4ZZ0A

Human gar transformylase in complex with gar and (s)-2-(8-(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)octanamido)pentanedioic acid (agf147)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Enzymatic Analysis of Tumor-Targeted Antifolates That Inhibit Glycinamide Ribonucleotide Formyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Trifunctional purine biosynthetic protein adenosine-3
total genus 66
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4zz0A00
2FMTA 1RBYA 3O1LA 4ZZ3A 4ZYUA 1C2TA 1ZGHA 4TT8A 1MEOA 1JKXA 4EW3A 1ZLYA 5CJJA 3R8XA 3Q0IA 4YFVA 1NJSA 1FMTA 4IQFA 3W7BA 4ZYXA 1S3IA 4TS4A 4ZYTA 1MEJA 3KCQA 3NRBA 3OBIA 1RC1A 4YFYA 4R8VA 4Q12A 4PZUA 4ZZ0A 1MENA 1GARA 3P9XA 3TQRA 3AV3A 4EW2A 4ZYYA 2BLNA 4S1NA 2BW0A 5J9FA 4ZYZA 1RBQA 3AUFA 5J63A 1C3EA 1CDDA 1ZLXA 4ZYWA 2YWRA 2CFIA 3DA8A 4NV1A 4QPDA 3TQQA 4DS3A 4EW1A 2GARA 4ZYVA 1RC0A 1GRCA 1CDEA 4TTSA 1YRWA 1RBMA 4ZZ2A 3GARA 3DCJA 4QPCA 3N0VA 4ZZ1A 1RBZA 3LOUA
chains in the Genus database with same CATH superfamily
1E2NA 1Q3KA 1TM2A 2CKDA 1PR2A 2H9AA 2Y9MB 3E3NA 3KQVA 4GR9A 3IEPA 4H7HA 4N5LA 4OPMA 3SYNA 5AUOB 1OXMA 1DAFA 1NONA 5HRAA 2JGDB 3QUCA 3CMCO 5JATA 2BJHA 2AKAB 1EMDA 1PG2A 2FG5A 2PBFA 3WZ2A 2YS6A 3DBRA 3N7UA 2F2TA 3C3WA 3AEUB 2W2PA 1UZAA 1YRYE 4L1KA 2RCNA 3SS9X 4RTSA 5BRJA 1SM4A 5KUTA 4HL6A 4YMGA 3ZJYA 2I4TA 2O14A 1QP8A 2PX8A 4JQCA 3D5QA 5GZ1A 1M2HA 2PXAA 5FNZA 1M1YA 3JR7A 5DXAA 3OQ1A 1F4LA 5KYXA 1KOFA 3P20A 2OHHA 2QTLA 2HW8A 1Z13A 2WMDA 3OCXA 2EIXA 1KORA 1LDMA 3NTRA 1T9GR 1LLCA 3L4BC 1ORVA 2X1HA 3AL3A 3A9VA 3LZCA 2IYZA 4KYIB 2Q27A 3OJWA 2VP3A 2WWIA 1J24A 3L77A 5D3MB 3QIAA 5KSOA 3MMXA 4FHZA 4BVHA 4ERNA 1HSZA 3A1CA 1UC9A 3CR3C 3HYCA 4FEGA 3PE4A 1BX3A 4BNDB 4UM9D 1JDJA 3K30A 3H9JA 3A31A 1NBWB 1QF7A 4RJLA 4YS6A 5LBIA 5CW1A 4BP1A 1MT3A 1ZHFA 2GCIA 3C70A 4O2AF 5BXYA 1VRCA 3HVHA 4OB7A 3PFCA 3SLGA 2QUJA 1Z4OA 1K27A 2F3TA 4MVJE 4M22A 4QDJA 4TV8F 1KC3A 3UW3A 2QLBA 1GQ2A 3HGMA 4KWHA 4PLZA 1WHSB 4B9AA 4BDTA 4YRBA 3IDAA 2JAUA 3ELUA 5F9FA 3AJ8A 3BORA 3ZDZB 2I55A 4MO9A 4R8MA 1TZ2A 3N74A 1I30A 3SBEA 3OEEA 1O6ZA 3NXSA 3ESZA 1IZ0A 4CIVA 2IU4A 2I2DA 3RW9A 4ON9A 1UM9B 2XB2A 1LRKA 3C7TA 1PT9A 4HUTA 2BSQA 4XLZA 4L57A 2CHEA 3QVVA 5A71A 3ZCVA 3MXTA 1TPZA 4ZCMA 2GZHA 2VL7A 4BRZA 2VZLA 3T9CA 2XIJA 1WE2A 2JCSA 2NPIA 3X1WA 2GF9A 2GHIA 1J06A 1SKAA 1UOOA 2CLCX 1XWFA 2FPGA 2G63A 4RM2A 5A3RA 1N32B 5AKKA 5BQ3A 4X20A 1O95A 2AOUA 2WOJA 3HI4A 3D7SA 1TT5A 5DEOA 3OOSA 5EZYA 3V2GA 4FDAA 2BEVB 4JFAA 2O59A 3H8VA 3LWNA 1AQIA 1AO0A 3SJUA 4Q7LA 1K5DA 4CMIA 4CDNA 4HY3A 4KFSA 4H77A 2IEZA 5DCUA 2NX2A 4D8TA 4NBSA 4NULA 2O19A 3IYLW 3L1JA 1KARA 5C7LO 4YJ3B 5K4GA 4IIFA 1JRLA 4OK3A 3NR2A 2F4VB 1O8CA 1NBMD 2DPGA 3LF1A 1QGZA 5IH3A 1ZVVA 1V9SA 3U19A 2X4DA 1WQ3A 4L8FA 3BG5A 4US1R 5I8WA 1D4ZA 1DQRA 3WWOA 2QAGA 3KPJA 1ZGBA 3O9VA 3HLKA 3PHHA 4FDTA 4U7JA 1NASA 1DVRA 2EFHB 4IIEA 2BKEA 2EWVA 3W5DA 1H42A 3OZWA 5CEEA 1XU7A 2WKSA 1ZUIA 2VTKA 5KOJA 1DQPA 4YRQA 3T61A 3SWWA 4JJ7A 4QDUA 1R0KA 1BS2A 1FYEA 1A5TA 3SEFA 4LXXA 1VFPA 1FQJA 3DS8A 3I42A 5SICE 3DUWA 2E4UA 4EX6A 5B1DA 3HWSA 5JNUA 2CHQA 4M9XA 3RJ9A 1C9EA 1WF6A 4KAAA 4BOYA 3L8HA 4KL8S 3ETCA 4YCNA 1MG0A 2E37A 3ANXA 4BCDA 3QPAA 2JAWA 2QX8A 4H3VA 2ATIA 2EFGA 1IY2A 1RWKA 1NQWA 4GYWA 3BZUA 4B5KA 5AUNB 2XUHA 3P2KA 4I3GA 2X0FA 1ZSVA 1DHTA 3UM9A 4DAOA 3HDGA 1XQVA 2RGGA 4IHJA 6ABPA 1JR4A 1XMXA 4O0LA 3DLHA 1RYEA 1XHEA 2F90A 2OYCA 2MYPA 4B76A 3AT1A 2I22A 1V5IA 2O54A 1LBQA 2PKYX 4GYKA 2FPUA 4MGHA 1QPGA 2ZUDA 4JY7A 4BPBA 3ML1A 1ZR2A 1U0OC 3C4VA 3DQZA 3FTQA 1YS2X 4J1NA 3IR6A 4YLGA 4LAFA 5BT8A 1Q20A 1RYFA 3OJXA 4QXMA 4RGVA 1TC2A 2XWJI 4U2FA 3WIUA 4B7UA 5HIIA 4UNSA 2JFGA 1I7SB 4O8ZA 4XB1A 3G79A 4ER0A 2WF8A 3U4AA 2H0QA 2R6ZA 4NZ9A 2WIAA 1RMTA 4TVSA 5GV7A 4Z4FA 5FWXA 2VUSA 5BSTA 3K5WA 4OH7A 2NXJA 1Q17A 1Z34A 2NSHA 3ZIAA 2OY0A 3ZQ6A 2Y1FA 4QNNA 1AKYA 3AW9A 3WSVA 5JD4A 1ZPDA 4IW3B 3KT8A 4NCHA 3I9V1 3NKLA 4NKRA 4H0FA 4UU1A 5FPSA 2DHQA 2VHQA 3ZWCA 4XOUA 3WX0A 5B53A 4L02A 5JO9A 4LFAB 5KREA 4BRWA 3T3DA 3U4HA 1XIVA 1QVVA 1APBA 4B3RB 2D0PB 4DJDC 1PR9A 3LXMA 2YY6A 2KM1A 2P27A 4WA7A 3DMRA 1DIAA 1W9HA 3NTOA 3DMTA 5A2QA 5EA2A 1CQIB 1VYHA 2AVDA 5ES3A 3EVZA 2VDWB 1OLXB 1QFXA 3FSRA 4QXOA 3E9ZA 1WA5A 5CDYA 1XG5A 2YC2C 3GVPA 2P0YA 2GBLC 4Q93A 4RVGA 4Q4HB 2I4MA 1UANA 3EXAA 4LBZA 4FYVA 3NIBA 4RL6A 4BNYA 1V5GA 1UJ2A 3LHSA 3IOEA 3ESQA 1LJUA 5EP1A 1RQNA 4AY6A 1YU9A 2H5EA 5JQGF 2O2CA 3LDFA 1ZEMA 2JIZD 2I7DA 2FPIA 2J33A 4I9GA 3K8OE 3DONA 4K40A 4UBMA 5TQVA 5HYVA 1QB7A 1U7UA 4HAVA 1J0DA 2ABWA 2WDPA 1B3BA 1JBKA 4WE3A 3JW8A 4KPFC 2GKSA 3GAFA 2EP5A 2VJPA 2B78A 1IMJA 1P8JA 3L8GA 5FI5A 5CVDA 1SA0A 3KXKA 4D97A 2WD7B 2OLJA 1XL1A 4RESA 1Y7IA 1ZHHA 1FDRA 5M3BA 3IXMA 1NHWA 1W88A 3CURA 3HDVA 3R7WB 3LDAA 2ZSEA 1GPWB 3H5IA 3FWNA 3OX3A 4G56A 4C5AA 3U3JA 4QTUB 2X6QA 2BTEA 1HZZA 1X7WB 3UOAB 2DUJA 3RHTA 4KTVE 1IQUA 1XJ0A 4P7GA 1X38A 2NPOA 2JDIA 5ED4A 1RJWA 2FEWB 2F00A 3FOBA 5LKRA 1R0WA 4N5MA 1DS6A 2QGZA 1M33A 1TCBA 4UAVA 2WILA 5EE3A 3VZSA 2IYEA 3GYBA 2CK3A 2VT7A 2ZRBA 4KBFA 4LDAA 3TNYA 1IN8A 1P4JA 4IH9A 7MHTA 2B20A 1VLJA 4Q3KA 1EDDA 2Z9BA 4MB0A 4E2YA 4NIMA 3A6KA 5IK2D 3QWAA 1RPZA 1GL6A 2DY0A 4G0UA 2X19A 1E1CB 1JPNA 1Y9JA 3GHYA 1P0FA 2YRWA 3MBKA 6NULA 1WTAA 2ZRMA 3PENA 3RUDA 3RH0A 1QOZA 3FBTA 5DB4A 2FF5A 1FS4A 2UAGA 4FW9A 2VAMA 2VDNB 5A5EA 2Q2WA 1TTQB 2J0EA 3UK2A 3E23A 4NENB 4V1CI 5J2UA 4OQDA 2Y4OA 2ZAOA 3SAJA 5DULA 1I2DA 1FSSA 1L4FA 1NM5C 3CWZA 5FL3A 5I45A 5AI6A 3C41J 2C3UA 3Q5DA 3ZD7A 5ED0A 1CS4C 4YBRA 1XEXA 4KMRA 5H02A 4DJ5X 2ZETA 2VOJA 3I9MA 2GFIA 3HA7A 2IFTA 1EVZA 3LFHA 3A6EA 1LK5A 1QIFA 2ECKA 1KEUA 5IDYA 4ODIA 1M8FA 4EUFA 3V55A 1XTUA 4FXOA 1N1GA 4Z7NB 3KG2A 3TD2A 1EE9A 3C6MA 5DBEX 4AMBA 1XXHA 2HJHA 2IIBA 4M9ZA 3AUFA 2Z8XA 1OBOA 1FMJA 2LWIA 3GIWA 2X5NA 1I36A 4MW1A 5K45A 2Y93A 3PDWA 2EKPA 1UBFA 3ZEIA 1CP2A 2H48A 1DV1A 1MA0A 4GT1A 2HXGA 5D5QA 1N33B 2IPXA 3AXSA 3OA0A 3HBAA 5JYEA 4G2NA 1R16A 2ZTMA 3KEGA 4FGKA 4R9VA 1JB9A 1YDHA 3PPVA 1N4AA 4E5YA 1L5HA 2GRUA 3IULA 3ORQA 3Q3GE 5FUBA 4AUKA 3QOWA 5AVVA 1F4VA 2JFOA 1NJGA 2EKBA 2QZSA 2GS9A 3G2LA 3KEOA 5HUQA 3TQRA 2EEPA 5DHAA 4YRTA 2FVYA 3DVLA 4LV6A 4YASA 3OCZA 2FHSA 2Z95A 4MWTA 2R84A 4R71A 1VE9A 4LNAA 4J6FA 1DBVO 3P2EA 2H65A 2IYSA 3H2BA 1NLMA 1VE3A 1PK8A 2P3QA 2ZVDA 4LF8B 3MMSA 1NW3A 2N0SA 1VB5A 1V9CA 2XDYA 3AP1A 4U5XA 5EP2A 2O4UX 3PYMA 2A4KA 5TT1A 4CLEA 5CXQA 3HCNA 3IALA 3ZXIA 4M1MA 4N3GA 4FKBA 2ZUCA 1SCNE 4RTOA 1ILEA 3PUVA 3V80A 2BR5A 1A5AB 3DZDA 4CF4A 5TR9A 4N8EA 1J8FA 3HBLA 1A2KC 1XTBA 1ZXXA 5E9AA 1Z07A 1FMLA 3WQQA 1J22A 2PWZA 2O2DA 2QE7A 3I6BA 4GI7A 1DMRA 3ETLA 4YP1A 3KKPA 4EZEA 2ZT7A 4Z49A 3U3RA 4UHCA 1E96A 1ICIA 4OUDA 3I04A 2OCXA 4M9QA 2B2XA 1H1LA 1IUKA 2Z5LA 4OQYA 2P3SA 4WNCA 5E0OA 3EIQA 1IN5A 2O1EA 3AR3A 3GRAA 4ABYA 5LP1A 2W6ID 3CCCA 3DE4X 3K70C 2H31A 4CM5A 1Q1EA 4CR7A 2V6GA 2NTEA 1GRVA 4L0QA 4JI1B 2UXDB 4UW9A 3SVLA 1HWYA 5JZ9A 5HS4A 1MHPA 1BYUA 1F8YA 4HN9A 1Z5OA 3T1YB 1AUVA 2Q1XA 1Y1RA 4C6HA 1CNFA 2PD6A 1MNAA 3H2JA 5TPWA 2ES4A 4JBLA 2GN1A 3AUXA 2J45A 3CM0A 2YFYA 4WLVA 1UBKS 3CPHA 3WISA 1DRJA 3BX1A 1VC2A 2PU7A 2JLCA 2XW6A 4V3CA 5JCOC 4JLNA 1SK9A 3KV1A 3Q6IA 4FNOA 2F9LA 4LRYA 3ZHQA 2NVBA 4FXPA 4CG0A 2J41A 2GSWA 5KO2A 4KQ1A 3PTAA 2I91A 3U3MA 1VKJA 1PTJC 1FTSA 1ZGGA 2FVXA 1MORA 3P9RA 4HEA1 4L28A 3OZBA 2BC9A 3H2GA 4CLXA 1BRMA 3F67A 4IQFA 1E4YA 1JAXA 2ZE8A 4KWEA 1JSCA 4LS3A 4Z9AA 1CE8A 3OBIA 1NVAA 1NVFA 1E61A 3PGJA 2HD4A 4V0MA 1ULBA 4GC9A 1ZWLA 1MJGM 3BA1A 3RGGA 3W05A 2VJCA 2F7SA 3EA5A 5FR2A 1NBMA 4C0QC 4CM6A 3GR6A 4KKXB 4YRRA 3GIDA 3KETA 5IUJC 3TXYA 2WWGA 4KQEA 4G0OA 2W4MA 3KELA 3OO0A 3W79A 4XTCS 1Z2EA 1PFYA 2W22A 3VI3B 4CEJA 4P34A 1SC1A 4YT5A 1QC5A 3WK6A 4G4IA 2O05A 1XK7A 3QPBA 3U40A 5AVWA 2FUCA 5G0SA 1Y6GA 2GO1A 2WJYA 4Q3CA 1JECA 1H85A 3NORA 1LLUA 4O0MA 4DQKA 1F6BA 4M8SA 1T9ZA 4HEQA 2ODPA 4P3PA 1Z5NA 4DNOA 5C7IO 1O95D 1S02A 4OSEA 1Y1TA 4L50A 4K3UA 5LXTB 2FZGA 5A4IS 1OWLA 1K4KA 4MKHA 4EF5A 2XCTB 4RVCA 5EE0A 4EG8A 1ORTA 4QULA 3A10A 1U94A 4K86A 4KQMA 3EULA 3TQFA 4WNAA 2OPHA 3LHFA 2AWOA 2I03A 4L27A 2AEJA 5EGSA 3ZS8A 1PYDA 1Q1BA 1PJBA 1YULA 1R0ZA 3C7KA 1X1EA 4JB0A 1KQNA 1OIVA 2Q7DA 3P7MA 2BEJA 1OBFO 3OP1A 4P33A 1ZCJA 3OEED 1GKLA 1Z7YA 2NNLD 4KH1A 4P31A 2JI8A 1N78A 3KJZA 1K1EA 4IGIA 4JLPA 4WL0A 1G6Q1 4YJFB 1LFDB 3OWXA 4BAGA 2DPXA 2FB9A 3AVOA 2ZXEA 4II2A 3EGVA 4P1ZA 2PMWB 1UFKA 3RUHA 1GTJ1 3VC7A 4CUZA 4D5EA 3JTEA 4DHWA 4O4LB 5JV5A 4A8TA 3M1IA 1TEHA 3WAJA 3LUBA 1ZH6A 1Z4KA 5JD3A 2GAJA 2G77B 2X4LA 2GA8A 1NVUQ 3DVAA 4OTZA 3TF5A 2DPYA 3DZHA 4INJA 1P2DA 2O2ZA 4B3BA 4BE9A 1OXXK 3ADOA 4UARA 1V8OA 1QDLB 3LX6A 2G8NA 3BE5A 3A1DA 4OOEA 5EG5A 1VL0A 1D2CA 2TECE 1VP3A 4YUXA 2HPZA 2A5YB 4HH1A 1WXHA 3KQKA 3TS1A 2L0XA 4EY4A 3CZ9A 3EVEA 4YAGA 3AR8A 3ER8A 2HLHA 4JUAA 4KBGA 1M7HA 1SRQA 1F12A 1W4LA 1Y9AA 1UKZA 3AYZB 3HY6A 3AF3A 3WLOA 1GQQA 5IPFA 3KV3O 4K9OA 1P1CA 2GWRA 2PMCA 3F7TA 4MYCA 2X58A 1ACJA 2HRBA 2Z4SA 1M0WA 5T5QA 1ZMBA 3HV0A 5I01A 1M0EA 1YTUA 3TQTA 1THGA 1KQFA 3IKTA 1SUWA 2CVFA 5CYFA 2DECA 4Q3NA 4YONB 1W30A 1C1DA 1WW2A 3PJFA 5FPYA 4O33A 5AW3A 3FBGA 4A0HA 4QSHA 4YUAA 3O47A 2RGRA 4GGOA 4LYYA 1NYQA 2QYSA 3QFRA 3VR5H 5MN5A 2CVOA 4XDHA 1HZZC 1BMFA 3D8TA 1AJEA 2JA2A 3MWEA 1CUVA 4B6EA 3N0WA 5ECWA 3GH1A 2Q2NA 3KWFA 1WDWB 2V6MA 2ZSIA 3RTGA 3PHCA 1JEAA 3O74A 1XPOA 1ZLYA 2ZQZA 1DO0A 1P0PA 2MWMA 1DADA 2WB4A 4ZO7A 1N92A 1AZWA 3KE9A 2XCLA 5J2TF 2DGDA 2FSSA 5L3VA 1EP1B 4K6FA 2QTHA 3G2NA 2IS2A 4Z99A 4A6PA 4N5HX 3NMUF 4EY7A 3FPFA 1YJCA 3VDMA 1QH8A 4KVZA 5HX7A 1IPEA 2R7LA 1CUDA 2W6JD 4KR0A 3H5OA 1HF3A 5LNK1 4TMFA 1SOVA 5KNCD 3R7SA 1VBFA 3FFTA 4HWGA 2Z8ZA 5AVRA 1QYRA 4NZNA 2IK8A 4JVSB 3UA4A 2P1ZA 4XM2A 1X14A 2IY8A 1QK3A 1UUFA 2WG2A 3H11B 3EVDA 1JEOA 1QKIA 1DC4A 1GTL1 4ATNA 3STTA 5JPDA 3E84A 3HFJA 4IX1A 3SHQA 4U1RA 1RYZA 1ZD1A 4GNKA 5EPUA 5AM4A 2H59A 2CSXA 1MW8X 4BO4A 3B1YA 2PX0A 3DP9A 2R8OA 2W2QA 2NU9A 1NOKA 3GH3A 3JQ8A 3L8ZA 3DMYA 4RK6A 2O2GA 3WDKA 5MFZA 3QJGA 1CW2B 4R81A 1L5WA 3G9QA 4O3MA 4TZ6A 3QA9A 4UNQA 2OG1A 5EJ5A 2P4EA 2NO4A 1E3WA 4QQRA 3ZK7A 2VFAA 2FGJA 1BXKA 1JSXA 1HT3A 2J0UB 3BHIA 2OORC 4UMEA 2YJGA 2BHSA 2NV2B 2IZ0A 2QJWA 3KJGA 4JQYA 3FVQA 2WWWA 1BJKA 4C0BA 1KMHA 1KMNA 1QM5A 2HX1A 2OVFA 5EWLB 3CGGA 2QM8A 4UM9B 4A8JA 4PG6A 5JDIA 1C50A 2I1QA 3DL4A 2FN4A 1T5OA 3CIFA 2F64A 3DW1X 3BOSA 4UVGA 1POXA 3ETNA 3TRKA 3HLTA 1YVPA 1K8XB 3Q2KA 1Z73A 2JIPA 3R3XA 1UBNA 3FZQA 1Z6PA 3AB8A 1W8DA 1O9GA 2ZJ7A 2DHCA 5K0CA 4PANA 5B6PA 5C1PA 3Q7RA 4Y18A 3QHPA 5BYJA 3RS8A 3TTXA 2VTBA 2NU6A 1WR8A 2Q2VA 2A5GA 2YIDA 3AK4A 3CE6A 3GF4A 1NTRA 3IUMA 1LV8A 2X4IA 3UMJA 3OMLA 2FZLA 2Q1SA 2YHIB 3MAGA 1U3WA 2MJLA 2SKDA 4LXQA 4Q0MA 2CV2A 1FDUA 3ZU4A 2W8ZA 4UTPA 3R24A 2D0OB 4UE2A 4JP5A 3D4OA 1L1FA 1RFGE 1T5BA 2FSPA 2X1VA 3A0UA 4WZAB 3SJZA 4LSWA 1C80A 2ZWIA 1U90A 2RHHA 3S99A 2HQRA 4B8WA 3PKJA 1EE2A 2UUAB 3ZVLA 4YAFA 2JFFA 1X39A 1NJ1A 1KMIY 1QQ5A 4TV9A 3MCWA 3MEQA 1CERA 5DSTA 2C7OA 4Z4GA 1Z37A 5AHRA 3IVGA 3NDPA 3DC2A 4R69A 1A8SA 2WWHA 3L92A 3I8OA 3OSUA 2XVXA 4OQPA 3OY7A 3JYHA 4LHVA 1UK9A 4L95C 5KQGA 4MEAA 2BLLA 1RCUA 3NC4A 1TCCA 4TRNA 1P0IA 5ITZA 3OP4A 1N2XA 3V6LA 2OAEA 4YQFA 5K8JB 4CODB 3CGWA 2HRRA 3O4JA 2WWYA 5ESXA 4YV7A 2I4RA 4OATA 3TSAA 3GCDA 1DRKA 3MGAA 4GMKA 4QBKA 3UAZA 3PL1A 3IR5A 4ZIRB 4INPA 2B2NA 5HKKD 4IZIA 4QAJA 5BQOA 3HSKA 4KUEA 4R40A 1KMQA 3G0CA 2YQ5A 3SHOA 4S35A 1WY5A 4I6JA 4BATA 3U09A 4BNLA 3TOSA 4NG5A 4G4SO 3T7IA 2FR0A 1GDDA 1WPQA 2W48A 2XIQA 4HQFA 2IIVA 4QYTA 4TV8A 2PS9A 3CUTA 4JNKA 4L7QA 4Q37A 1OWPA 4ZI2A 4G0VA 4D98A 2LCFA 3V00A 3U4MA 3MWLA 5CP8A 4Z1MD 1SXJC 3MF4A 1E7YA 4OHWA 3N0VA 4G0PA 1OSNA 4L4SA 3WMEA 1IIBA 3ZI4A 1M6YA 4MYTA 4PIMA 1NW8A 2WYWA 4GVPA 5FR1A 3C7DB 1FFDA 3HNOA 1NA5A 1R4MA 5JH7F 4WHMA 1BA2A 2IZ7A 3D4LA 4G23A 4ND4A 5HBGA 3HCPA 4ND3A 1U28A 5LB4A 4RA9B 1JVBA 1QNFA 4UXIA 3CH7A 4ID9A 4JLSA 5DM2A 2ZPUA 5DYIA 4NFLA 1BDJA 3GPIA 4S1TA 1XR3A 4KIFA 3CLUC 1PZFA 1NI3A 3AF5A 2AQ8A 3G7UA 1HG1A 3IUPA 2GEFA 2OR3A 3LIPA 3MLAA 2ZS9A 4CJXA 1N9KA 3LP6A 4LHEA 1OFIA 5B58T 4OXKA 4R3NA 3KK0A 1E1RA 3GBPA 1TB4A 4C29A 1QH0A 2J9ZB 4GQBA 5ALJA 2HWKA 1H0HA 1XTZA 4CF5A 4BNZA 5DF1A 2AJTA 3A14A 4IDOA 4XARA 3DULA 1YB5A 5BYAA 3C8HA 1CJCA 3EC7A 2D1RA 2KBFA 2Q5LA 3DAGA 4FWIB 4YO7A 3F4BA 3DTYA 3A70A 5AW7A 1UPFA 2PRJA 5HQ3B 2EWWA 4BMSA 1KVSA 2YKGA 2VJOA 4TQGA 4N48A 1PD1A 4FP9A 5IVIA 1T3ZA 3LWBA 4P36A 5CK4A 2HCTA 3CRNA 2DFDA 3AP2A 3L7CA 1TMOA 2XUKA 3X1KA 5FTMA 4KPUB 2EWMA 2JLSA 3PQ6A 3QMVA 3QOXA 4JEHA 1I3OA 3H19A 3BJIC 1C29B 1NN1A 1LTHR 1RRFA 1FNSA 3ENZA 4A6DA 1D7OA 3ZZ1A 1U2SA 3OZFA 4RUKA 1TZJA 1OI3A 5CB8A 3F73A 1OH8A 2VT2A 1EX6A 3MFQA 4EHAA 4N6OA 3X1XA 3MPOA 1YFJA 4M0EA 3LXXA 4OQ4A 4D8WA 4YRLA 3D8SA 5HZHA 1KEPA 4L5BA 5I9BA 5FO0A 3DCYA 4EHKA 1RBZA 1GLGA 1Y6JA 2PUVA 4FFDA 2I6XA 3DYBA 4MQLA 1D9ZA 1P9WA 2O4CA 4COKA 2W6MA 4CM8A 1W76A 3HTXA 5TX7A 1VL1A 1BVYF 3O2NA 3WGIA 1VJDA 2G1KA 4TN5A 1H65A 1N6HA 5EY5B 4DNPA 1ECCA 2J1LA 4MKRA 4OX9Y 3HVKA 2XLBA 1VHQA 3U0VA 5E3HA 2JI4A 4G37A 2F3PA 4IIJB 3L0CA 1FL9A 3E7DA 3VZRA 2ALJA 1JFLA 3FOAA 1TE2A 3FVVA 4HDCA 1SN7A 3GFSA 2ZBGA 4RLHA 3S2UA 3ZWXA 3ZDCA 1N5LA 3DMDA 1W4RA 4LE2A 5KSPA 4DUGD 2ZYRA 4E5NA 5L7TA 1LSUA 3HFRA 1U3TA 4FIDA 3WL5A 3OQMA 3KZ1E 1EZ4A 2YC4C 3B6IA 2GN8A 2QSJA 4Q3EA 1OFGA 2BFNA 2PAAA 1CLEA 1R37A 1ZZGA 2JAXA 1F2DA 4DT1A 4E31A 1XZJA 2BEUB 1BMDA 1DLJA 4PU0A 1PR3A 1G8FA 3I6MA 2C5EA 2DR2A 1YJBA 3P32A 3JQ7B 3PF8A 3ZKAA 3O94A 1XXHB 1BCRB 1X7YA 3PPWA 3OJ0A 3I5MA 2FZ5A 2PKCA 1G5HA 5FOTA 1DQSA 1JTEA 4HXEB 1UZUA 1DC5A 1FNBA 4I9HA 3SGLA 4CIWA 1ZYUA 3GV0A 2VDOB 2HA4A 3WAKA 4DADA 3R74A 3ZHCA 5KMGB 1X13A 2GT1A 1JXOA 1MX3A 4UAGA 3I4LA 2C97A 3AFHA 3UT5B 3HCWA 1LNZA 1A88A 1TO2E 2OESA 1LFAA 3R3JA 4OJTA 1G20B 1LQUA 3AM3A 2VF4X 4RJJA 5BV1A 1TAUA 3ORFA 4DUYB 3B52X 2NSDA 2WPNA 4RBNA 8AT1A 5K8IA 1LDEA 3JWGA 1ZY2A 4PICA 4MP3A 5E2BA 2FN3A 4R16A 3KAQA 5JSZB 4EZBA 1OZAA 1OLUB 4BGDA 5EZYB 4D5GA 3NANA 2C9ZA 4RXUA 1U98A 5E2IA 1V4VA 4Q1FA 4FK8A 3V7FA 4M0MA 3WDSA 2B37A 4B4KA 1E2BA 4BX8A 5A7GA 5T4BA 3PPYA 4ZZIA 4LOHA 1BROA 4FVTA 2UZ4A 3BGWA 5A3JA 1JJ7A 1UPUA 1X7ZB 2ZJBA 1HDXA 4S24A 1V25A 1FQOA 1U7OA 5LA6A 3RC7A 4BX9A 3KPWA 3EXFA 3OT1B 3C6KA 1I1HA 3KKMA 1NDUA 2Q46A 1XVUA 3QVOA 1UM9A 3G85A 4BV8A 2GPNA 4HYYA 4IVRA 4C30A 5FA5A 3BULA 4GYJA 3AJRA 3GNQA 3ZS9A 4ER7A 2MSEB 5LJIA 1J9ZA 3VNSA 4FI3F 2ECQA 3NUQA 5C34B 4ZZ0A 2M1ZA 3PYLA 3JSXA 2XTAA 4RXMA 3L0DA 2ANCA 4MINA 1G64A 1B00A 1Q74A 2PGAA 4LNHA 4M86A 2Z09A 3IURA 1XXLA 3A9RA 4YP9A 3VC2A 2ICAA 4ITRC 5CH5A 2H1LA 4J0JA 2E5WA 1Z17A 2SECE 3LT0A 5HK8A 3CNBA 3QE2A 5DXJA 2W37A 2XRZA 2HJ9A 5JMPA 2ADMA 2H3EA 1Z7GA 3QWHA 1T4MA 3BDAA 4E1BA 3HVRA 2AFHB 4MS4A 4I9UA 3Q5GA 1GCUA 4FFRA 4C4PA 8GPBA 4L3WA 4AX8A 2PUHA 2QHXA 1YF3A 3SSNA 3ZWDA 3V3KA 3CTPA 1M6WA 4IIJF 5JUWA 2JFPA 1L2TA 2QD2A 4V0RA 4BFLA 3QENA 3IP5A 3WKAA 3IIMA 3I9KA 1CT9A 1MIOA 4EO4A 4FOLA 3V3TA 5JADA 1H1TA 3FCYA 2I2FA 4G4SP 5DYGA 2OUIA 1WP4A 4AW9A 1MX1A 2FZVA 2OC9A 3CUSA 4DLUA 1RHMA 4H35A 4G85A 1MVOA 4MQ5A 3DAYA 1M75A 2VPZA 3GNSA 1XVLA 3O4VA 3JSAA 5BQ5A 4LYEA 2VTDA 5H9VA 2FSVA 4TTVA 5FPHA 1KZHA 2F3UA 4MPDA 2GCOA 4ZAWA 4WFQA 2H7XA 3H5RA 1ORHA 4KEAA 1JR6A 1Y37A 5ALNA 3W7BA 5I7RA 4REMA 3GJ0A 3IMKA 3ENKA 4PGHA 4XWGA 5FPPA 2Z0MA 2AKYA 4DZZA 1GKKA 3RTCA 4CW7A 5L4SA 1TJ5A 3M1LA 1XTRA 5JXHA 1EB9A 1XZBA 3L0IB 3RC3A 2I33A 5JPCA 4BNNA 5KC9A 5EQDA 2A94A 2W5UA 4KFRA 3M82A 2OBBA 2X3YA 1PZMA 4X66B 1FP7A 3WGTA 4JBWA 2GEVA 4LGMA 3CKYA 1HFEL 1X87A 2GHTA 2WIFA 3B8HA 3M81A 4GMXA 4I1VA 4QWWA 3DDNA 5L6MB 5TQ0B 3S8EA 2YFKA 1DG9A 4R7ZA 3SIWA 3R8CA 3R8XA 1EVYA 4PF1A 2BM9A 3ZGYA 5CR9A 3V8RA 5J4YA 4FB4A 3EFOB 1X8LA 3SSAA 1VIAA 1DWQA 5I7EA 3K0CA 4JELA 4IIBA 1JEEA 1NXTA 3BK2A 3ZTTA 3PYXA 3VJLA 2M98A 1KH2A 1SUCA 5E9QA 3G9UA 2G9RA 5I47A 3KYBA 4IUCS 4D4KA 3DSRA 5F3RA 1I5RA 3HA2A 1LW6E 2XYGA 3IL2A 3NJRA 4DJAA 2BAGA 3K2IA 5IAGA 3HC7A 4GPEA 1A0OA 1EX9A 2QAGC 4IEFB 4OF4A 5IJ9A 3ZI0A 2AHRA 3A1EA 3H9EO 4RSMA 4MZDA 4DSUA 4FFMA 1YI0A 1QGED 4NZOA 5AW9A 4BNWA 1QLHA 3DWFA 1U5AA 4IHAA 3AH8A 2E5LB 1E2DA 3EXG2 4YUWA 1UKVY 2ZIZA 2EJUA 4LWZA 4D9NA 4ZI3A 4FNGA 2ZAYA 4X1YA 1WUYA 1JJIA 3QW4B 3KQUA 4RGBA 1GGNA 3DD5A 3TLGB 3TUIC 5CAEB 4FE4A 2HNAA 3K1YA 3G0DA 3TECE 1UXGA 2D5AA 1Y82A 3LQFA 1IY8A 4HLNA 4KE7A 1T34A 3WNBA 3UENA 1P72A 2K6GA 2PXHA 3IX7A 5IEJA 3RKRA 1FFGA 3W2GA 3V7WA 4C4RA 5BUSA 2OB2A 5F5LA 2C8JA 5IAJA 4Y0AA 5JYDA 2X0JA 2OFFA 4HN2A 3WHIA 1UK7A 1NV9A 1K6EA 2HGZA 2OB1A 1BYIA 1KYVA 2R6CA 3IMCA 3IRVA 3L6BA 4YIKA 3HY4A 4QOFA 2J3EA 1KI9A 3CFYA 1Y7LA 2ZANA 3LX5A 1H0SA 4PLGA 5AOBA 5JALA 5KNBA 2FR8A 2PV7A 3AZOA 1H8HD 2XITA 2AOUB 3H1EA 2GRAA 1H2XA 3AI2A 3TM5A 5KNBD 4X62B 1L4HA 3PD0A 1PYGA 1N3IA 3W2TA 3M4YA 3CNHA 5JZMA 2YASA 1MMFB 3Q9NA 3USZA 3AUJB 1QTQA 1OJLA 1E79D 1NU8A 1SG0A 2HV8A 4H0CA 4JKOA 2VK8A 4X94A 1CYEA 2FKAA 3OESA 3PKZA 4TMVA 4PG5A 1Z2CA 3LOPA 5K3OA 2OXEA 3ZW7A 3IGFA 1TUEA 1ZXLA 3DYIA 5GONA 4FBGA 2NG1A 1NUPA 1W4BA 2V55B 4N0QA 1WXDA 1QGDA 2Q5CA 4YCMA 1SD2A 5C1OA 3PFFA 2O8CB 3I9NA 2W58A 1HL7A 1ZESA 3ETGA 1ZVJA 4IWYA 4IXNA 4KGXA 4KV9A 4ZJYA 3RVDA 1II8B 3TVTA 4X61A 4D3DA 4F4IA 4D3YA 3PEFA 1OREA 5IF9A 1QC5B 3L4SO 3R5FA 1M34E 3I23A 4PNHA 3BH0A 3KQLA 3I4CA 4C89A 4E12A 4WACA 3HBFA 5FLYA 4H18A 5LSAA 4TKUB 1G63A 3H16A 3CWQA 5F5NA 4H60A 3KLPX 3AZPA 4J8PA 4FM9A 3E5NA 2FK7A 1E2IA 3CLRD 1YTLA 4DA8A 2YHSA 3ZHBA 2HTEA 4R68A 4RAQA 3PR3A 3ZD6A 2OXFA 4A0FA 5I7HA 3VJKA 3S68A 4UASA 2JARA 3THXB 4FC6A 3UXEA 5CNJA 4F85A 3A1UA 3AESB 4LCEA 4AY5A 1XCOA 1KS2A 1SH7A 4GLBA 4ZARA 5BW6B 3RC1A 5DRYA 1SPBS 3AHHA 2V8BA 4G5RA 5G53C 1GZ6A 1EVLA 4FU0A 4ZAYA 2D06A 5KAPA 1IUPA 4F2GA 1V6SA 2BMFA 3II6X 3DGEC 4L78A 4DDWA 5DX1A 3R7AA 3K09A 3KVRA 4QEDA 3AF0A 1OWNA 4PXAA 1AZLA 5DMXA 1NL3A 1OW3B 1R0BA 4L9SA 1CD5A 1U8TA 1V95A 2HNKA 3KDSE 4PNPA 4AY3A 4D6XA 1A9PA 2XVAA 4MIYA 2I54A 1EWVA 4X90A 5K2OA 4JBIA 1SQSA 1ZGAA 1UP4A 2W2KA 2C8LA 1ACLA 1OVGA 2O5EA 4FE3A 1E2GA 1THMA 4HNUA 1EX1A 1I3KA 3H5AA 1EM8B 1G6KA 1A8HA 4BB9A 5FYDA 5I7AA 5AVUA 2HIGA 5ALOA 1CRZA 2XMGA 4J07A 1UOPA 2YZ2A 2SNIE 1VYVA 2F3RA 4RIFA 3ZY4A 5JSQA 2XGOA 4L08A 3UMGA 4PX3A 6ADHA 2CKMA 5ARDA 1XVAA 4IWXA 5IKOA 1UXJA 2GVNA 4EYSA 3PGKA 3OLZA 1DBSA 4MWZA 3GRRA 1JQEA 4JYAB 2E85A 3GJSA 3R0QA 5JJIA 2RBEA 3B7GA 2R7KA 2PVPA 4B7AA 5CG1A 5IT5A 1O58A 3ZWMA 4DCPA 1QU3A 4H9GA 2VHXA 2F6RA 3ZHYA 2XRFA 1U7TA 3ISJA 1RAFA 2VDQB 1MB4A 1Z68A 4UTOA 2C54A 4JBYA 4I50F 2IXDA 4QWMA 3DT6A 4HDSB 3UG7A 4X45A 1RDFA 2QTGA 4MI9A 4NMHA 1E92A 4BQIA 2YWGA 3FZEA 1KTIA 1OFUA 2Y66A 1GDHA 2FDXA 3U3ZA 1AKRA 2OV8A 2MMGA 1EG7A 2H1HA 1JG2A 5ICEA 1C0EA 4ER3A 3M8KA 3AVQA 1ISHA 3J81A 3H5NA 1TUGA 4UOZA 4OLBA 1SFRA 3A4YA 1PO7A 1GKYA 1PR6A 2IZ5A 3OE7D 1L9KA 4YRNA 1OPRA 1ZN8A 4DIMA 2R6AA 4LRTB 1NMZA 1EHCA 1KYTA 3H7AA 2FFAA 4YRAA 2EL9A 2Z2YA 3BFJA 1LI4A 4I4TF 3I5XA 2P2GA 1A5ZA 2H0AA 1DXQA 1XC7A 2DZDA 2F1HA 4UM8B 3IB6A 4R1NA 4OHRA 5F76A 1JTFA 1HDGO 1DKUA 3OC6A 3QQ5A 1CQJB 1P31A 3P4YA 2QRZA 1BU8A 3GJRA 4XUDA 3QVMA 2J6CA 5HGJA 3E2MA 5EKTA 3JQAB 1SD5A 4TROA 3IQEA 5CB4A 5JZOA 1G9SA 4MRPA 1U28C 4TKUA 4OMCA 5GMOA 2IV3A 2XRMA 2NGRA 3ESAA 4HGRA 4OBEA 4TKMA 2WJ6A 3O4IA 1NFQA 2BFPA 3OURA 3D8NA 2V58A 3PXBA 4O4IA 4AM8A 4GMDA 2BZGA 2PU5A 1J39A 5IM4A 2YNMA 1I1NA 1ENOA 4EG5A 3ESBA 3WNZA 2P9JA 1Y9ZA 3IAFA 3PEVA 4U9UA 4D4LA 1FYVA 4BFWA 2Y0PA 2RKWA 2INGX 2Q6VA 3LNCA 2C9BA 2JPDA 1K6JA 5EJMA 1JTVA 4JI4B 4NENA 1HG0A 2GX6A 1DT5A 3A4NA 3EGOA 4H0NA 4CCWA 2W00A 5JH7A 2FLWA 1YZKA 2BMVA 2QNBA 2X7HA 2FPSA 4RYDA 2IZOA 2BONA 2NZ8A 1C30B 3NEJA 5CIQA 5DHPA 3W5VA 4R41A 1OX6A 2ASEA 2O8NA 1Y3IA 4Z9FA 5FYQA 1U8YA 5CDFA 3VJRA 3D31A 2DQSA 4IKPA 4IIGA 2J3JA 4B2YA 4DMCA 4JI7B 3Q9LA 4FINA 4XX0A 3RFCA 3F46A 5AQ1A 1R74A 3EFOA 3PXAA 1ZQ9A 4N54A 1AHIA 2PV0A 1GCIA 4MUFA 3IVMA 1XXHE 2H1OA 3L6EA 3PXXA 3WLAA 2ERXA 4PM4A 2XBMA 1NMXA 2PZEA 3EIWA 1D1PA 3GRKA 4GXRA 2E18A 3CS3A 3GD7A 5LCXA 1HLDA 1TQ8A 1ZA1A 3IBCA 3UJ9A 1L7XA 4RGQA 3K9LA 2OWEA 4CM1A 2HK8A 4PQRA 1XFAA 4WXMA 1GGMA 2I7TA 3K16A 3K0CC 4BVKA 4HQLA 3A4TA 4C0KA 3QVXA 3K6KA 4W9MC 1WL8A 5FWDA 4P4NA 3FJYA 3H2KA 3F5DA 2IEBA 2QMOA 4LWPA 1XMJA 3E48A 4M8IA 3SN6A 2O5CA 3GRUA 4YVFA 3GW8A 1H6DA 4ZOLA 4DV6B 1C0KA 1IC6A 4TSFD 5FEUA 3KB2A 2CDRA 4JJKA 1GRNA 5IAOA 3OKCA 5HFNA 4BEVA 1F4PA 4UE3S 1MRNA 2XCQA 4Q9LA 1OTYA 2UVPA 3PJEA 2NQ2C 3Q3JB 5A0VA 4I50A 4OXRA 5KJFA 4L5YA 5CLGA 1QHEA 2CLOB 4W4TA 2QTVA 1C3EA 4ND1A 3IJ5A 1M8JA 3WB1A 2CB0A 2VPPA 3EW7A 4J0QA 2WWXA 2BFCA 1BXGA 5KZMB 5EXTA 5IBCA 2WUGA 2C03A 2Q9BA 1Q7RA 3KM0A 4YGYA 1K7CA 3MGKA 5EZ5A 1MRZA 3ZZNA 1J8QA 3INNA 1T3LA 5IAKA 4YR7A 5LDDC 2X1LA 5AK0A 1MFZA 5CDTA 3G8YA 3ZHUA 2Q9CA 2ORED 4DR7B 1XA3A 3QFTA 3TFOA 1JDPA 1SQ0A 3KJQA 3EWAA 3OI7A 4K9SA 4GPAA 2PYZA 4CR8A 1ZA2A 3LJKA 3SFVA 1EXNA 1E1LA 4IZOA 4C6TB 2XB6A 1E3IA 1RW4A 2ZS7A 1EYZA 3HO6A 2X8AA 5D7NA 1NSFA 1CUSA 5DWVA 3UGTA 2SCUB 2HT6A 3CQ9A 3R7DA 4HXFB 1VHDA 3QM1A 4ARVA 3U9TA 5DH9A 2XB9A 2JFQA 5BMVB 1D1QA 2B34A 1W2WB 5H68A 5IZ4A 2OCAA 1ZP6A 2Q5JA 4NCIA 3K09C 4O4HF 4GUAA 3LOUA 1PE0A 2YJ3A 2VNJA 1E1RD 5HF8A 1U7WA 4YRIA 4XIIA 1BN7A 2R25B 4FWTA 5CFMA 3DTTA 1IXZA 4IG9A 3K9WA 4ZRNA 2YV5A 1TA9A 1Z26A 3Q6NA 3M3HA 1VKNA 4E5VA 4DB2A 2YFQA 3B13B 3L7AA 1YRAA 1W75A 2GVZC 1POWA 3K9GA 3WL3A 2C77A 4B44A 1I0ZA 4CTNA 1TADA 3QVWA 3NHJA 4XPZA 5AIAA 1ZI8A 2MTBA 5ADHA 4G0XA 2QT0A 2I6FA 3NCHA 1H3NA 5F52A 4AX4A 3WTBA 1XSEA 1M5RA 1CUZA 4LGCA 4F04A 3HA5A 4R9RA 5BR8B 7AT1A 1G66A 2DBVO 3UJPA 2FWMX 1A5BB 1HT2E 2XQIA 4KK4A 4QFMA 4FDLA 5DM60 2GD1O 1S2MA 2X41A 3PVZA 3AINA 1E2QA 3EWSA 2D00A 2PFSA 3EODA 3OPQA 4HZIA 4TTIA 1NG1A 1YACA 4XQ9A 4M7WA 4HGPA 4FYKA 1VI2A 4HAXA 4NS1A 4XJTA 1GQRA 3OM1A 5BMVF 1SVMA 3KD3A 3SR0A 4AG6A 4EG7A 3BL8A 1ZK2A 1DWOA 4C4AA 2BLNA 5IWAB 3VM6A 1TC1A 2XOXA 1VI5A 3C97A 4RW0A 2NZ2A 3GJXC 2YHAA 2WMOB 3LAWA 4DC1A 4ZCRA 3I04M 3ZKWB 3AJEA 1LZLA 3BM5A 4LF6B 1J09A 3G7NA 3HPRA 5LA6B 1EJ2A 1GA6A 1ST2A 1JXAA 1RJFA 5EUQB 3H2YA 3U3DA 3OETA 3PL5A 1TK9A 4J0EA 1JHUA 1HK7A 2HIMA 5GADl 1PHPA 4P0QB 1GAXA 3OPXA 3QX7A 4AMGA 1Y42X 1WKVA 4RQUA 4I1YA 1RLOA 3EB9A 4CM4A 1U8FO 1D0IA 1RIFA 1J33A 2GM4A 1ANKA 3TMKA 4DNFA 5HQTA 2VJKA 4B3IA 4FR0A 3M5DA 4HNHA 1WDMA 2O5VA 2OMKA 3A1SA 3D02A 1WETA 1RS0A 3RASA 3R6LA 5LP6F 5LWHA 2FE1A 2ATVA 1FP6A 3C3BA 3L0PA 4B6PA 2OT3B 3B1ZA 2XA9A 1OX4A 4O2RA 3DEFA 2MINA 1GL3A 1ODLA 5ALWA 3GRYA 3UT5A 3UWOA 3ZLTA 2G07A 2RH5A 2YOHA 4MR7B 5F2OA 4CL8A 1ECPA 1DTWA 4CFZA 1GQOA 4RQBA 1X7ZA 2FFRA 3GLHA 4ARZA 4KZPA 4FFPA 4JC8A 1RRPA 4R1TA 3DEHA 2Q1UA 4ZVUA 3S27A 3LRTA 2AX3A 3TQIA 4HMPA 2CUTA 2ZWMA 4G1EB 4MUJA 4NYJR 4ZCTA 3DHYA 4ILEA 1X77A 3NJ4A 1QHFA 3ZW9A 3LC2O 5KX5B 1KVTA 1GPNA 3WMGA 4UNIA 5JCXA 3MRVA 1E9RA 1YJXA 1CCWA 5KYKA 2G88A 2G9UA 3IVCA 2JK1A 3GA0A 4KX5A 1UBSB 1I3NA 4RZIA 2HA2A 3V7YA 4DQLA 1V7ZA 3SK0A 4DOMA 3KFVA 3ZI7A 3DLTA 4GAEA 5FH9A 4QU8A 5HKOA 1HYEA 4MIOA 4NL4H 5CVJA 2YZMA 1LBEA 1QFYA 3RVJA 2PM8A 3SEZA 4U2BA 5EKXA 1K5HA 1O1YA 2ZBDA 5FORA 2GR9A 1W93A 5EWJA 3I2GA 2BFDA 3IFSA 2DUUA 1DIOB 1MB2A 1N2CE 3LUPA 4HZGA 4QOGA 1PVOA 2CL7X 3CZMA 4NBLA 4KFCA 4R4JA 1YR3A 3KOXA 4ZHQA 2CLIB 4RVUA 2AK2A 5FNVA 4QHTA 4YWHA 1KZ9A 4G07A 3FPJA 3ENWA 4HPXB 1KDPA 1LVHA 4WKOA 2Y1OA 5HILA 4DPLA 3B6EA 4ZREA 4ITUA 1WCV1 3BZWA 4IQ8A 2WBLC 3EH2A 3N2LA 4IP0A 4UNNA 2EGGA 1VKHA 5C5EA 4MVJF 3AHEA 1YL7A 1S7CA 1W0KA 3IP3A 4RF2A 4YAOA 4HVCA 3EZLA 3EXHC 1E2EA 2VRCA 4GXTA 2X8BA 4BJ3A 1AXEA 1EP2B 2V6JA 1GPKA 1QVRA 5JBNA 1YIDA 2Q8NA 3EH1A 4MVJG 3E8MA 2GYVA 4N9WA 2ORIA 3A37A 4UTNA 4RE6A 1CDOA 3CZ5A 5CCEA 1PTJA 4HPJB 3D0OA 1TO6A 4NHEA 2I29A 2EOAA 2QTRA 4BQFA 1JUDA 1KDOA 3MTAA 4FHDA 4HB3A 4PN3A 2XNCA 1YDMA 3GU3A 3GLGA 1VL2A 2B0JA 2NTNA 1KTVA 4CQLB 4IOLA 5KKNB 3E35A 4V0ME 4JL5A 4NE7A 5EL0A 1VPTA 4XWKA 5EXXA 1GFWA 2DFKB 5JQGA 1C9DB 3DA8A 1UPBA 2O0LA 4CQJA 4F46A 5IT4A 3HADA 3KKQA 1Q1NA 5FOXA 5DT2A 5BMOA 4S12A 3R7FA 1KPIA 2I76A 3SLKA 1TIBA 1LTQA 1PAUA 2TMYA 3P94A 4JOQA 4EHDA 5I4IA 1GJRA 3MIZA 4WSOA 1B6GA 2O2SA 4FCCA 4YQYA 4UAJA 4F0JA 1UXOA 3QKWA 3L1UA 3RTBA 3ELDA 4ZU6X 2LZ0A 5KWJA 3HB4X 3F7MA 4P35A 3N2ZB 4FCTA 5SYNA 1KI7A 3HK2A 4FKZA 1IONA 2IV2X 2VPYA 2WWFA 1T5SA 5COQA 4JI0B 3KPYA 5FXMA 1Z5WA 5BYBA 4GQAA 3F0TA 1XI2A 3WQSB 4RNCA 5AESA 3GAZA 3CVWA 3REQB 1B23P 1B41A 4CCYB 3TX6A 3I73A 4I1RA 1YCFA 2J6IA 4CYMA 5JRZA 5FBQB 2VSNA 1DNPA 1AURA 2AL7A 4IH4A 2BBTA 3MT7A 2CVZA 2HREA 4Q48A 2KS6A 2VSQA 4ZI5A 3DDSA 3IKLA 1E5LA 4YUVA 4LISA 4DJEC 3AX6A 3I30X 1FW8A 4HSEA 1DWUA 3IC5A 4PXSA 2VF7A 5GP1A 3D6NB 4MVYA 2P5UA 4PYLA 1ZSYA 3P9QA 2FXIA 3KWLA 1YDWA 1IG3A 1VZ3A 5JBQA 1J70A 5IANA 1E3JA 2PL5A 4L0MA 4UHBA 5J2UF 4OFXA 4LGYA 3T06B 4HVAA 1JIUA 1NIPA 1ZUNA 3T99A 3WJ1A 2MMCA 6YASA 1JU9A 4OV6B 1JILA 2JI6A 2OO5C 4NABA 4RJ2A 4QOHA 2K5UA 5CNMA 1ULUA 4IKOA 5DTQA 3UY4A 4ENRA 1H2FA 1E8DA 3EVCA 1Z8HA 2OO3A 3B1VA 1QIIA 1KZ6A 4BGEA 1W36D 1NKTA 1IHOA 1N5RA 3R0XA 2ZB7A 2XD9A 3V4SA 2DXIA 4MV6A 4Z9XA 1T10A 1WXWA 4PCUA 3CC8A 3SC2A 5BN3B 1IHYA 2H54A 2XBLA 3E1SA 2OZEA 3RJ5A 2J5KA 1QIGA 3O8RA 1ZWKA 5TY0A 3AXTA 1KFEB 3OEHD 4CMJA 4DL9A 4X6YA 1XRNA 4TZ0A 5GY7A 1T6XA 3NM5A 4EB6A 4CEHB 5AXDA 5L7WA 2C9CA 4EJMA 1E9CA 1QPBA 1SOMA 2FF7A 2LIPA 5DLPA 1YR6A 2H2IA 3PFBA 3A2NA 2B36A 3A36A 4L76A 5EUCA 4EABA 4B3HA 3PCTA 4ND8B 4FZ5A 4WBSA 4RL4A 1COWA 1KXJA 4Y2TA 4RC9A 3N7TA 4FMDB 4J6EA 4X71A 4YH1A 5K3SA 2Y1GA 4QVIA 2O48X 3KYDB 4NBWA 1XAGA 3COSA 2XMZA 3FFXA 3R5JA 3DWIA 4G86A 4IH1A 3B36A 3T7SA 2C7GA 1I3LA 2WJWA 3A9SA 3BMXA 3IPCA 3PDIA 1P2FA 2C4HA 4RHXA 3EIFA 5AK5A 1NVWQ 1P91A 2JGJA 3PWSA 5GONB 4BE7B 1RLIA 2X9NA 4L07A 2CXTA 2WP8J 2CXXA 2NT4A 3UAVA 4EFMA 2YXLA 1OJ7A 2IYAA 3E1GA 3JARB 5EMLA 3RS9A 2QX6A 1G7SA 1T2EA 1NYTA 1FUKA 3ZVKA 1YZUA 2DYKA 4EB8A 3O2JA 2Y1KA 3CA8A 3CF4A 1CDZA 4OL9A 3HWX1 2CFIA 5IYZA 5KWVA 4MQ6A 3O2SB 1HEUA 3G2JA 2POCA 2N42A 3B5IA 4A2PA 3CZ4A 4O2LA 4YO8A 1QQAA 3OWOA 3WGGA 2FPXA 1N2ZA 2Y2UA 4BV2A 1A2OA 2C2MA 1FFCA 3M1AA 2EZ8A 5JXWA 4N76A 4LBWA 2QVLA 5G0VA 5IM4F 2QDXA 3SZOA 4S05A 4MJXA 4WY2A 3EGEA 4IMIB 1NURA 3HPQA 3RU3A 1XQWA 5BRAA 4DR3B 3FVTA 4DY6A 3JASA 5HE8A 3HU5A 1J20A 3SLRA 1DEKA 2HPHA 4RD2A 3GQVA 4DNQA 4FMDF 1PFWA 1T2AA 3EDQA 3OPYI 2ZUUA 4FOTA 4Y2YA 4OJKA 4BX2A 1O57A 1P61B 1LF5A 2Q28A 4Z0TA 4HCJA 5AFSA 4OUKX 1THZA 3T3NA 2UXBB 2ZBVA 5DMHA 1WXQA 2UYQA 1YZTA 4C08A 4D9JA 2NW6A 1YOBA 1BH6A 1JA1A 1V48A 8ABPA 4BUCA 1V2GA 3LH5A 2A0KA 1VLVA 2WK1A 1SWVA 3HCBA 5CDHA 3AOGA 2XUGA 1QS0A 2CUKA 3K53A 3ODGA 3Q9SA 4U2CA 2BHRA 1HRDA 3GEHA 2IZZA 4P4SB 2C94A 1UPAA 4WLOA 3QGMA 3L6CA 4I4LA 1XTKA 3TSZA 3VYSB 5KYWB 1PR0A 4PCLA 4MCAA 5K0LA 1J4AA 3Q0TA 1T2CA 3DXYA 4H7JA 3CVJA 3I28A 1WKCA 4FNMA 4HN4B 3FOFC 3V4PB 2C7QA 1Y3CE 3FDZA 3HQ4O 3ZU6A 4F8JA 4WJLA 1BO6A 1Q16A 3HCEA 2OV6A 2X8WA 3DKRA 4TLAA 3MOGA 1U9JA 4E33A 1P5HA 3QG5A 4JV5B 2CYBA 3BREA 2PQ6A 1KYWA 1Q50A 2ZU6A 5DT9A 5BSRA 2H17A 3EK2A 4URYR 1K86A 3K2EA 3HB5X 4JBHA 4GUDA 1TYCA 4PLVA 4BKUA 1A8IA 1FTQA 2F55A 2CHVA 2GZ3A 3H5VA 1P6UA 2W4IA 4X93A 3SE7A 1MA3A 3MINB 1XEFA 3HCCA 4NH4A 1P39A 4V03A 3G1UA 1XKTA 3DLPX 4NARA 3A9UA 1GNRA 2JD1A 3SSOA 1WMSA 3ZHXA 4W6QA 2WWVD 3EGIA 3H97A 4AKEA 4GHWA 3U49A 1LX6A 3S5JA 2C99A 1HTTA 3G0GA 3GJ3A 5JJCA 2FWBA 2IUTA 2RD2A 5U4XA 1Y6FA 4XWOA 3LA6A 3NQ41 4TYMA 1I24A 2FHPA 2Q3CA 5E9WA 2DWUA 4JT4A 3VHLB 4QA9A 4B8ZA 1IXYA 1G59A 1DJMA 2WTAA 3EZ9A 1EP9A 2JJYA 2XE4A 4Q47A 3CVYA 1P4RA 1VXRA 2UYYA 1N6RA 4HD8A 5FP0A 4TLLB 1Z35A 3RBXA 3TNFA 1E9FA 3N28A 3OO1A 4HB4A 1BE0A 3B2NA 4I4CA 4HEHA 4U4AA 3NVKI 4N6GA 4TVBA 4UEJA 3UT0A 3R6WA 1WAMA 3QBJA 1XYYA 4MYRA 5IMSA 4WKBA 3JD1A 5M04A 1LDNA 5IAAA 3KVVA 4BNJA 2C3PA 1KVQA 4WKCA 3S0JA 5HM6A 3BIXA 1V26A 1CIVA 1DFIA 1XAJA 5FBHA 2UU9B 1KRWA 1QCYA 4MRSA 1JEJA 2G5PA 4IV0A 1FFSA 1NUHA 4LI3X 1Z6XA 1OMOA 4RWEA 2VZEA 4GP9A 4DMUB 5IJ0A 4IIDA 4RFSA 1P2SA 3A4MA 3EXHA 2BCJQ 1J1IA 1P5RA 3RRFA 2BGKA 4MH0R 4N5DA 2EFDB 1HYBA 3A6GA 1K7XB 4Y67A 1NNEA 1MVLA 1FE8A 3QFSA 3R9XB 3E1KA 3K5PA 5AHWA 1ILWA 2ZIAA 1JQLB 4AB1A 2FY8A 1GOTA 2WQ7A 3K9FC 3IUBA 4TX1A 2MYNA 2WAOA 1D4OA 3CZCA 1LB1B 2XRYA 3N8DA 2IQIA 1DKRA 3IPRA 4KW7A 4NYJQ 4RE5A 2XKKA 2O8FB 2QUBA 3H1FA 3H1BA 2CNKA 3P0RA 4O59O 5B1SA 3ANTA 2W0SA 5EGNA 3A4IA 3NBZC 1C7IA 3CF2A 1I7NA 5A9SA 5DBOA 2ZTLA 3ORHA 1SC4A 1SHZA 2VKTA 4WOKA 4YB8A 5KJEA 4CV2A 3T5MA 5AJWA 1PL6A 3VTZA 1RWVA 4ETIA 3CNLA 3I76A 5IWCA 1NFRA 1GAJA 1EFVA 1U8CB 2RK6A 1SA0B 1DUIA 3N6RA 4WLUA 4EL0A 4FHGA 1VGVA 2BGIA 3VC3A 1JH9A 3H5LA 5MHTA 1TRKA 5CLIA 2H0RA 4XDZA 1N2CA 3DUFA 3HWRA 4KDEA 1FFEA 1QBKC 4N49A 1XPJA 1KDZA 3SMQA 1WXEA 2ZVQX 1O8BA 1EHIA 1D6JA 2ZDHA 2ZRHA 3I05A 1P80A 4F5YA 5DLYA 1CIPA 2XCUA 1G55A 3N3BC 4RHCA 4DRYA 3CW9A 4I5GA 4Y7CA 1KYIA 4O63O 2EARA 3UV7A 1VHWA 3D54D 2OE2A 4HP8A 1E7WA 1JIQA 3IRUA 3ZGVA 4AJEA 4TGLA 2ZUFA 4FYIA 3A6FA 1AKVA 2DULA 3EC1A 3MS7A 4J7CA 4C2UA 4FGUA 1JDVA 1ESDA 4WOPA 2C4WA 4ZEOA 5IT9A 1Y7PA 5J2TB 1CETA 1VMAA 3TAUA 2XZTA 1TJPB 1L5OA 1US8A 4FZ3A 1ZIYA 4NJMB 16PKA 2R1VA 4PYQA 4R1OA 2PGXA 2AN9A 4RJIA 5CX1B 3H0CA 5H5JA 4WZBB 3FTCA 4YYEA 2O6HA 4UXJA 4LDPA 2I5PO 3BXXA 4IHQA 3D8HA 3BXGA 2NUTB 3IIEA 3Q8XB 5ESWA 3RDPA 3A3KA 5AMXA 2G0TA 3IQWA 1L1RA 4ARSA 3DMNA 5EXPA 1EESA 2OO5A 1I2CA 1GTG1 1P17A 2QZ4A 3B5JA 3ZUGA 1B8PA 2WKRA 4R84A 4PSVA 2HOQA 3CJTA 4XUCA 3FN4A 1KBOA 5EJIA 5JYBA 4BLWA 5EINA 5DM1A 3CX7A 1NXSA 1QG6A 3G5AA 1W0JA 1FU7A 1M2VB 2BFBB 1K0UA 1T0JB 5H16A 3ICQB 3RBZA 1HE3A 3PLRA 1W6UA 1A69A 2C5HA 4AF7A 2KPOA 3GY0A 4QUJA 4F96A 2BGWA 2C4MA 4HO1X 1NHGA 1GU7A 3GGJA 5JJBA 2ZKLA 4XCQA 4XIYA 1MZVA 4A0RA 3C6QA 1NQAO 1R6TA 2OGUA 3KUXA 2QMQA 1S8AA 4UUAA 4V2IA 2ZI9A 1GN9A 1QKJA 3STYA 3TTWA 3UV3A 5AICA 3W5HA 2QY6A 3A3YA 1CR1A 1OU0A 3NS7A 3FTFA 3ZJVA 2VSOA 3BIFA 3A6LA 2ZBFA 3OZAA 2OXRA 3GLVA 4PTLA 3QBTA 3H13A 1WVGA 4IXWA 4Q21A 4LEIA 4QBHA 3LY9A 4JX8A 3VPXA 1P74A 4LF9B 4XYLA 4M0DA 3TTYA 5C7YA 4GMGA 3V2HA 2GNOA 1VKZA 5U1PA 2K4MA 3RR2A 1V16A 4FCVA 3EFHA 3E3LA 5IJAA 3VNRA 2K87A 4DDMA 3BB3A 4NBKA 2Y1DA 2ZM5A 1J0BA 3H65A 2FZKA 3MSCA 4M76B 3SF0A 5I5EA 5FBRB 4WCFA 3CVVA 2GK4A 1EP3B 2HWUA 1Z36A 3KX2A 3GAAA 4WCFB 5BSMA 5LZ2A 1Z74A 2L2QA 3CH6A 4R0VA 2PRIA 1J0CA 2LW7A 1JFFB 3ZQJA 1NYRA 2HBRA 3Q7QA 3BGVA 3LUFA 5ICSA 3A7EA 1RHRA 3QFFA 5G0WA 3BPSA 1U2GA 2KYRA 3RB8A 1ABEA 3WQRA 4JBGA 5LLDA 5CD1A 1EWKA 2WNHA 2YXNA 1AMNA 3I1JA 3PWTA 1IJKA 4UUQA 1KJYA 4BMVA 4PAGA 4A7PA 1Y8QB 3KXIA 4ESEA 4HFJA 4EDFA 1WOYA 4PLPA 1T6BY 2J5BA 4DA0A 4ZT2A 1NV8A 1HA3A 3F7NA 1ZLXA 2J5XA 1NNI1 2IOHA 5K9ZA 3S2FA 5AOCA 1Z4LA 2QJFA 1BJTA 3LLSA 2PX4A 3GB9A 4O1MA 5BOSB 4IGFA 1UWLA 2NZWA 3WGNA 4WOJA 2PWAA 3Q87B 3GG2A 3EXFB 4F06A 5IRCD 2Q5QA 1WTCA 3F3YA 4PNZA 2HCJB 1WZCA 3QKUA 3GD5A 3GLIE 1A04A 3EEQA 3BVPA 1G5RA 2R96A 4G09A 3G2KA 1MC1A 1DCMA 3CVOA 4LRQA 3UCXA 3P8ZA 1T1EA 1BWSA 2YYAA 2BFFA 1HRKA 3F96A 1B76A 2J7PD 2O57A 4YP7A 4EG4A 4ZMBA 2OBYA 3DDWA 3P26A 1YQQA 2I6GA 3PCXA 4RZQA 3NAZA 5B30A 4Z1OA 4XD2A 4O4HB 1BN6A 4KSBA 1EBFA 2P1DA 4RY9A 2BISA 5ISMA 2VK2A 3S8MA 2QYHA 1ORRA 4UD2A 2RMKA 4JGBA 5JH7B 3ZQ4A 4DSAA 2IHJA 4IFTA 5G1NA 3UXMA 2C20A 3NBMA 3OZVA 3LPCA 4NEHB 4AG5A 3MTJA 1GZ5A 3ESRA 3TW6A 2JBWA 3EZGA 4A8JC 4WNYA 4HEJA 3KB1A 4TZTA 4BO0A 1G4UR 3HKBA 1GR0A 1G8GA 1I01A 2FSVC 1KSFX 2PT6A 4IDEA 5JEDA 1W1IA 2P9CA 3FTNA 1SBQA 4FZVA 4BNMA 2ORVA 3QKRB 4CKYA 1F8GA 3TLMA 4P0TA 1X42A 5CLLA 1T5TA 3DGFC 1XTIA 5BWBA 4JOSA 4GM4A 9LDBA 1EK1A 2IP1A 3D6UA 3DOCA 1FNCA 4H1TA 3MCAA 4J16C 2BI4A 5CJ2A 1S2GA 5DBIA 5JROA 2WU0A 3OX1A 821PA 4MS1B 5CB4B 3L1KA 4FKMA 1N8SA 4DA6A 2WSBA 5EJ4A 1YV9A 4EVQA 2CV1A 4EGQA 1L8QA 3BMOB 2PHZA 2AOWA 2X1MA 1GIAA 3OTIA 4Z4IA 4LJSA 2IHUA 4WXPA 4HAYA 5LIRA 2X0IA 3AQ4A 3CX8A 3OZTA 3G02A 3RIEA 4C2AA 5AJUA 1VGQA 2Z6UA 4Z4CA 1PQPA 1Z0AA 2PZJA 3M5PA 1AGRA 3IUEA 2J07A 2J31A 5DX0A 3W2IA 1C81A 3RYCA 1XO1A 4MQBA 1IY1A 4AZTA 2IU0A 3HBJA 3FOCA 3TCKA 2WFLA 4E2XA 1ZN2A 1MOPA 1NI4A 1KEVA 3WMRA 2HBQA 4X7PA 5J4LA 3DBLB 3Q2OA 5H80A 1M1YE 3J7TA 4UZSA 2XCSB 2JFXA 3WJ2A 2H2DA 4JB2A 2HO5A 3EMDA 4KH0A 4OFZA 2FK8A 2ZRGA 3WLTA 4CLHA 4JT2A 1BVHA 1UT6A 2WV9A 2VP0A 4NQRA 2NXWA 4TKZA 3EDOA 4QO8A 5A4FS 2LV8A 2X77A 3W4JA 1NMEA 2C0PA 3JQFC 2NNWB 3CLTD 1E0KA 1KNXA 1QUFA 4B0PA 1W4AA 1KY2A 4BLTA 2AFVA 3ESYA 3BWEA 5AKZA 1W5TA 3NRJA 3VU3A 4ZGWA 2QJRA 1R50A 2DUNA 4KAXA 3RS5A 4YMVA 5K0TA 3HJBA 3I2JA 2BM1A 4OHFA 1JDSA 3MILA 4QEZA 4Q4LA 4DPMA 2GJ9A 3BJRA 3OX4A 4Y9SA 4AJOA 3H17A 3UMCA 1OC4A 1O4VA 4WA8A 1CX9B 3P9KA 3SHWA 3PQ8A 4EA7A 1BGXT 3SP1A 1SR8A 1PGOA 3EAFA 3EA4A 3FR7A 4WFKA 2NU8B 2EKLA 3TZQA 1WW3A 3VR5D 4CGYA 5E6RA 4Z4HA 1TA0A 5FBVB 2BR4A 2MYTA 3HNPA 5DYNA 4JI8B 5DP2A 2W6PA 2BI8A 1H66A 1V37A 4C1NA 1HE8B 2P2LA 4HH3C 3CONA 1J00A 4D3ZA 2PBZA 3AEKA 3DMFA 1FMTA 5ICMA 4R31A 4YHHB 2R2GA 3EF1A 3B12A 3IJPA 2PA3A 3A3NA 5E6SA 4C0LA 3GEDA 2JJ8A 4P5PA 5MDHA 4HTFB 2PCLA 2A6PA 4MPPA 5FKJA 2F17A 1HUQA 1YR9A 3VO8A 2CFSA 4MWCA 3OICA 2QYOA 3OMXA 1ZX1A 5EI5A 1U7DA 5FWAA 3EG9B 2FEOA 5AW0A 3AWDA 1V5WA 1XROA 2P68A 4M9SA 1P3Y1 1VL5A 1P9OA 5JLAA 1ZC4A 1T36B 4BDSA 1T2NA 2PUJA 2R8BA 3DPUA 2Q7XA 4MGIR 1K7SN 1D2HA 2FWAA 3ZDBA 4PIPA 1YB4A 1Y98A 3VUEA 1M2NA 1P62B 2C2OA 4G9EA 4ENTA 3VU0A 1T1JA 1OH5A 2DPMA 2EV9A 3BMCB 3UMRA 4YEDA 2QZPA 3WLQA 1DBPA 2D0IA 2HO4A 4LUCA 1OPXA 1VE5A 3I34X 4RZ3A 2WYVA 1PK7A 2X13A 4IO1A 3PC6A 3SD7A 1GPYA 3I92A 4HX5A 1S6YA 2VDJA 2XNJA 1XDDA 3GRZA 1S2IA 2HF2A 4RTJA 1SBIA 1U1IA 5BQFA 4UCFA 3U7FB 2ECFA 1WX1A 2Z3WA 4EJSA 5JC8A 1QP0A 2V45A 5FTJA 1BWQA 4DCOA 1AZSC 3DTVA 3LO5A 3HJFA 1N2EA 2H6EA 2UZ0A 4MA4A 4R2WA 2IS4A 4GXQA 3FNEA 3D7KA 4MRMA 5F7ZA 3B51X 4BAZA 2XPCA 2PKWA 2Q4RA 3WRXC 4EY8A 4D92A 4PHCA 1P1BA 1SEVA 1SUDA 2A1IA 2O50A 1QS0B 5LQKA 4GZLA 4QOJA 4UCXA 5IBRA 3U37A 4MUIA 4BIIA 4ZJUA 3A2LA 5KKCA 1FOEB 1TGVA 4RLQA 1KOGA 2P3OA 2WIKA 1E9AA 3WGLA 1T0BA 1I9CA 2BR3A 5CEJA 4ENUA 2CN1A 2JZCA 1AV7A 4DQVA 3IELA 1H1DA 3THWA 4DJTA 1PJ8A 3INRA 4MVJM 5E4YA 1KWGA 3MYYA 4AN1A 4BBAA 4ZQFA 5L4LA 4OSPA 1E4EB 4QG7A 4F60A 2GSDA 4UOEA 1NQ5A 1NOIA 1AQLA 1T5HX 1UXIA 4LHXA 1Z4MA 5DTRA 3GPCA 2Q4BA 2WE8A 5FBWB 1MGPA 4JWKA 3YASA 1Q7CA 1KFBB 1NJ6A 2ZYWX 3LL7A 1BE6A 5HZKA 2QMEA 5GM2A 3DZCA 3WGHA 4D0GA 1W87A 2ZJ0A 1PJRA 2BSAA 4B09A 1O96B 3O91A 3Q7TA 4LQ4A 1NU6A 4KHZA 1U0GA 3CISA 2GTPA 1RCFA 3JAMA 5F51A 1XD8A 2A1UA 4ZVTA 2D4HA 5AUPB 4Y9RA 4X84A 4KE8A 5P8WA 5ALFA 6AT1A 4CKZA 2VDUE 3OAAA 2JHFA 1EB8A 2VHEA 3P96A 1CZHA 1PIWA 1CG6A 3PFIA 2HIHA 3WS7A 4DYVA 1RLJA 5LP6C 3M6MD 4XSGA 3K9CA 1SXJB 3E9NA 1HQDA 1NMSA 3V1LA 2ACVA 1J42A 4ZCSA 3VAAA 3JAKB 1C1XB 1S3IA 2AW3A 2R6JA 4LYGA 2RIRA 1FSPA 3JU3A 3L18A 2EXXA 2P9HA 1IN6A 3GVHA 3H05A 1MR3F 1ISRA 3R23A 1HQKA 1DG1G 1QOPB 1R0SA 1UIMA 1NUSA 1EJ6A 3QXSA 4G0QA 2Y0CA 2P2YA 1L7RA 1WD5A 2CNWA 4FC7A 4IEEA 2DMRA 3MHPA 4HNAB 2ZIXA 1VLLA 4ZVRA 3Q12A 5A4AA 4B6JA 5JAOA 2VTBB 1DRUA 3I61A 3HR8A 3H2ZA 1RJEA 2MSNA 1JSZA 1NT4A 1DBQA 1LNSA 2JEYA 2A7XA 3ESXA 4CNQA 4G0YA 2FETA 4UEWA 1EVJA 2IDKA 2PGLA 4RK0A 3MTIA 1YL5A 2Z04A 4CT4B 4BFCA 4DRZA 3QTBA 2NO1A 2VQ3A 2OM6A 5BWNA 3IH5A 3VPFA 4MUAA 1G8KA 3U1VA 4CL2A 5KYUB 2A1TS 3AKEA 5B4VA 1FVXA 2NVWA 1LDBA 3RUEA 5C9ZA 4QDKA 5CT4A 1E7QA 1TIKA 4ZYXA 1V1RB 1PKEA 2HBYA 2V1XA 5EHXA 3K4HA 1YU6A 3OUUA 4MV0A 1R8YA 4IXMA 2E87A 3H5WA 3N76A 1N9GB 5ALEA 1G2PA 2DY1A 5IVPA 4JLOA 5F77A 5TQ2B 1QO7A 2DT8A 3A3OA 5AJYA 3STHA 2D1SA 2GH1A 4F5WA 3IAM1 3BILA 1OROA 3VR0A 1XRQA 5KBYA 1RWXA 3BCSA 1ECJA 4J29A 3H6GA 3PUHA 3EQZA 2LR0A 3CB2A 5DNYB 5EIXA 2PQ2A 1NW7A 2G17A 2H7VA 3CLRC 4GOXA 4QVKA 4C4YA 2HA3A 4E88A 1GLNA 4EJ0A 3FB4A 3OTQA 2BBWA 3BXFA 3C87A 3E9YA 3JZMA 1WBJB 4G41A 3QF7A 3ZGOA 1OT5A 2PS3A 1XU4A 1E9SA 3F6BX 5KNDD 2GNAA 3HXMA 4OHZA 2IXAA 3GEIA 3RS3A 5TARA 1BFDA 2ZYGA 3UHFA 3NCTA 2IIPA 5K8TA 4LECA 3DE6X 4HPWA 5IKMA 1TVEA 5H83A 3Q41A 2RARA 3A6ZA 1I3CA 1Q7TA 1SXIA 5DW0A 3AUAA 5H59A 4YQEA 3T7TA 4B81A 2CVQA 3DE2X 3DEKA 1YE3A 3BWYA 3P2YA 5H82A 3D1JA 4BTVA 5JCJD 2ZE7A 1BMQA 4EOGA 2QIPA 3I64A 4MKFA 5J43A 3HGTA 1DKMA 2WLSA 1I7QB 3JAKA 5HQJA 1FRQA 1JEQB 5CJJA 5A9RA 3CNNA 4ND7A 1ISMA 2ROQA 5GWXA 3HABA 4C03A 4AZSA 5I8ZA 1GPMA 3O8DA 2H92A 4JOBA 2J0SA 1SG9A 5SYAA 4RHUA 2P4UA 4BFTA 4BFZA 1N0WA 3TEFA 4ZTZB 1G6OA 2YWEA 4MA5A 4A2WA 3JZFA 4IMPA 1XDWA 5LQJA 1NNSA 1RRMA 2LCQA 5A3VA 3ROFA 1NVVQ 4DIBA 2BMAA 4IJMA 4MQFB 2EBFX 4MS1A 1QONA 2GLXA 4J2TA 5LBUA 4EEZA 4A15A 3J7AC 1Y7HA 2FCAA 1RC0A 2ZVJA 4D0SA 5K7SA 5E4FA 5DP1A 1ZIPA 2FWPA 2WYOA 1ZRHA 5E3IA 5EIFA 3GJ7A 3T5CA 4DBLC 5H9WA 1HE4A 2MYUA 1NQUA 2P79A 1IPFA 2RC5A 1TTTA 1QGYA 2OBFA 3C0KA 3FRIA 3JQFA 2PXXA 5IKEA 2GEKA 2I6UA 2R4TA 4YV0A 4O08A 4PQYA 5DOZA 5INTA 5KJCA 5AVJA 2WUFA 2W6OA 5HOQA 2EJBA 2AN3A 3E9MA 4DA4A 1RKQA 1C4OA 1T8SA 2Z2KA 3HKBB 4MGZR 2PKQO 2IT1A 1LJ8A 3X44A 4D3XA 3RLFA 1B14A 1O08A 3OFKA 1BGWA 2GPTA 3HO8A 4I6GA 4WCDA 1BX0A 3KSUA 2GETA 3WNVA 1FX1A 4W1QA 4HBZA 1I5OA 5BN4A 1E1CA 1F2TB 3D4BA 2P4HX 3BSFA 4JJIA 5LYJF 2GM9A 1W36B 4H4EA 4ZT3A 4DXDA 1SRRA 2AFIE 3F6PA 4RTLA 5C3MA 2VNAA 3TZBA 4CHGA 2VJDA 5EXSA 1Z45A 3PNLA 2FMHA 1CY2A 5B5SA 1Y1LA 1FFBA 3OOJA 3QLVA 4KJZA 1H8EA 4WESB 5F1PA 5TLSA 4M0LA 4JP3A 3OFVA 3KUUA 3I2KA 4ZO9A 3GVIA 4IX9A 4W63A 1Z2AA 1P45A 5ALSA 1E1MA 5K4AA 4YYZA 5AVSA 1N0UA 2PZLA 3BH7A 1PCXA 3VI4B 5B4UA 1QDUA 4QUKA 2FFJA 3WIEA 1CVLA 3PC8C 3HUEA 3ICVA 4XFJA 4KP7A 3GEEA 3OTOB 4UVDA 1HETA 4CDGA 3EZNA 2DVMA 3ELBA 4LHSA 3KUDA 5AKGA 3THSA 1WRBA 4EH1A 1SHUX 4ZQEA 2YHBA 4MJ3A 4CMGA 2WM9B 2DPLA 4N0MA 5I9TA 1ETUA 4MQ4A 2KX7A 4JWTA 1IMOA 4XFKA 5A4JA 3M7IA 3SCZA 2PUWA 1PFKA 1QLJA 2L18A 4I55F 1TD9A 3T5TA 4G0ZA 5CYPA 3ZWWA 5JARA 3Q98A 5FUQA 5HZMA 2E2WA 3QLJA 4NZPA 1EH5A 4UXHA 2IEYA 4NPAA 3LLVA 4QDXA 1A4IA 1YUNA 2DJ5A 3GG9A 1SKYB 2IYRA 1EFUA 2QTWB 1P7YA 4RV4A 4XCXA 1SVUA 5TXGA 3TO5A 2BBSA 2HDHA 2RBGA 3TQHA 3FHLA 3VOAA 2C31A 2VHYA 1UCFA 1X7YB 1N2HA 3KUKA 3PSHA 5JSYA 1FLAA 3AERB 3MJDA 4X3OA 5ALUA 3IHWA 1U2QA 1ULSA 3KT6A 4E2WA 1T9KA 1KYXA 3GRPA 3DAPA 4G4GA 4RF4A 1N2BA 2FTKE 2V8OA 3R75A 1YRLA 2HU2A 3LPNA 3JYQA 4BKMA 2VEDA 4JENA 3RC8A 4JLDA 1L5GB 4W5NA 3SX2A 1QRTA 3ZCQA 3MWGA 4MUXA 1ODTC 2JJQA 4Q7KA 1QANA 4XUEA 2AG1A 5CU7A 5ALTA 4DTIA 3O2QB 2YY7A 5AH0A 5D5HA 2QKYA 3ADBA 2O3QA 3P9CA 3BRSA 2XODA 2V7XA 1IDOA 4UFNA 4AULA 1UP7A 1M72A 4WW0A 2CJXA 3NATA 4GX2A 1QZ3A 4EF4A 3FH0A 4O5AA 3X3HA 2WJJA 4J0CA 4MYUA 3RS7A 2OGZA 4XRRA 3PNQA 1NW5A 4DLSA 5A1TA 3T0GA 3PICA 5KSYA 3NHYA 1UZMA 3CEHA 3H2IA 2GB4A 1KJ9A 7REQA 3MBIA 1BKDR 1P7WA 4RK5A 4LG1A 4ENSA 3TMAA 4A2CA 4QTYA 1F3LA 5FWXB 4QGHA 1CUBA 2YS7A 1LRJA 4PZDA 3VZDA 3BRWA 4K1XA 1XZAA 4ESHA 3DWGA 2QXYA 5DI9A 1P4HA 4MQMA 5C51B 2OCLA 2QAJA 1FYDA 4BO6A 3WL6A 2RGAA 3L02A 1G7TA 1XDGA 2RH4A 4L6AA 3VR4H 5TMPA 1TMKA 3QPDA 4ZYZA 1VCNA 1PG0A 2QVBA 4KFUA 1Z0IA 4DPKA 1M8GA 3IQIX 5DV9A 5AVXA 2JFHA 1PWZA 1QGAA 2OENG 3TEMA 1VBMA 4A3SA 1RNLA 1YIOA 2HWYA 2QXTA 3ZV4A 5JVDF 1VZ2A 3PR2B 2NZXA 3RQIA 3QEBZ 5CDFE 3IMEA 2NU8A 5D1NA 5CCXA 1C3XA 1OX5A 3QHAA 1SG6A 2QVYX 1MAVA 4GVLA 3GZNA 3VSEA 2I2AA 2FE4A 3NHBA 2WFZA 1RLTA 4GQIA 1EINA 1VMKA 4ZZ3A 1M34B 3FGPA 3PXCX 3QEMB 4DCJA 4F2WA 1UQUA 3G2MA 2JGNA 3L9XA 3AHJA 4I55B 5L8VA 2IP4A 2R8PA 3B53X 3LCVB 1ZOSA 3AIMA 2H51A 1FDTA 3OEWA 4KUHA 1HYHA 2W8BB 2AEEA 5LB2A 3TD9A 1B8UA 2D13A 2H5JA 4EGAA 1DC3A 3BUSA 4AY2A 4C6SA 2PUGA 4PGAA 3ZX4A 1L7NA 1RJGA 2GLTA 2EX0A 4TT3D 3LV8A 3IQHX 1QH9A 2YWFA 4RELA 2YIVX 3FWHA 3HG7A 3KAPA 4LJ5A 4RQTA 3NX4A 3IHKA 4IDGA 1U2EA 3PRKE 4FMBB 1V4BA 2PUAA 1N1EA 3DW3X 3CN7A 4HGYA 4L0DA 5AHKA 3UICA 1Y5LA 1A9XA 1QO0D 3CRVA 1PJ3A 1YZGA 3U81A 2P2NA 1DAIA 2G1AA 3KZMA 1ULHA 4Z2AA 4LBYA 5G4LA 1A97A 2VO1A 4QYSA 4US0R 2EJWA 1H8HA 4FS8A 1ZOIA 2XB8A 4ZV9A 3OFJA 1YKSA 2ZPAA 3LF2A 3HRIA 2WFMA 2JNWA 4ZAXA 4D44A 2V74B 1IPHA 4G97A 4PTZA 4KB5A 1HGXA 1YQ9A 3PQ7A 4WECA 4A2QA 2BFCB 2PSFA 4ZTBA 1JNYA 3W5CA 1A9SA 1U0NA 3GPDG 5JNVA 3M2TA 1GFSA 3IEMA 5D51S 3S2IA 1TTHA 4JLVA 1WZ2A 4HWKA 5ESRA 1PLJA 1UBCA 2Q62A 2BEKA 3PUWA 4NK4A 4RK1A 3MUFA 4FT2A 3H1PA 5AHOA 5BSHA 2QBYB 1KIFA 1RP7A 2C84A 2OFXA 2HMVA 1WXIA 3RBVA 3WKDA 3R3VA 2R6GA 1K5PA 3MRXA 2AD1A 2RE8A 1VECA 1X0VA 3QXCA 4N8DA 3EYAA 3RUAA 3CPEA 5BSKA 2GZMA 4M89A 4MGEA 2X0NA 1C3JA 3KE8A 1XVTA 4ZOLB 4BFVA 2ZUWA 1PJAA 4HYQA 2HCFA 4N12A 4WZBA 4DZTA 1CY0A 1NIJA 2ONZA 5EHNA 3V8PA 2EFJA 4Q4HA 2QW0X 3WHPA 1Q91A 2NUBA 4C7OA 2RHCA 2B8WA 1OE0A 3B2QA 3EBPA 3VPCA 3EDMA 1OTXA 4DNXA 2Q0XA 2YWJA 4PX5A 2FQXA 5JDIC 3M6VA 3C4JA 3TKLA 3ZE0B 2AOVA 1KSHA 3SEAA 1E6CA 4WKNA 4HGZA 1ND5A 4TRJA 5DI3B 2Y1WA 3ETDA 1S8OA 3G7SA 2OSVA 3Q85A 3VU9A 1FFYA 4ETMA 4HH4A 3JQ6A 4ZAVA 4JXZA 2D8MA 1GD1O 1RBYA 2ET6A 4JC4A 1S9DA 3UK6A 2VYQA 1OI2A 2FQ1A 2H18A 1HYQA 5F4BA 1SBYA 1ICEA 4MHSA 2XXBA 2GPJA 4IDCA 4JK3A 4D4GA 5E7JA 2YTZA 4PZ0A 4QXPA 5EE1A 4E5PA 2YNMC 3C3MA 2W8BA 2XGSA 2COKA 2Q3DA 3PDCA 5DNWA 5FI1B 1GQYA 2BJVA 2ZG6A 3C3DA 3N0RA 3NALA 4KLCA 1WSWA 4F4UA 5BORA 5C5DA 3PQ2A 1PGNA 2RI1A 3WRVA 2F1JA 1QRUA 3P0FA 3WWDA 4MAMA 1JKIA 2XE6A 2HCRA 3PHBE 3B60A 3Q0EA 4CG3A 1SB8A 2Z8YA 3P1JA 5C4MA 3L40A 1RTTA 1U9ZA 3T1TA 1O87A 1RC8A 3LE8A 1SZDA 1OI7A 5FTWA 4UDOA 5GZ3A 2XNKA 2Y1XA 1EXVA 3NTUA 1UODA 4NX2A 4LY0A 4AJ4A 1BHJA 9LDTA 3KOWA 3KKEA 4K6GA 5C8XA 4FS3A 2HU7A 3AEXA 3ASYA 3Q0IA 4ZEWA 1RVV1 1WUHS 2F9FA 3GCXA 2P6MA 1R8JA 3UAXA 1T0HB 2PNFA 2CB9A 2AVNA 1M1ZA 3EDCA 1KZGB 3GWZA 4O2BF 4PAMA 1E98A 1IH8A 1R12A 2Q0HA 3AC0A 3EPPA 1PU2A 1S2NA 4LZNA 1JVNA 4M60A 2ODTX 2QE6A 1G5PA 2R751 4PAQA 1CRWG 1E2MA 2ZP1A 3UMFA 4ALIA 4DQUA 3V4RA 1M67A 3DHWC 3F5FA 1YZ3A 4HAOA 3R4VA 1U8AA 4PR0A