MB 3UB4A 4DLNA 1DAGA 3GQBA 3PDIA 4GAEA 5DGIA 2FDXA 2Q1WA 2J0UB 1U02A 3MWDB 3PHHA 5KTOA 3BXFA 4HRVA 3QVOA 4IQFA 1DB3A 4RCYA 1CQZA 3GD5A 3GPCA 3MTEA 3D2BA 4IRXA 2O0JA 4NKRA 2HRQA 5BV0A 3GGCA 1U7WA 3HDTA 1ID8A 2AVDA 1JXQA 1EH5A 2ZE7A 3KB8A 3OQ1A 4PYNA 5LLDA 5AHOA 4J1QA 3PNPA 4NJOA 2EJCA 1R0RE 1EFUA 4QYTA 5JFTA 3BTSA 4G1VA 3SXPA 2VYFA 3RC2A 1DC7A 2YDYA 2CBXA 3QW2A 5F51A 3DDSA 1LQUA 5BN3A 1S89A 3ABZA 4JCOA 2ZT7A 1D6JA 4KXVA 4BKRA 4MR7A 4FE7A 3C43A 2DHRA 5TDHA 3HYNA 1YCHA 1FDVA 1KOGA 4C2TA 5AKHA 5C4MA 1IZ0A 1W2WB 4E13A 2ET6A 2HSZA 2QLNA 2YV2A 4F3CA 2HU5A 1D2RA 3K8ZA 1X9GA 2BFFB 1KQFA 1EX7A 3V7FA 1F8YA 1ZD3A 1K5PA 1Y1PA 3IVXA 4O0LA 2CXSA 4L5BA 4RGBA 5DTMA 3A1VA 5DCUA 1XQWA 4RULA 1UJCA 3VM6A 2FX5A 4K9RA 1X1BA 1OFUX 1P29A 4JA0A 1MX3A 4K6CA 4IIXA 4Q4JA 4QPNA 3LP6A 4TT3A 2X40A 5TE9A 4F2GA 4ZAZA 1F51E 4UOZA 1CWUA 4YMGA 4WZ6A 5DW0A 2YIDA 4NMMA 4Z5XA 4PSCA 5I9NA 2NTNA 2A0WA 3LSTA 4GMXA 4H60A 1M2OA 1GQSA 1IN6A 1ISSA 2MJLA 4GR9A 4KIGA 1GV1A 5KYYA 5F76A 3REFA 1E60A 5TRTA 3THRA 1PK7A 1J4AA 4DLXA 2PKQP 3KWLA 2WEKA 2AK3A 4Z3KA 3PXEA 1NVMB 2RI0A 5AD1A 2LBPA 4B7UA 4WOKA 2OOSA 3OE7A 4FLEA 2JK1A 1T5LA 2ZVDA 1FU7A 1NU8A 4EW2A 3GWGA 2I6QA 3VC2A 2P6MA 2WKQA 4ZCSA 3VGPA 1G8JA 2GAOA 3R9XB 3LKVA 4TZ0A 4V0ME 1N1EA 4D4IA 2C78A 2C61A 2HM7A 4DCSA 5KVAA 3FOCA 3AERA 5DK6A 3QP9A 1VHTA 1AS0A 1KI1A 1VA4A 2GD1O 5LP6C 3AKDA 1PNVA 3AEXA 3PIRA 4LF6B 5ARDA 4PW0A 2ABWA 1KFJB 4ZK2A 5DULA 4QBIA 3DEFA 4XWKA 2HW8A 1PR9A 1SXJB 1BX0A 3MSCA 1RI5A 1K7CA 2GXUA 4COKA 5JD4A 2KB0A 1CQWA 1P2SA 2AI3A 2ZSBA 1MH1A 3BMOB 5KINB 1TLTA 5CYGA 1MOZA 2CYAA 1W47A 4TLDA 3JQAA 2QWXA 4JZKA 4M53A 3VQTA 1GITA 3IHTA 2WYHA 1UWCA 1UEIA 1FW8A 4L5AA 3SZRA 1R6TA 2ZUEA 3GGDA 4OLBA 5JS6A 2HJVA 5CYOA 1CUZA 4GDMA 4LKOA 3AP3A 3E4DA 3HVJA 3ZS8A 5ENVA 5ADWA 4GRIA 5HEKA 9GPBA 3DNMA 2EWWA 3O74A 1NBHA 2BGLA 1L7NA 1T1IA 2VN8A 4EUEA 5FBHA 2BEVB 4U0JA 2IU3A 2VXOA 4K9QA 1CIVA 1C30B 2EX0A 1D4OA 2GK3A 3TQRA 3QMMA 1E3EA 1SU6A 3F97A 3M33A 2XAUA 2PKRA 4II2A 5K5EA 5K8LA 1UOQA 1NBWB 1LVGA 1MD9A 4GG1A 4GZ5A 3LA8A 4MI9A 5DHSA 3QUCA 2IJGX 2P4QA 1SO8A 5C7IO 4XPIB 1PVOA 4OFBA 1I2CA 4BAGA 1RPNA 1D0VA 3DYVA 4TTVA 1M1NA 5E4FA 2RH5A 1SBIA 1S8AA 4JU8A 3WL6A 5LQKA 5JQGF 4IJ6A 5C5EA 1A1SA 1BU5A 1ND5A 1DT5A 5EIOA 1GUAA 3AVXA 2YXEA 2EQ5A 3C8ZA 4NHEA 2RGNC 1DGQA 4R9SA 5LWHA 1VRVA 4Z2AA 2ZUDA 3SDBA 1OLXB 3DV0B 3V5NA 1SQSA 3C85A 3ZTYA 3ZW9A 4BU1A 1FTNA 3KOZA 2XMZA 2ZEJA 4OHXA 2OV1A 2Z3ZA 3EGXB 5G0VA 5BNZA 2F48A 1BDBA 1AHNA 5CNIA 3ZQ6A 4EDHA 1LBSA 3TH5A 5KNCA 2IYYA 4LK3A 4E5SA 3A4VA 2WYVA 4OB6A 3WVNA 121PA 1UFRA 3LE8A 1QGAA 3IR5A 5J43A 3BL6A 3T8YA 2ZYRA 2A92A 3OE4A 3TR6A 4UC0A 2WWTA 2QY6A 3UMJA 2VJMA 2QUBA 5TX7A 2DUMA 2ZYWX 4LF9B 5IBPA 3HWWA 4ZOCA 2VHCA 4HCJA 5LYYA 1TUEA 2QQ5A 1BJTA 1RHQA 4N3CA 4ZVMA 5HHTA 1L7QA 1YH3A 1Z6ZA 2A0KA 1EE9A 3L8CA 1NULA 1MO4A 1XOIA 4FHDA 4H7PA 4LE1A 1X1CA 4O1MA 1OR8A 3ND7A 4GLOA 1W36B 1NFRA 2PU7A 2ZRAA 4BFVA 2EBHX 3OJXA 4IO0A 3W1WA 3AI1A 1YJAA 4YXWD 1M0WA 1Q19A 4IZ6A 4EH1A 1Q17A 4AF8A 3UT5B 4DCGA 2FMTA 3HXPA 4DA8A 1N2GA 5EUBA 4M9SA 4RC9A 2VRCA 1VI2A 4E15A 1MZVA 1V5FA 2OHIA 2P9EA 4Z3DA 3COPA 5LKRA 3ZDFA 1LUAA 2OO3A 5EPUA 1L8LA 3VSBA 3RJTA 1G98A 1SRQA 2R8XA 3TOZA 3Q6IA 9LDTA 3UANA 3R5FA 4UHCA 4WRRA 4D0NA 4EQ6B 5JVDF 1U7OA 4CTMA 3WBKA 2WYOA 5TQVA 3GHHA 4OGLA 1H4QA 3IOYA 1WEKA 3SOZA 4P84A 3EG9A 4N47A 3UENA 5IXSA 1MP0A 1ZSYA 2QUZA 2JB9A 1VJCA 1Z2NX 3A6HA 3DVLA 1J8QA 1R5JA 5IF3A 2Y68A 5FFNA 1U2DC 2WICA 2JFQA 5KTTA 3OOHA 3DZKA 4A8PA 3AY6A 2QG4A 3GJTA 4GOJA 2YVAA 3AFIA 2GJAA 5LDHA 3R7AA 1V47A 5AT1A 5AXDA 3GUUA 3LGAA 2VSOA 4W8GA 3NONA 3TQOA 4N41A 2DPHA 3QENA 4UZFA 5KOHA 1P7ZA 3HUDA 3IYLW 3DT6A 4B46A 1RVDA 3C3AA 2V0GA 4G09A 5GJWC 4A10A 3VKUA 1KY3A 1JDTA 5SZHB 4BLWA 1IN1A 3GJ6A 2CLHB 4Z9XA 1YMUA 1G4AE 5JAPA 2YIJA 1JHVA 3NT5A 3U16A 4RD0A 3LY5A 5TGTA 2IT1A 3K0BA 1AUOA 3EXG2 3O47A 4M86A 4B33A 1XL1A 2PUBA 2I2CA 1EPUA 2LZ0A 1UBFA 3PPWA 2PUFA 3ER8A 3PDWA 1II8A 2R4UA 4L8FA 4TQGA 4ZHSA 1ILWA 3W9SA 1KSHA 3ETNA 3N2YA 1NF8A 4TMTA 5FTKA 3ZJYA 3CKMA 2IYTA 2VRCD 5AW7A 4WOCA 2PO7A 5A02A 2NSDA 1QKKA 3CX6A 3DE2X 3BWYA 2CNLA 1ZZGA 1M2VA 2PQ6A 4X62B 1WBDA 2YH2A 1TO6A 4EMBA 4LQLA 1QGYA 2XT6A 3KQPA 1FL9A 3ZH9B 4EGQA 3HXQA 5FAKA 5A3QA 4K86A 1E5DA 2GN9A 5ALLA 3LRTA 4Q1FA 5F3RA 3EVFA 4LX0A 1SUEA 4V24A 1NVUQ 3DUFB 3JQGA 1DQZA 1ZUNB 1ZA1A 1DTSA 1NMSA 3C6ZA 2XMCA 3I1JA 1KQNA 3TTYA 2V7QD 1J39A 4FYHA 4PZZA 4ZJPA 1ZR2A 2VWHA 2AXNA 4LOJA 3O5AA 3A9RA 3DBIA 4RD1A 4Y0NA 3F6PA 4DIKA 3ND6A 3PXBA 1CUHA 4IIFA 4E33A 2BD0A 1PQYA 2ZXUA 3MT7A 3SEQA 5CT6A 4E2XA 2I4IA 1O6GA 1EUQA 3USES 2YZ7A 2XPCA 1LB1B 3GXBA 1QDUA 4PSKA 3KZOA 3DT9A 3K0EA 3NV9A 2ZDQA 2AZTA 2H4WA 4G65A 3ZWCA 4EKDA 5KC8A 4FKBA 3A1SA 3CPJB 1KF0A 5C1OA 1I8TA 3IP7A 4PC1A 1CJBA 3A4MA 1EP9A 3THSA 5IEJA 1Q7TA 1ZK2A 5JDCC 3FWZA 4LRTB 3IBGA 4AT1A 4LFBB 2VSYA 2XH8A 4KQEA 5EP3A 2EL7A 3AVYA 5BQ3A 3D7KA 2Z6VA 4L08A 4M88A 3B1YA 3VNRA 4WZAE 3LXMA 1NV9A 1CF2O 4U6QA 1JR3D 1XP8A 2O23A 5LCXA 1GPWB 1NATA 2XCIA 2I2DA 4FINA 4IX1A 4D0LB 1L7BA 2QTFA 4A91A 5LP6F 4HAUA 4RETA 4C6TA 4I55F 4KXWA 1UKZA 2LVBA 4DV5B 1E1MA 2WUWE 4V1CA 2HYDA 2R97A 4DSOA 3CLHA 1NASA 5JCJA 3O3OB 1W29A 1WZEA 4DV0B 2UDPA 3GJRA 3IQGX 1JKFA 4JD5A 2YZGA 3H9GA 2PJZA 4LRWA 1IBRA 2NOAA 3OETA 3PHCA 1X7YB 3AF3A 3GIWA 2XUOA 1PT6A 1GPAA 4CF4A 4KPUB 3HZOA 5BR4A 3BXXA 5ENZA 4EY8A 1VIDA 2C4UA 2RHBA 4YACA 1E94E 1BWPA 1NMXA 2ZYUX 3PIDA 1FZTA 3SLGA 1FLVA 1CJKC 3L07A 4O4LA 1OT3A 2UYYA 4KMRA 1JAZA 2AQHA 1PFGA 4W6QA 1J1ZA 3QLUC 1W5FA 3JZMA 4IIJA 4G0PA 1KAOA 1TEZA 2N47A 5KHLB 2C42A 1YKGA 1IHOA 2GD2A 1AK9A 2WTMA 3D43A 3HCCA 2WJPA 3KPJA 4O2AF 5FBRB 3V2IA 4IUBS 5JOQA 1LH0A 3IAFA 5JTUA 2DFPA 2QIPA 3GOQA 2CDCA 2OXRA 1GCUA 2XIJA 3DVSX 1NNUA 3MS7A 1UK9A 3AOEC 3STYA 5J2TA 1CCWA 4BE9A 3PV0A 4MGKR 1OZ0A 4QARA 1UAAA 2PH5A 3KJZA 2LKCA 4MIEA 2IDMA 4TKLA 2NV2B 3GDHA 4LPKA 4MI3A 1LX6A 4X97A 1N1GA 1JU9A 2AD1A 1A27A 4AS2A 2Q41A 2D2FA 3ROKA 1DTWA 2GYUA 2OL4A 2Z2IA 5DMXA 5FAXA 1AGPA 4RHEA 2B1GA 4HGNA 3RSOA 2JKVA 4OL9A 5HIJA 2JI4A 1R0CA 1ISFA 4YCDA 4WY5A 1H0KA 2KM1A 5AMXA 4B4KA 2GPSA 4K9SA 1SD1A 1M8JA 1EGQA 4UHFA 2CL7X 5D6NA 2SICE 5JCJD 1PNRA 5EIHA 1CQPA 3JALA 1I5OA 1U3FA 2Z2KA 1ZBQA 3AC0A 1X1RA 3QLJA 3OCZA 5DHAA 4FWBA 3TOSA 1ZMBA 3E7WA 3TTWA 3UKOA 2Q3JA 2VK2A 2WUFA 3JARB 4I9FA 1A5SB 2BHLA 2PX3A 2VNHA 3GP3A 3PZBA 5AYVA 2G4LA 2KS6A 3KUXA 1PV2A 5E7QA 4U6SA 3DLBA 4C7XA 4OQPA 4R71A 4G97A 1N4AA 1IJFA 2QGFA 5I7UA 5K0GA 1WXXA 3THXB 4RAQA 4YROA 1L7PA 4HEA6 5M04A 1DIHA 2ZATA 4FX2A 3DW1X 1X7WB 4IIEA 1M8PA 3FCOA 2HLPA 4LXUA 4TTAA 4C0LA 2G0NA 3I2GA 5FH9A 2IOHA 3CEMA 3EHEA 3MG9A 5LP6A 3CNNA 4YQEA 5FI3A 1M1YE 1L5VA 2XGSA 4QXPA 3HYCA 4TUYF 3GQVA 4U9HS 5HBRA 3VR2D 4HNTA 4K6GA 3TIFA 4NZPA 1BQ3A 3PQ8A 1YC5A 4HAIA 3R8XA 2FEKA 2FMXA 4R1NA 3ZUPA 2E18A 2ID8A 2R87A 2OCLA 1L1RA 3U61B 2UXCB 1JT9A 3D5QA 3HDVA 3RF7A 3A1DA 1OXMA 5DH9A 5KI6A 3LDUA 4G4IA 4AXBA 3W2IA 3E5MA 4HVTA 4JYPA 2WHRA 3E7XA 1XEWY 3IXQA 3ZBPA 4HATA 2WJ6A 5AWFC 2NO7A 3SJBA 3W8EA 2DVMA 1I33A 1GPDG 4OXXA 2I8CA 3CUWA 1CVIA 3RQIA 2ZTUA 3H1BA 3ANXA 4Q1VA 3T41A 1WB9A 3NVMB 2FR8C 1LC3A 1QTRA 4HB2A 5EXPA 3VAYA 3DVAA 4LDJA 3NX4A 4GNKA 5DOZA 5ALWA 3GFRA 5K2MA 5DM70 4JKIA 2Q7XA 4FK8A 1SBQA 2O8DB 2EJBA 1O6ZA 3OZRA 4I4TF 2OP1A 3C5WP 1MC5A 4RA9B 3DWIA 3T94A 3X1DA 4CM9D 5TPZA 5ER9A 4M9CA 4O4HF 4CV2A 3R9WA 1E9EA 3CEAA 2FW7A 5JS7A 4G5FA 2FUG1 1B2RA 5J3JA 1SKMA 1H23A 1K7YA 4MIYA 4LWOA 1U7DA 2C7QA 2Y9PB 1M33A 5CLJA 4TLMB 4D9MA 4ZMRA 4MO2A 3ANYB 1Q14A 3ZZNA 1CU1A 1FP1D 3V4LA 2WU8A 2V7XA 2BMJA 3NVDA 2JHGA 4M1EA 1J23A 4HRYA 4MUFA 2E7ZA 5AKEA 5E6RA 3ZD8A 2I4LA 2QRMA 2VJDA 4GMFA 2BRUC 2DHEA 3EQ8A 4NVRA 3LYUA 1F5NA 1EZ4A 1NF2A 1MC4A 1Q0SA 4Q7JB 3JQRA 2P77A 5B58C 2FWIA 2RGNA 3B6KA 4FOPA 4J4TA 3F46A 1P9LA 2C0PA 2H08A 4EUHA 1U5BB 3RVSA 2COEA 4GMHA 3DMTA 4Y30A 4GPBA 4PG4A 4HDSB 1W4AA 4EPRA 2D1TA 2CDNA 2DWPA 2C5AA 1YIDA 5COAA 1C5KA 2WKPA 4RZ2A 3RJ5A 1N2CA 1KVSA 2WM2A 4KODA 1LVHA 2GVNA 2P4UA 5HZKA 3FUXA 4XX0A 2ZLBA 1SVLA 1AZTA 3AONB 1C41A 2IOYA 3E9DA 1JAXA 3L82B 1TJ3A 1VLJA 2FZLA 3P2JA 4XB1A 5IAJA 3T4XA 3X2SA 5KX5A 2DMRA 3ZDCA 2XUGA 3TW8A 2ZPAA 4P7FA 3N1UA 4IH1A 1NJ5A 2E89A 1UC5B 1ISRA 1JHQA 2XA1A 2UYGA 5JADA 3WA7A 2W8BA 4RJLA 4AIRA 5JQWA 2X5JO 3H4IA 5BUZA 4L0QA 1QGDA 2WQ7A 4ARAA 1Q22A 1P0FA 3NPAA 5B1YA 5AK0A 1UJ5A 1BDIA 2YQ5A 3QOXA 4DYVA 3N86A 4OJYA 4EECA 1I4WA 2PH7A 4LMPA 3LBHA 4Z4GA 4MS1B 1TCUA 3IQFA 5D5PA 3W8NA 3EXAA 2FPMA 1XV5A 1NXQA 1YHZA 2O4UX 3EH1A 3U7HB 3KYCB 1DG1G 4TL8A 5FBKA 4DWJA 1XXHB 2PUHA 4MIOA 1PQPA 4KBFA 1BCSA 4LDPA 3VH2A 2WB2A 1USVA 2A9VA 5I5GA 2YDXA 1ULUA 3PUJA 3IPXA 2G17A 3UQYS 4H2DA 1EVLA 3K6JA 2PR2A 2JANA 5E95A 2FN8A 2ZT8A 1FX1A 5HIMA 1YOVB 3CNBA 3HCEA 3S3TA 3I64A 3KYJB 4KFSA 3GLHB 3T7IA 3V4VB 2RAVA 1L4LA 2IGBA 1ARZA 2BFCB 2P9HA 2SECE 4LTDA 5ECWA 5A5EA 3TPFA 4LAFA 1LRLA 2WTAA 5EYPB 1RD4A 1RAAA 2PJRA 3JQBC 1KS2A 5AVYA 3TKYA 4CR8A 4I55A 13PKA 1IOLA 4CKXA 1MO2A 1WSDA 1M6YA 3TRIA 2FG7C 4RPLA 5EMMA 3AJ8A 4C7VA 4ENQA 3E9YA 5HILA 1B7GO 4I1YA 3MK31 3BXPA 3L6OO 1K3TA 1G6KA 2WP0A 3GFPA 3O4GA 1ODJA 2CNWA 5F7JA 3R9IA 2OD9A 3DZJA 5AHKA 1JFFA 5KYWB 4EHBA 4CCSA 4J0QA 3U7GA 2V5AA 4E0BA 3LM8A 1CY6A 1L8XA 3IUQA 4X71A 1Y6ZA 3MMZA 1OV4A 4IY1A 2PT7A 1TTTA 3HH8A 1C7FA 3RYTC 3EARA 4RPHA 1WXDA 5IYZA 2B35A 1LSJA 2ZE5A 2IODA 4B6GA 1OYYA 1EBUA 4TWRA 4CVNA 4RWZA 5AKKA 2Q0HA 2AR0A 2Q6LA 2WUVA 1E3WA 3KEGA 5I4BA 3SF8B 3A0RB 1XNHA 3LOUA 5KSYA 1XPJA 1UMCA 2BEUA 3WB2A 3UMGA 5KYTA 4DY4A 3KUUA 4IGIA 1YU6A 1X1TA 3MRXA 3CWQA 1Y1KE 4Q05A 5JR3A 4B7ZA 4RTMA 3W9BA 1EDDA 1LFAA 2FCAA 1N1MA 1UOPA 4P38A 5KJEA 3IE0A 3S2SA 1GDHA 2GI4A 3VSAA 2FEAA 1AN9A 2HU8A 2QM8A 4HGPA 3TXYA 3MW8A 5CLHA 2AN9A 3C48A 5KYXB 4UJ5A 4E5UA 1B76A 1N3BA 1X19A 1JZTA 2B7LA 2QV0A 2XMSA 4QXAA 1ZH6A 4TTJA 3ZK7A 1TECE 3AUJB 2R6ZA 3KT0A 2MINA 4IDPA 3BDIA 1RWQA 2ZWOA 1P1IA 2VP2A 3M4YA 2ZJBA 4K03A 3BD8A 2G5PA 2PXHA 3I39X 4OB7A 3R74A 3U6KA 3I9V6 3G1TA 3M82A 3URKA 4A0HA 3TZHA 1NQ5A 1SK9A 4S24A 4OYHA 3QEAZ 3R3YA 4KLRA 5IJ9A 2CNWD 3OD1A 1Y8QB 4K9MA 4RTNA 1YR3A 5E9QA 3CVYA 3CZMA 2EZ8A 3IPCA 3AM4A 1DO8A 3TOXA 4R1PA 5IT9A 2VPPA 2YRWA 4DN6A 2WWIA 2BMVA 4KYUA 5K1ZA 3VOTA 5H68A 2D1FA 5EEGA 2EOAA 3QE0A 3DEIA 2FP4A 3M1AA 3K4QA 5K3AA 5BYKA 1GR1A 1I7LA 3H04A 3IAAA 1MGPA 3ROGA 3TOCA 2CXNA 1LLQA 2R68A 2G70A 1VSVA 4BJ1A 3RKRA 3VPXA 3BB3A 4PAMA 3T15A 4LG1A 1W1IA 2DTDA 3I37X 1EQUA 4TUYA 1WU8A 2NYRA 1Q57A 4Y7CA 3S8MA 6ADHA 1SPBS 5DYWA 1ZLXA 3FNQA 3GZNA 2NUBA 3KOWA 1MIOB 3N8HA 2QN7A 1WEHA 4NCBA 4PO3X 1BHJA 1TQ8A 5F73A 1XTSA 3AUAA 3FE2A 3RC9A 1RYNA 3A9TA 3I9JA 2ZUUA 3UV3A 1RJFA 2JJ1D 3VKFA 4NBLA 3U48A 4PBRA 2YJ6A 3PXAA 3IV9A 5DHPA 4HRXA 4Z4QA 1OIWA 3DUWA 1IMJA 1LQTA 1SG6A 3G2JA 4X20B 4CTOA 5KYUB 3QLUA 2GCGA 5CLGA 4W1RA 4YRSA 3AM3A 1NUPA 4P7BA 3IB3A 4XSVA 4QUAA 4R41A 4DLBA 2EYUA 5CDUA 1NJ6A 4PCLA 5KSWB 5I51A 3PNSA 4XYGA 4A03A 3W6ZA 4MV7A 1DKNA 4FBLA 4BFTA 1IXRC 3A6DA 3NUQA 1HNWB 3FOZA 3C3JA 3SVLA 1WR8A 2PL1A 1V48A 3QX7A 1AHHA 3T52A 1VLMA 1HT3A 4G25A 4Q66C 4QAJA 3IAS6 4BKQA 2BEWB 2Y1DA 1Z68A 1FRVA 2X3UA 3MJRA 5HOQA 3DFKA 4TRMA 5EE0A 3SFVA 1QE3A 4WX2B 1CZHA 1UEJA 5DBGA 1BKSB 1K6IA 4JL6A 3H17A 3DDCA 3WK8A 3OMLA 1D6SA 1T1JA 4OGFA 4DVJA 4CZ2A 2CXQA 1KYVA 1O9GA 1RWPA 2BM1A 2GZSA 1IPEA 4FCCA 2QIOA 3IILA 4ZI3A 1E59A 4TVOA 1OLOA 2PUCA 5HBGA 4Q34A 2WSMA 1XJ5A 1O87A 3K96A 1IB6A 1ID1A 3FN4A 3FNFA 4LRUA 4CU5A 3QBEA 3B6MA 3JYNA 2VF4X 3HCWA 2VBGA 4L3VA 3EBLA 2R3SA 2C3OA 1XEFA 1FP6A 1RRPA 4UD6A 3QMPA 4WNAA 5DGDA 1V37A 5T4BA 4LZJA 4DJ5X 2LCIA 2EP5A 3ZHTA 5AW1A 1MR3F 1NR5A 1YIAA 3ZCQA 3ZCUA 5FI0B 4NFSA 1QIGA 2FA9A 2JIOA 5HTOA 4MVJI 4MYDA 1ZVQA 2I9KA 2WIGA 1BCRA 1AUXA 1XMIA 4W1QA 4BKUA 2OFWA 5CNMA 2OPHA 1FZQA 1V16A 3UJPA 1OFUA 1VSUA 4HHEA 2H7VA 4DIUA 1M7HA 5CCEA 2FTKE 1FY2A 1XDSA 4QBGB 2CMFA 1VL8A 2PTHA 3N7UA 4XA8A 4F46A 2Z9DA 3D6FA 2ZQ5A 5JH7B 1BDMA 2OXEA 2XNKA 3SHQA 4UM5A 2PXCA 3EC2A 4BQSA 1JALA 2EW1A 1FUEA 4XCVA 4O3MA 3EGVA 1PVDA 4J0KA 1WW2A 5BYBA 5I01A 2ATCA 3HWX1 4TM7A 3RIYA 4OHOA 1VKOA 1FSSA 3LTNC 1FFGA 2CUKA 1C8VB 4OCZA 3UHFA 1CS4C 1HDIA 4WADA 5GV7A 4L9SA 3T3IA 4RQUA 1PQ4A 2Y1FA 3BWVA 4CM5A 1QM5A 1I4OA 3VAAA 4W7IA 3CB4A 3N6RA 1AUVA 4WOPA 1M2GA 3MS4A 5J1SB 1AQYA 1U3VA 1Y1RA 1YFZA 2ENWA 2FZEA 2YFHA 3AI3A 3RHFA 5CAEA 2P7HA 4KZKA 2UYQA 3OLVA 1NBIA 2Y8EA 4GICA 3PFWO 4WESB 5DLQC 4KB5A 1QC5B 2JAWA 3DOFA 1BROA 2FR8A 2JCYA 3WA6A 1MOSA 3AY7A 4WN3A 3VOAA 1FTWA 4LI0A 4OK5A 1GNLA 1N6NA 4GD3Q 1AUPA 4IOKA 1CUBA 3SX0A 3K6SB 2WFMA 3V8VA 3OIFA 4PNPA 2JFGA 2BGMA 4ZAFA 1LDGA 1M0SA 2CVPA 4OH1A 2JFVA 1OI4A 4HEQA 1BGXT 3GFOA 7REQA 2E6UX 1CBUA 1XRMA 5JJBA 4ZAGA 1O57A 1SHUX 1TA4A 4BMDA 2V1UA 1IY8A 4KHPB 2QRNA 3PL1A 1XKQA 4FHCA 4XQ9A 2QV7A 2HSJA 2VH1A 2OCBA 4CMIA 1XEAA 3N6XA 3UWDA 3HXTA 3F9RA 1OI2A 2HLDA 5LYJB 4II7A 4GFDA 5CT8A 4OAQA 4IH9A 3TNLA 1G5QA 1L3IA 2BUCA 1XKXA 1ENOA 1N2EA 4E5PA 3QUTA 2XVXA 1BH6A 2BRUA 1AHIA 4YT5A 4Z0HO 1KFKB 4UHBA 3ZGVA 1XLWA 2IYEA 4MWDA 2Y6UA 4NOMA 1Y5IA 4QO8A 5G41A 4UU1A 2G08A 4CLEA 4D56A 3UJ3X 4M1TA 1WXIA 2XYVA 1YA4A 2QLFA 1BZYA 1O6BA 4WBXC 5LNK1 4HNQA 2ISQA 2RH4A 4XLZA 1TK3A 3OWOA 4EHJA 2DC1A 4BVEA 4QYIA 4CLXA 2XYPA 3QVMA 3O92A 3RVNA 5FUBA 1W1WA 3QBVA 4K9OA 4K40A 4QOJA 3IEPA 3JYHA 3NHKA 1VJTA 2I54A 3D8BA 1G5TA 3G5MA 1AQNA 2YYZA 3NUGA 3OCUA 4HT3B 4FCWA 1HETA 3KLOA 2TMGA 2BE9A 1OLUA 2G77B 2OBFA 3QHAA 1DKMA 3RFVA 2UXDB 1LJUA 4FOLA 1NE7A 1W59A 2GZMA 3I5MA 3IAM6 1I3CA 3PD0A 4BNLA 3SQDA 5B1HA 4C0AC 2FKNA 1N6HA 2QR5A 1GCIA 1DKRA 2QTHA 2AN4A 3CJTA 3F8TA 4QFBA 3RJZA 3TCNA 5IBCA 2UV8A 5JXJA 2QSYA 2NUAB 3DWGA 2WK1A 2CL5A 1SZJG 3OPMA 3DULA 1F6BA 1BH2A 5B1DA 5D5HA 3LX5A 1UBGA 2CL0X 4FGSA 1CNMA 1RZRD 3BTVA 3C8HA 4BBJA 3W5AA 3ZD7A 2WUGA 4AJIA 4LV5B 4U2DA 1GFIA 3DBRB 1GPYA 1EXWA 3I2JA 3ILXA 3M6WA 3NBMA 1DAKA 2PAFA 1NVBA 1R6XA 1X39A 1EWTA 2LCFA 2XE8A 1JWLA 5DK4A 3SJZA 1LLFA 4GYKA 1SHTX 2HIGA 3EGXA 3GRZA 2OAGA 3A04A 4B83A 3HXKA 1YOBA 3FWKA 3L5KA 1C9EA 1NKVA 1QAOA 4JB8A 4WLUA 2O48X 2ZB8A 5DSXA 4C2UA 1NYQA 1ZP6A 3NDPA 4RIHA 1TL7C 3WLNA 2HA2A 4PZDA 5E1BA 2IEBA 1EJBA 4X8HA 5KCMA 1T8PA 4KQXA 3A27A 5DLEA 5AI0A 5BNFA 4Q4AB 1G8AA 5DZSA 3T3GA 3INGA 4MJXA 3C1OA 1WSAA 3PYLA 4QRDA 4DLKA 2XADA 2ZTMA 1W0KD 2W2LD 4WIAA 3PUWA 1Z17A 3HG7A 1FLNA 3I01M 4FM9A 4ND3A 1QXSA 3VNQA 2OGTA 3C15C 3DNFA 3HDJA 5D85A 1EB9A 3TQSA 5JQGB 2VP9A 1P4JA 4J7UA 4UMEA 3CCBA 3RNLA 3H5WA 4L6CA 3C0KA 3WGNA 1B74A 4AQ7A 2BR4A 1NRXA 2YOHA 1PZNA 1QE0A 3WKDA 1IN4A 1T9DA 2XCLA 5CURA 1NQAO 1NXTA 1GIAA 3EAFA 3GYGA 3BM5A 3N0VA 2HHLA 3AJAA 1QJ4A 1VFPA 3FNIA 4X0EA 1YE3A 3R7WA 4XWTA 4C4OA 2JAHA 4ZDJA 1CD5A 2I78A 1TD9A 2QKYA 2ROQA 4BJHB 3H6GA 4M21A 5K8UA 5L3SB 2DRIA 2QVYX 2PSSA 3J7TA 1PWZA 4FFLA 3GEPA 1E2JA 3E6AA 1K8ZB 1L8OA 3KQLA 1G3UA 1VKRA 3CUYA 2B8WA 5K6AC 2EJTA 3UMMA 1RBZA 4PCUA 1UFQA 3U80A 3E9ZA 5K8TA 1DJPA 2VS1A 5ALXA 2EFJA 3EPLA 2AHOA 1TKAA 4F71A 4ZPXA 2DWOA 1T26A 4R6WA 4K7JA 2A6PA 3JRWA 5K3DA 2OO7A 1LC0A 4I1SA 1TJYA 4FE3A 1TQHA 2FW1A 2C3UA 5KVQA 1U5AA 2X0IA 4BVAA 2ZAGA 1TEVA 3CR7A 1W44A 1BMQA 1DJOA 3R41A 2DOKA 1K86A 5EZQA 2HWWA 4M54A 3DLIA 3E9CA