4ZZ5A

X-ray crystal structure of chitosan-binding module 2 derived from chitosanase/glucanase from paenibacillus sp. ik-5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
HNLALNKATATSSIETAGHEGDKAVDGNAATRWASAYGASPQWIYINLGSTQSISRVKLNWEDAYATAYSIQVSNDSGSTPTNWTTVYSTTTGDGAIDDITFAATNAKFVRVYATTRATAYGYSLWEFEVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of chitosan recognition by CBM32 carbohydrate-binding modules from a Paenibacillus sp. IK-5 chitosanase/glucanase
pubmed doi rcsb
source organism Paenibacillus fukuinensis
molecule tags Hydrolase
molecule keywords Glucanase/chitosanase
total genus 32
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature ec 3.2.1.132: Chitosanase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4zz5A00
2WUHA 4OUEA 1OT5A 1ULOA 1GOFA 4CUAA 1JU3A 4A3ZA 1YQ2A 3NRUA 2RJ2A 1US2A 5LA0A 2QQIA 4JHZA 2J1UA 3VD7A 4PT6A 2WO3A 1OF3A 1NKGA 1PX4A 2C26A 2W1WA 3LQCA 4GZ9A 4ZZ5A 1JYXA 5JR2A 4YPJA 2Y6KA 1F4AA 2EIDA 3ECQA 5LA2A 5JXIA 2VZOA 3CMGA 1SHWB 2J22A 1KEXA 2WN3A 2WZEA 4QDSA 4UI9L 2W3JA 3I2JA 1XPWA 3GM8A 4DXTA 2J1EA 1CZTA 4RYDA 1TVGA 2YG0A 3UESA 4DEVA 3P6BA 2Z4FA 2VZRA 2BGPA 4QPWA 2XQXA 5C70A 3W5NA 3I3DA 2WAOA 2HLEA 2EICA 1UY3A 4W4ZA 3ACHA 3T2PA 4P5YA 5EJZB 3D3AA 3K77A 3K46A 3DYPA 4ARYA 2YFUA 3BGAA 2E31A 4KMQA 3MO4A 2W1QA 2VR4A 4BXSV 3LEKA 1W99A 4OMCA 2KD7A 2E32A 3SEEA 1JHJA 1GNYA 1XNTA 2EIBA 3NJVA 3UETA 3A23A 1NUKA 2E33A 5B4NA 1UY4A 3BN6A 3WF4A 3OB8A 3WNPA 5FUIA 2VZPA 3FHQA 2WBKA 4W50A 4XUNA 4E8CA 2VL4A 4A4AA 4A44A 2W91A 3OGRA 3K4ZA 4P00B 1L7QA 1RYYA 4KI5M 2VMCA 3K75B 1GUIA 2E26A 3IIIA 2W95A 4JKLA 3I3EA 2X05A 2VTFA 2VCAA 2Y6LA 4QX0A 5IFTA 5IHRA 4LQRA 4QB1A 4MADA 1US3A 2QQJA 5I0DA 2Y6JA 1GU3A 2ZEZA 3J7HA 5C7GA 3WF3A 4A41A 4QDQA 3UNPA 2W47A 5JXGA 3ETPA 3LPGA 3WF0A 2VZUA 1IQDC 1W0NA 1DLCA 1NAEA 3K4AA 3WQBA 4XURA 1I5PA 1UXXX 2QQOA 1JZ6A 3T0BA 1JYWA 5DQ0A 1W9WA 5F7UA 2VC9A 4BDVB 4L0PA 3PUIA 2ID4A 5EIYB 2J1TA 4UOJA 3T09A 4QX3A 4MGQA 3FL7A 3HPNA 3I2KA 2ORXA 3C7GA 1OF4A 1K42A 1LNSA 3VD4A 1K12A 2B9VA 1WKYA 4DXRA 4OMDA 4RN5A 1W9TA 3I2GA 2ZXQA 3MBWA 2WO1A 1MPXA 4DXSA 2RVAA 1JZ4A 4CVUA 2WDBA 3C7FA 1H6XA 3CDZB 4QAWA 3SEPA 3FN9A 4ZY9A 1UY2A 4KWUA 4MOAA 1ULPA 1UYZA 3IB3A 1UMIA 4ZZ8A 3VD5A 2CDPA 3OG2A 3THDA 5CZKA 3WNNA 3K4DA 2VZVA 2ZEWA 2C4XA 3T2OA 3NQHA 4Z2AA 2W46A 2WO2A 1DP0A 3E1F1 1F4HA 3I97A 3NJXA 3P1IA 4QX2A 1H6YA 5IJRA 1JZ5A 3FHAA 3SKVA 3OGSA 2J7MA 3EYPA 2BZDA 3T0DA 3T08A 1UXZA 3IAPA 1PX3A 2X10A 2PQSA 3WF1A 3CZUA 2WYSA 2Y64A 4AAXA 5EJ1B 2YC2A 3WF2A 2VZ3A 1O59A 5LCWL 3C7HA 4M4PA 2W1UA 2VQTA 3A21A 2WQ8A 4M4RA 1HN1A 4OZOA 5DMYA 5DN2A 3IAQA 4GWIA 4DUVA 2J1RA 5LA1A 1O8SA 1UYYA 3VDBA 2JDAA 2WABA 2YB7A 2V4VA 1UWWA 5IYYA 3MV11 3WNLA 4W8JA 2Y6GA 4CUCA 3THCA 1JZ3A 2XONA 1UYXA 4XZUG 2VO5A 4HG6B 3OGVA 3ACIA 4LKSA 3GDBA 2DDUA 2VM9A 4QDRA 2X09A 3HJRA 2VQUA 3MUY1 4ARXA 5C71A 4JKKA 1OD3A 5G05L 3EB7A 4DEQA 2VJXA 4E8DA 1GMMA 2YFZA 1SDDB 3JXSA 2QBXA 3C7EA 3OEAA 3CQOA 1L7RA 2R7EB 3OBAA 2W1SA 2VCCA 4QX1A 2RV9A 4A6OA 5IFPA 2QQMA 3LEIA 2LS6A 3CKHA 3MUZ1 2W87A 1CZVA 4CU6A 1CZSA 1XNAA 2B4KA 2VOTA 4ET7A 1W8OA 2VMDA 3F2ZA 1XC6A 1NX9A 2Y6HA 2DCKA 4A42A 4PF1A 5J1XA 2WAAA 3VDCA 1O8PA 4XUPA 1GQPA 5B4XA 3WSOA 3CIHA 1EUTA 2W92A 2VMEA 1W8NA 5CYYA 2CDOA 3HN3A 3OEBA 2J1AA 2ZEXA 2LW8A 1UMHA 2VCBA 5JMOA 2J1VA 1EUUA 4JKMA 5JXJA 4BJ0A 3T2QA 2YC4A 1DYOA 1PMJX 5HPOA 1KGYA 2EIEA 2VMFA 1UX7A 1GOGA 2QQLA 1PMHX 4CUBA 1TG7A 2XOMA 1BHGA 2V72A 3A7QA 1K3IA 4XUOA 3ZM8A 2HYXA 3A22A 4GWJA 2Y8KA 3HNBM 3PUHA 2BERA 3DYOA 1J84A 1UZ0A 4P08A 3SKJE 1JZ7A 1JYVA 3WNOA 3CZJA 4LHSA 3LEGA 2W94A 1T2XA 3GXUA 3HOBA 1UY1A 1JZ8A 3WNMA 3I2IA 4D0QA 1K45A 3ACFA 1W9SA 3AC0A 2QQKA 2ZEYA 3ACGA 2VZ1A 2W9XA 2WZ8A 3GGLA 4TTGA 1R64A 4A45A 2QQNA 3ABZA 4PQQA 4BK4A 2V5DA 2BBAA 2L9LA 4TXWA 4XUTA 5A1AA 3HNMA 3W5MA 2ORZA 3MV01 1JZ2A 3I2FA 4QB6A 4DUXA 4AG4A 4JX0A 2XHNA 5HXMA 1JYNA 2W5FA 3IDAA 4DUWA 1D7PM 2JKXA 2OKXA 4MGSA 3HNYM 1GOHA 3C7OA 2VZTA 1J83A 3WNKA 1P8JA 3DYMA 2JE8A 1UY0A 2JD9A 2J1SA 3T0AA 3WEZA 3LE0A 3HEIA 4ZXEA 4P02B 2WN2A 2VZQA 5JXHA 1OH4A 4BK5A 1CX1A 4CU7A 5DPNA 5JUVA 4MO3M 1JI6A 4IUGA 3DECA 4LPLA 4CU9A 4D8MA 4QB2A 2C9KA 3I3BA 4XVHA 3VDAA 2DCJA 2VZSA 3VD9A 3VD3A 1CIYA 4XUQA 3LPFA 2BGOA 1WCQA 3NNGA 4CU8A 3U37A 4FI9A 5G04L 3I2HA 1JU4A 3C8XA 1SG3A 4OYUA 4UAPA
chains in the Genus database with same CATH superfamily
1J3PA 1E5IA 2UWAA 4FPKA 4YGDA 1OT5A 3ON7A 1ULOA 3IZOA 4XIOA 3ZYPA 2TBVA 1YQ2A 5JSPA 3ZSJA 4YG6A 1HLCA 2D6OX 5K0UB 2VXJA 4SBVA 1X9PA 5FTTC 3DN7A 2WO3A 5A6XA 2C26A 1NKGA 2YU1A 5JR2A 1WCKA 4P9GA 3K2OA 1XNKA 3ECQA 2WO7A 2XPJA 1WZXA 3O1OA 3CMGA 1SHWB 4WVVA 4YLZA 1AYM3 3AJZA 2VNVA 3MLKA 2GMMA 3GJAA 2ZGQA 4XMAA 2HWD1 1O6UA 4Y5Z0 3H50A 3IKWA 1RVF1 2JG8B 2VVFA 3VKNA 4BYYA 4GB33 1AJOA 2QQVA 4JDNA 4JGZB 4DXTA 5C8CC 5HCHA 5ACA3 1MEC3 3SH5A 1VIWB 1C1LA 5FY9A 4RYDA 1QJY3 2JDNA 5FRAA 3L2HA 1PZ9A 1X36A 5CKMA 2A6YA 4UXAA 1AUYA 3TEZA 2GNBA 3LEMA 5FZLA 4GH4B 4RS5C 5D21A 3UKVA 2ZGKA 3OD0A 3LB9A 5EV7A 5J98B 1CPMA 3T2PA 4P5YA 2GNMA 5H9RA 1EV12 3T4HB 4I3PA 1SDWA 3BGAA 2WNUB 4KMQA 1NE6A 4EV0A 1H9WA 2VR4A 4AVTA 1LHOA 3IM0A 1AZDA 5FXVA 2TUNA 1W99A 3VBOB 5C33A 5DZEA 3R4DB 3WW1A 1OLRA 4COYA 1XNTA 2EIBA 2GN3A 5LATA 4E2SA 2ZGPA 5L9VA 4ASMB 3ELNA 1DQ5A 2BPA2 2K46A 3VL8A 4M0NA 2XJUA 4AYUA 5B4NA 3FE5A 2BP6A 3LAGA 3WG3A 1GANA 3WF4A 1XQNA 1O3SA 1LODA 2Z69A 5FKCA 3N35A 2GMEA 1K5JA 1GZWB 1H30A 2P1BA 1R081 1WW4A 4P9WA 4TYSA 3WG4A 4AE2A 3M7AA 5C5TA 3POIA 2HEVF 2GDFA 4DS0A 2RDQA 3RI8A 1QDOA 1IQAA 3S57A 4GXLA 5FKBA 3CNAA 4A4AA 1W9FA 4Y20A 3OGRA 1UO9A 2F17A 3PNAA 4OUSA 1CIWA 4XTPA 1AX1A 2ATFA 2CU5A 3RI9A 3SCGA 4R9BA 1Q8SA 1CWPA 2VMCA 4FPLA 1GUIA 1OPOA 5FLJA 1O91A 1LOGA 2CSGA 3AL6A 3ES1A 1RUD2 3MW4A 3VDDA 3E97A 4XDPA 3ZFGB 1RUC1 1HB4A 3EQEA 4MGKE 3AYDA 5CFCB 1XYOA 3KM5A 4NHYA 1SACA 2VTFA 1R1A2 2BU9A 2VCAA 3NV4A 5JI7A 1V0AA 1AR71 1TZOA 4O7XA 3OBTA 4D7TA 1RINA 2E63A 4FFGA 5IHRA 1BQPA 1EV13 4QB1A 3CBNA 3ZLIA 1KJRA 1GU3A 1L3JA 2Y6JA 1NY72 3M3CA 1X8EA 1CAVA 1NZCA 3PVOA 5C7GA 4A41A 3E6DA 3S7EA 1U0AA 4LBQB 4YM0A 1NQJA 4CDQB 3OGJA 1IQDC 3ILNA 1ENRA 3LSEA 5IAXA 3T30A 1AL21 1DLCA 5IAVA 2WSUA 1GQHA 1XE8A 4HSLA 3VV1A 3W9AA 3C2UA 1A8DA 2EIGA 3ZXAC 2WA4A 1CAWB 3LA3A 2P6HA 4Q4W1 2QQOA 2FCUA 1JZ6A 2C0ZA 4CDXC 3MEPA 3NJZA 1W9WA 1NE4A 2LRPA 5F6LB 3RQ0A 4O65A 2VC9A 4R4XA 4XBNA 3UGGA 5IT6A 2NP0A 1AR63 4L0PA 3ILRA 1W6MA 5EIYB 1JYCA 2J1TA 4UOJA 3T09A 3VHOA 1O5LA 1NCQA 1LCLA 2R072 3M8LA 3WT3A 4BQ3A 3ZSEA 4RR3C 1SBEA 3IIAA 5GALA 3C7GA 5FV3A 1PK6C 1LNSA 1U5YA 4A7ZA 4HT1T 1WCSA 3QBQA 1DGWX 3S7IA 1DGRN 2B9VA 1YC61 4RHV1 4QXBA 5J7MA 1LULA 4R9DA 5FZ4A 4LO8A 4FFFA 5FLHA 1GZ9A 4ATEA 4K7JA 4L11A 2FMYA 2XL9A 4NIDA 1HRV3 4ASLA 1IOAA 1J3QA 4NIHA 4UFHA 4YM1A 1VMFA 1AL23 5CIRA 2WDBA 2WZR2 2WSVA 4QAWA 1G8WA 3LWCA 3ZXJA 5C4WC 3FN9A 4Q4Y2 4ZY9A 2Q8EA 1C5HA 1QXPA 2QZ2A 5IVEA 1PZ8A 5L7OB 1EV11 1RTVA 4MOAA 1ULPA 1QJY2 3IB3A 3VD5A 5ACA2 5FYUA 2CDPA 4AQSA 1KRIA 1HV0A 2P3YA 3VUOA 1OLMA 1TME3 1SZBA 4LBJA 1ASJ2 3GZEA 5FZMA 3VBSA 1DYKA 3WNNA 1UZZA 3I4IA 4FXKB 4QKNA 4FAHA 2XXZA 3NQHA 1CESA 1DP0A 4HPKB 3E1F1 1D4M1 4LORA 4LK6A 5A3LA 1V6KA 1ZBE2 4J25A 4GAZA 1LESA 4H7MA 4Q4W2 1PIV3 1OQDA 1SFYA 1XU2A 4QX5A 2F6BA 2JG8A 5JOWA 3O1TA 4FOYA 4KWLA 3WCRA 4Y24A 1H1AA 2VBDA 3SKVA 1V9U1 1VMJA 2UYAA 2VBPA 1RB8G 2EALA 2BZDA 4NHKA 3BTXA 1QXRA 4D69A 4YVWC 5EHDA 1DZRA 1B35A 1YJLA 3BB6A 4W6WA 3T08A 5K4LA 4N9IA 5BNPA 1UXZA 1JHNA 1WMXA 5IATA 3IAPA 3AKTA 1ST8A 1O4ZA 2BDRA 1XJAA 2MEV2 2SBAA 5BXXA 2UY9A 2VE1A 3R6SA 3ZDSA 4JTNA 4SLIA 3NAPC 1YI9A 3QCWA 5L9BA 4B3NA 4Z92B 1AR81 3AJYA 1W05A 2RHPA 2Y64A 2ZS6B 3PUSA 1GSLA 4QGLA 1S4CA 4AAXA 2JG9A 2X5IC 4YZ3A 3HBKA 2YC2A 3NSTA 3DCQA 1F2NA 1GYKA 4YVWB 4TZDA 1I1EA 1NLQA 3C7HA 4M4PA 5C6CA 3N9PA 3QLQA 3VLBB 5FZCA 4M4RA 3WG1A 4CDWB 5BNOC 2R063 2ILMA 1W8HA 3D82A 4XZPA 1XE0A 3ZYGA 1OOPA 5K7PA 1SQ4A 1RUH3 4IE0A 1UZVA 2WFF3 1RUJ2 4GWIA 3TYJA 2ZMLA 5FP9A 4J6GA 3N7JA 1UYYA 5JAXA 4AW7A 4N43B 2FDIA 2JIGA 5ERLA 5CG8A 5FY1A 3PMSA 2D6LX 2YB7A 1DGLA 2VW0A 4PDWB 3T4VA 4XBLA 1OXCA 4ZXKA 1O7FA 3WUDA 1PMIA 4Q4V2 4EWAA 3WDYA 1BBT1 4QHBA 4UFIA 1LB2A 3OGVA 3VBUC 3VBSC 2QQPA 4NUBA 2WNVA 1RVF3 1RUG2 2O14A 2IXLA 1WMDA 1SLTA 2QVSB 4QDRA 3SMHA 2X09A 3ZN4A 4EQVA 5BNOA 2BNMA 1AX0A 4KGGA 5C9AB 3MUY1 5KR7A 4ARXA 1W2UA 1PZ7A 4XJUA 4KU8A 4QHZA 1NZIA 5G05L 3EB7A 3RJRA 3ST7A 4E8DA 2YFZA 3FLPA 4XBQA 4YGBA 4YGCA 4COZA 2A6ZA 3URFA 1Y9MA 3FMGA 1L7RA 1ZBA2 5LZ6A 5CFCA 2JEMA 1NOVA 3CL1A 1STMA 3RSJA 4RGAA 4A2UA 1VBA2 3KVBA 4JQTA 4BQ1A 4D7SA 3NKTA 5EZWA 5FYZA 5IFPA 4KWKA 5KHKA 2BVVA 3KT1A 2Y6FA 2ZAHA 3LEIA 1QJZA 3TN91 4XQDA 1GBGA 4IE5A 2YUEA 3ZYJB 2B4KA 1TMF2 1VBE2 2VOTA 5LY2A 4URAA 2PHWA 4BLIA 4ET7A 2FMDA 4C90A 2VMDA 4K9SA 3ZX7A 1K5MC 4LO7A 4CDQA 5AVPA 5BNNC 2SLIA 4HMZA 5A7SA 3H8UA 4YW2A 2KM2A 5A33A 1M06G 5APAA 3ASIA 1Y9QA 3WZ1A 4AFDA 1DYPA 1ND2B 2HWB1 4PBOA 4PF1A 3VDCA 3KHCA 2B39A 2ZCWA 1O8PA 3ZDVA 4BWOA 3CIHA 1JMUB 2OW4A 1YFXA 3RZLA 2OVUA 2Q1ZB 3DPRB 3LSDA 4R4ZA 2XDVA 3H8XA 3FLRA 3LIHA 2VMHA 4BB3A 4AI0A 1PO11 2DCZA 4LXLA 5C3SA 4BMEA 1NY71 3MF6A 4N90A 4B7EA 1FNZA 2VMIA 3O12A 4YFZA 1UMHA 1NCQB 1AJKA 5FCCA 1RMU2 5JXJA 1FI2A 4JHTA 4RR3B 5CNAA 5DAVA 3GBGA 3T2QA 2IXHA 1KGYA 3U11A 2HWF3 1OURA 1W8UA 1LHUA 4XXPA 1AXZA 2QQLA 2Y38A 5F39A 2W39A 4QMAA 2HKXA 1JN2P 1RUF2 3PMEA 1TG7A 2XOMA 5KXEA 1W8TA 1VBC2 1IPKA 3PTYA 5GLZA 5F5CA 3ZM8A 2F4LA 5DXDA 2CTVA 3A22A 4ZS2A 5L19A 1RGSA 3EJKA 4P9JA 4AQ6A 2PLV3 3HNBM 3IDCB 1HXS1 3OF1A 4HANA 4G3YC 1RUH2 3NKGA 4HL0A 1JZ7A 5J37A 1WD4A 3D8CA 3PVNA 3G7DA 1BEV2 4B8EA 4CP2A 3CZJA 4Q5OA 1JYVA 1N1SA 3WQ7A 2DUPA 4OHZA 2ZTNA 2PAKA 3GXUA 1YQ8A 1VBD1 3Q8FA 4LMFA 3ZN6A 1JZ8A 5DABA 4NAMA 1X9TA 4WM8A 1LENA 1YFYA 2CYFA 2V09A 3KV6A 4HKWA 3O1SA 3BKZA 1LOCA 1Q3EA 1LHWA 4S2HA 2Y26A 3AZXA 4V1PA 5FPAA 3AP4A 3ACGA 1H9PA 1C28A 4PI0A 1DLLA 5JR7B 3ATGA 2JDZA 3EO6A 3LA7A 3P3NA 2PLV2 4AR2A 3ZR6A 4TTGA 2BOIA 5FFOC 4IEZA 2VW2A 4AEDB 1E5SA 4Q4V1 1XNBA 1NCRC 2ZX3A 1X82A 5FPUA 1KD7A 3NV3A 4H14A 2L9LA 4LBOA 4XABA 4R9CA 3CU7A 1H4GA 3NNFA 4EWDA 3DGTA 1SBDA 5FZKA 3E5UA 1CAUB 4RD7A 4GH4C 4IE7A 4RS5B 4AVBA 4H55A 2YGLA 2UWBA 4RQPB 4JX0A 5A3UA 4Y26A 2AENA 2XKPA 4OUMA 1JYNA 4Q4Y3 3MIBA 1XBFA 1CAVB 4O9EA 1FX5A 4FFHA 3AXEA 2JKXA 4XF9A 2R043 3MIDA 4FOWA 5KXDA 4LBNA 4FQZA 2VQ0A 1BVVA 4XFIA 4C0HA 4IE6A 5J09A 3RYRA 1P8JA 1ASJ3 4BM8A 1COV3 4CDXB 3T0AA 5FZDA 1HXS3 1NLSA 2HWB3 5M0TA 1SFNA 2DF7A 5KWRA 1VAMA 1ENXA 1B35C 3AK0A 1ACCA 3HAGA 3BVCA 2BFUL 4QQOA 1TMF1 4JVAA 1BLZA 2J42A 1NYWA 4COWA 1UCXA 2P17A 1UOFA 4BK5A 1CX1A 3PDQA 4CU7A 3FLTA 4AVCA 5DZFA 5F2WA 2YXSA 4I30A 3ZVXA 3AMMA 1EAH3 2D44A 5H9SA 1PGL1 3WDXA 4IGOA 3WCSA 3ZKUA 3N7KA 3FX3A 4XF3A 2CGNA 4NHXA 4Y1XA 4FFIA 4XF4A 1PM7A 2JDKA 4OI0A 1IS4A 3B9CA 3I3BA 3AKRA 4LKEA 1ND3A 3FUQA 4COVA 4F7ZA 1U5IA 5LASA 2ET1A 4Y1YA 5DG2A 1PO13 5CFCC 3LPFA 2XJQA 3AZYA 1UIKA 1W6OB 5T5PA 4AK3A 2I45A 3AP7A 4CU8A 3GJBA 3DV8A 3U37A 4R8HA 4OCTA 5KC6A 1JU4A 3J7LA 4C1WA 1R1A1 3KVAA 4S2DA 2P4EA 2YC0A 3KCXA 5LBCA 4BH9A 3NWKA 1Q8OA 3UT0A 5DG1A 5E88A 2D6KA 3M3OA 2RS53 3OY8B 5F2SA 5HV0A 1VLNA 5JOXA 1Z7S3 2WUHA 3N3HA 2LM3A 3MW2A 2QKDA 4A3ZA 2OT7A 3NRUA 2B9UA 1US2A 4GH4A 5LEKA 3GF6A 4X6QB 2YPJA 4C91A 1VRBA 4PT6A 4UW5A 1RUH1 1ZBA1 1C57A 1OF3A 3LQCA 4ZZ5A 4RGGA 1NA1B 5AVAA 3MF9A 4YPJA 2VBBA 4NOTA 2R061 3NAPB 3DPRA 2Y6KA 1IS6A 2PMWB 5CA6A 1ULGA 1TNFA 2VPVA 1LU2A 3N9LA 2P6CA 1REDA 2RM22 1KEXA 4AHWA 4FSJA 2WN3A 1H1IA 1CR7A 4QDSA 5F5AA 2X5IB 1WCDJ 2A6XA 2QNKA 3PUQA 5IW0A 1MZFA 3W21A 1W0OA 2D5HA 4UI9L 3VL9A 2NYYA 1DGRA 5A7OA 5C8CA 2YZ4A 5C5UA 4Y4YA 3VHPA 1MQTC 3GM8A 1V00A 3EMRA 3MIFA 1CZTA 1TVGA 5C3QA 3VBRB 4WVWA 2Z4FA 4DRRA 4BQ4A 4NAOA 4CPBD 5JIAA 3HBZA 3MGUA 2IVJA 1QWRA 3BTAA 3I3DA 2OA2A 2WAOA 4IEOA 4AVVA 5FWEA 1MZ5A 4XPVA 3D3AA 3K77A 5IVYA 1CAXA 2RMU1 1EPWA 1MQTB 2HBUA 3DYPA 4ARYA 4BQWA 4OHYA 2I2SA 3USUB 4H3WA 1YEWA 3J8F2 4NMIA 1D4M3 1XSRA 4L92A 4ZS3A 2RMU3 4BXSV 4QXCA 5CG9A 4XXAA 5A7WB 3LEKA 4OMCA 4PBPA 1W03A 2E32A 4FAGA 3TBDA 2HEYF 3M4FA 4FQ4A 1C5IA 4YW7A 5A6QA 4KG0A 2ZGLA 1JTZX 1G9DA 5A6YA 2WQ4A 3H1MA 2NM1A 1NUKA 4GWMA 1YXWA 4UYBA 2Q8DA 4ASKA 2EAAA 3TNQA 2Z2SB 4WBBA 5FZIA 4CXWA 5C9AA 4XFHA 1MEC1 1FATA 1VJ2A 2A3WA 4B7KA 3POSA 4Q0SA 2VCMA 5IK7A 1GLHA 5FUIA 5A3MA 2VZPA 2ES3A 1W6MB 4MXVA 3RMYA 1DF0A 3UGHA 3ME2A 2IVIB 1V6NA 2A7AA 1YHFA 2VL4A 4QQ2A 5GZCA 5A3TA 3DKWA 1ENQA 1H8TA 5JVVA 3WY6A 4A44A 1J1LA 5I8SA 5BNNB 3LDRA 3K4ZA 1O5UA 5ANNA 1RYYA 1AR61 2HWC3 4NN0A 2GC1A 2R062 3PVBB 2VG9A 3OGGA 4KI5M 2WC2A 4WV8A 1FPN3 3OD4A 2E26A 4FCAA 3WOGA 1LOBA 3IIIA 1LJ7A 2R073 3U4XA 2VU9A 4KH9A 2AC1A 1R1ZA 1VPHA 3DF0A 4JKLA 3KB5A 2X05A 4TLGA 5JZGB 3S0MA 4CDXA 4D7YA 4EWEA 4HXCA 2JD4A 1DDLA 5IFTA 1CGPA 1SLCA 3KD4A 5LK7B 2OZJA 2WNEA 1TQ5A 2QQJA 1IG3A 1PGW2 4B4QA 5I0DA 1GP6A 2ZEZA 1XSQA 4AI9A 4NPMA 4AQTA 3GBWA 3KF5A 5LB6A 3ZXLA 2IC1A 4Q0QA 4A7KA 1F35A 4LHLA 2A1XA 3ETPA 3LPGA 5FZ8A 3WF0A 2JJ6A 1W0NA 4BQYA 4IV3C 4NVPA 3K3NA 4CRQA 4PQ9A 4QPGB 4MG2A 1X50A 2ZAAA 1WLWA 4RR3A 5DUVA 1BBT2 1W04A 2E6VA 1I5PA 1JODA 4LA2A 4XQ4A 2ZA9A 1QJU2 4I3GA 5FZ7A 3SQOA 1PM4A 2R49A 2VECA 3VBHA 2PHRA 3T0BA 1HJGA 1JYWA 3J8F1 1NQDA 2EXKA 1YNAA 2C9AA 2OX0A 2BNOA 3CO2A 3NVCA 4K1ZA 4GKXA 4UF0B 2VGDA 4CYDA 1F9KA 1H2LA 4HPKA 4BDVB 1VR3A 2O0OA 3ZSMA 3RZKA 2JDHA 3U0ZA 3WP4A 4QX3A 4Q26A 3AL5A 1DQ6A 5FZHA 3AMPA 3E5QA 4MHUA 2ORXA 2ZZJA 3RWKX 1ZYBA 3JBG2 2P3IA 2VUDA 3QH7A 1K12A 2OQ7A 2CY6A 4GB32 3D6EA 4DXRA 1UPIA 4BPZA 1I9RA 2V5YA 2WJSA 3FZ3A 1W9TA 4AGRA 4JC1A 1FXZA 1VBD3 2YBSA 1ODMA 4FPCA 2WO1A 1MPXA 4QPIA 2EVXA 3H1WA 2R1DA 2WLPA 4MV2A 4YSFA 1RXGA 4Z8BA 1YFUA 5CKNA 3POBA 3NL1A 4JTOA 1UY2A 5DUUA 3AYCA 4D6RA 5F7UA 2QQUA 2RS11 4F8AA 3AVSA 1ND3C 1UNBA 2R041 4TN7A 4ZZ8A 1RUNA 1F8VA 2C24A 5CAZA 4LITA 1JYIA 1PK6A 3Q8EA 3WV6A 2DV9A 4MH0E 3ZFEA 2XHKA 1ZNPA 2W52A 3M70A 3PURA 4LK7A 4YVWA 3USSA 1TEIA 3AZWA 3D5OA 3VKOA 2CGOA 4BHPA 2Y34A 1LRHA 1PO12 3V0AA 1KXGA 2XL7A 1OFSA 5F1RA 2RM23 4XYXA 1H6YA 2A3YA 1LECA 1Y3TA 2RS32 3JD71 4RS5A 3WHUA 4NJ4A 5I0UA 1OUSA 2JG9C 2J7MA 4P5HA 3EYPA 4J1WA 5ISLA 5EYXA 2P37A 3ZO0B 2XLFA 4FPJA 1IS5A 1ZZ7A 2ZZQA 5FP8A 1UKGA 1W90A 1ZRFA 3MFAA 2PAMA 1O4YA 4GB31 2BEOA 1HDKA 2YPDA 2AZ5A 2B7YA 5ANQA 4DFSA 3CZUA 3H7YA 2OPKA 2XWJB 1UYPA 2WYSA 4Y5TA 5FYBA 3JBG3 4HK8A 2DCTA 5KHHA 3KS7A 1S0FA 4ISRA 1HRI3 1FAYA 1VB4A 3GALA 5EJ1B 4XEZA 1W2OA 2JXAA 2CAUA 2ZGMA 4MLOA 4YWAA 3WW3A 4FTEA 3HMYA 3M2MA 4PDWC 5LCWL 3DEMA 4HK9A 3A21A 4YM2A 3TN92 1HN1A 4CP9A 3BPSA 1ALYA 1AVBA 4PIYA 1DHKB 5DN2A 4NRPA 2VD7A 2QFEA 1YQ5A 3IAQA 4HSJA 1XNDA 5C3OA 1AYN2 5T3NA 5ABJB 1U12A 2J1RA 2WYFA 2ZABA 1O8SA 5DDJ3 5AC92 4E4SA 5LA1A 3OUJA 4OI1A 2BTVC 1DQ4A 2G19A 5FAXA 1R091 1GP4A 3B02A 3NNMA 3FUOA 3WUCA 3R05A 4KG8A 4ZKTB 5JSOA 1MZ6A 4CUGA 4HVRA 1QQP2 2PHLA 5IYYA 3MV11 2MEV3 1G9FA 2AREA 2PHTA 4FTBA 2HJIA 1JZ3A 4XZUG 1UYXA 4PF5A 3JB8A 1ZZCA 4OHWA 3KSCA 1S0JA 4WZFA 3ETQA 5DZGA 3GDBA 3ENRA 3N9OA 5BNNA 2VM9A 2WT1A 3HJRA 1A78A 2VQUA 1N1YA 5TSWA 5C71A 4UT5A 4FPGA 4Q1PA 4DEQA 4DY5A 4CEYA 5KBFA 1GZCA 3ITQA 3MPBA 1WW6A 3OEAA 1XOYA 3SH3A 4CCOA 1R093 2PTMA 1RUF1 4NRMA 4M3CF 3BU7A 3OBAA 1REFA 1OLME 3VBRC 3WVJA 4E2QA 4QX1A 4XFBA 2RV9A 2O1QA 2ARBA 4A6OA 3LIGA 5GLUA 4RFRB 4DB5A 5C9AC 4OZXA 5T50A 2QQMA 2ARCA 3WNXA 3UJOA 1AXKA 3UGFA 2DUOA 1VP6A 3P3PA 2G9ZA 1WCUA 2V4AA 1CZVA 3A0KA 4LEJA 1HXS2 1XNAA 2VH9A 1GWKA 2H6CA 2WL1A 2XKOA 1XXNA 3F2ZA 3POWA 4CXYA 1MS5A 4QM8A 1QIQA 4N7UA 4BA6A 1NX9A 2DTWA 1SCRA 2DCKA 3SISA 4I0BA 4QPGC 4XAAA 4KBZA 3U78A 4A42A 5J1XA 4CEWA 1CJPA 5FY7A 1JUHA 1YWKA 1ASJ1 2GALA 1KS4A 3VBHB 2G9FA 1EYBA 2D6PA 3DXTA 1G7YA 3KV5A 1W8NA 3RPQA 3AP5A 5CYYA 5FYYA 4CEWC 3M3IA 4CDWC 1AXYA 3WXPA 4MHRA 4Z82A 3J26N 1QDCA 3KQRA 4JRLA 1CN1A 4I0WB 4MX3A 4AFBA 5FWJA 3POFA 3RDIA 2GU9A 4BJ0A 1C8M1 5A1LA 1PMJX 1W6NA 3VZNA 2VMFA 4QM9A 3I7DA 2WNUA 5FREA 1PMHX 4Y5SA 1WLDA 4YVSB 3S5QA 2VUAA 4BQ5A 1LOFA 2VUJA 1ZBA3 4JRAA 3POEA 2OIIA 4N53B 4D6QA 5C4WB 1PIV1 1B09A 2V72A 5FZ9A 2WS92 1OKOA 1OH3A 3PU3A 5FP7A 1YUDA 3S30A 5LEJA 3H42B 3N9QA 4OI4A 1H0BA 1LTEA 3WP5A 4J1XA 2NN8A 3CJIB 4W6YA 1W8FA 4QPYA 2NMOA 1W8WA 1ULCA 4LIUA 4LO6B 2D6NA 2DVBA 4E2GA 1APNA 2JE7A 4LO4B 2BERA 1MS4A 3DYOA 1J84A 4QKFA 1PK6B 4RGKA 3USUA 3TEWA 2IZWA 1UD1A 2YGMA 4M00A 3LEGA 4JGYB 5LRSA 4CTEA 1N3PA 1R1A3 3O1UA 5EJ3A 3OYWA 3SC7X 5B2GB 3HOBA 3BYWA 2EXHA 2MHFA 1OBNA 4EYUA 5FY0A 2D3RA 1FMD3 1QXJA 4LIVA 4BIOA 4XHXA 3B9IA 1D4VB 4PI2A 3ZIWA 5FPZA 4QT6A 2XGXA 3ACFA 3WLUA 1W2NA 1QMJA 4AFAA 3IWZA 3DKQA 3AXDA 1S0BA 2EXIA 2W9XA 4LOSA 1MS3A 5KHJA 4XFAA 4LUKA 5D1IA 4HN1A 1UOBA 1W6PB 3IPVA 1R64A 3OPTA 3H3LA 3KT4A 2UWCA 1QEXA 3ABZA 1S2KA 1ZA7A 2RR13 4GMP0 4Z2WA 2FCTA 2BNNA 4TXWA 4CZSA 3VB9A 3LGRA 4L99A 3VKFC 3HNMA 4INDA 1YIPA 2ORZA 3VBFB 5IVVA 1JZ2A 3J8F3 3W5MA 3TOJA 1PVC1 4K8RB 4QB6A 2GP5A 1W8ZA 1TME1 4CEYC 3IDAA 3BTZA 4YW3A 4AFMA 3B93A 2D40A 4PLNA 2YROA 4BE3A 4CDUC 3HNYM 4YW6A 3VBHC 3B01A 4IEWA 3AZZA 1IPJA 4GQ7A 4OHVA 1D0HA 1W06A 3DYMA 2JE8A 5JZGA 5I8YA 3WEZA 1CJDA 4YARA 2JX9A 4YZ1A 3ZR5A 1C8M2 4P02B 1YCIA 3OBRA 3UJQA 2P5BA 2JKBA 2KR2A 4WVMB 4YG0A 4GULA 1MS9A 1NXD1 1PVC3 4BMBA 5K9YA 1QHDA 1DQ2A 2ZBJA 3ZKYA 2X5IA 2EF6A 5JMCA 5JUVA 1RUC3 1VB2A 1JI6A 2VNOA 4CCEA 5K0UA 4B4RA 4LPLA 5AFBA 3I49A 2BOJA 2ADEA 2LROA 4QB2A 2G1MA 2C9KA 4MVTA 2XVKA 3ZYHA 5HI0A 1WLTA 4UFMA 3VDAA 4GWNA 1RVF2 2WFF2 1OC1A 3ZYRA 3VD3A 3VD9A 3AMHA 3VBRA 2YY1A 3HD8B 2YV8A 1R083 1HQLA 4RSUA 4UF0A 5FLIA 2R042 1FMD1 3PTRB 4QXKA 4JGZC 2ZGTA 3NNGA 4JCKA 3NV2A 1IG0A 4FI9A 2ZX0A 3I2HA 1TME2 1PVXA 3ZYBA 1QJFA 2XMLA 1BBT3 3G6JB 1YFWA 2QJVA 2EA7A 4JGZA 4L8QA 4ATFA 1V6OA 4Q1RA 2GH8A 1E57A 2RDRA 4MGIE 4QPIB 4WM7B 3LCPA 2W2IA 1AR73 1HB2A 1GOFA 2IXJA 2ARXA 1JU3A 5CB7A 1G9BA 1EAH2 1SLBA 4XFFA 5E8AA 1L7LA 4AEKA 5LA0A 1WUVA 2DFCA 4JHZA 3PIGA 1RHI2 2J1UA 1RL3A 2NPIA 3O5SA 4FPYA 5FO7B 3VD7A 2Q4SA 1KFUL 3VHRA 1MQTA 4Q4X2 3UKTA 3J9SA 1QOSA 3OTFA 1NT0A 5DDJ2 3ZFEC 1F4AA 1QJU1 2EIDA 5LA2A 3IMMA 3QH6A 2HWE2 3R0RA 4KBBA 4WM7C 2VZOA 3ZYFA 5BNPB 5JXIA 2J22A 2XUMA 1WWYA 4AL9A 2HYKA 2FHRA 5CU1A 5JZGC 4EJRA 1DZQA 1ZZ8A 5D2AA 1RUF3 3UKNA 1VBE1 2W3JA 5LBFA 3ZXEA 4XF0A 4F83A 3JCIA 4A6SA 3O0VA 3GZTB 3FFZA 2PFWA 4D3WA 5J3UA 4XC9A 4EZ4A 2J1EA 4BISA 2CL2A 2YG0A 4HBNA 4Q0PA 3UESA 1GZWA 4OI2A 3P6BA 4DEVA 5CADA 1IGOA 4L97A 1CPNA 5EYYA 4JZRA 2VZRA 5FMOS 2BGPA 4AI8A 1IPSA 2B46X 2AUYA 3ZPOA 3ZMNA 4QPWA 2XQXA 2QDRA 5FY8A 5C70A 5I91A 3W5NA 2WWJA 5FMBA 2HLEA 4L2NA 1O3RA 2CGPA 2DURA 2EICA 2I07B 3HQUA 3OPWA 3RNSA 1KDKA 3K46A 3PJYA 4GD4A 3H0OA 4N43A 5L7OC 2DBIA 1RMU3 2E31A 1EAH1 1F31A 2XQRA 3I8TA 2W1QA 3MO4A 1DQ1A 1FT9A 1BXHA 4O9GA 4PDWA 4G9SB 4UBHA 2CV6A 2GC0A 4LUMA 1A6CA 1BCXA 3SNMA 1PGSA 3SEEA 1JHJA 1W39A 1XU1A 4BXFA 1GNYA 4EN9B 1DQ0A 1YQ6A 1UZYA 4DQAA 3INAA 5FZ3A 2E33A 1H8TC 1U5XA 1Z7S1 4XACA 1H2MA 3BN6A 5A3OA 3WNPA 1QJX3 3H9AA 4IEXA 5JOZA 4IETA 4E4ZA 5HBAA 3IT8A 4R9AA 1N47A 3CHXA 3J7NA 1NLRA 4LKFA 1T6GC 3LOIA 4B29A 1OOPC 3IMNA 4IEPA 1ZM1A 4NHMA 2OQ6A 2K0GA 2PHFA 2ZACA 2WBKA 4UFKA 4A7YA 1VBC3 4HN0A 2MEV1 2ZHLA 3H3ZA 4QPGA 4ZU7A 1AYM1 5IK8A 2ZHMA 3IBMA 4QQPA 3KLSA 5F6KA 1REEA 2W91A 4PCRA 1AR92 4DXZA 5H9PA 2K2SA 3WINE 2ZKNA 4FP3A 2YBKA 3JU9A 4HONA 1L7QA 3PU8A 4MGYE 4Q4V3 2IFRA 2UYBA 3GHMA 3RRDA 5FPXA 3K75B 4XHBA 4XILA 5DDJ1 4FVVA 2ERFA 1FMD2 5BUVA 3VBOA 4BCUA 3S5AA 2W95A 4AF9A 2RM21 3HWJA 1LHNA 1OVSA 1SBFA 3O0XA 3ZFFA 2A5ZA 2Y6LA 2Z5WA 4LQRA 4XE9A 4MADA 4XMIA 1NCRA 1US3A 5D8AC 1JXNA 4YZ2A 1COV1 4ZONA 3VZLA 1UU5A 3VBFC 2ET7A 1S0DA 3M1HA 3T2TA 5T5OA 2IXKA 2ZKLA 4Q0VA 3AKSA 5FYSA 3ZFFC 5FBJA 4DIQA 3IDBB 3MLLA 1UL9A 1WW5A 3GBFA 3ORJA 3WF3A 4CP0A 2XBO3 3SCFA 5I0RA 5JXGA 3UNPA 1KDMA 3I3MA 3B3QE 1Z7S2 4CCMA 2QDNA 2WA3A 4XFGA 4XJ9A 5A3PA 2D43A 3K4AA 3GNEA 4PJYA 3ZSLA 3WQBA 3KGZA 1G86A 4BZ4A 1YYNA 1YLLA 3J4UH 2Z42A 1OKQA 3ZIXA 2P3KA 1MS0A 4NR1A 5FP4A 5FY5A 4AEDA 1W2TA 1YQCA 2D98A 4UBGA 3V64A 2FCVA 1UW8A 2CHHA 4Y22A 3VDDB 5I0SA 5SV5A 2R1BA 2RJLA 1MVEA 1CQ9A 3PUIA 2HWE3 2ID4A 5FPBA 1C4RA 1UMZA 3BTYA 2BV4A 4MGQA 2R32A 5HCBA 2VY0A 3POGA 2GP3A 1DBNA 3HPNA 3POYA 4RFT0 3I2KA 1U5ZA 4FPEA 1DIWA 1GZTA 1OF4A 3B94A 3MPPG 4Q4X3 1GICA 4Y33A 4DRVA 4YZ5A 1K42A 3VD4A 1Y43B 3WHTA 2VOXA 5F3IA 2B45X 2GN7A 4OMDA 2XUEA 2E7TA 4K1YA 4RN5A 3I2GA 5FUNA 4WM8C 5L9RA 3V56A 4DMIA 2RVAA 1T6BX 2Z79A 1JZ4A 3ZFGA 4KNCA 1LEMA 4ORFA 4XJZA 4CP9B 4DZGA 5GM0A 3C7FA 1H6XA 3CDZB 4LKDA 1FOD1 2G9GA 3I3QA 1MVQA 2QE3A 2WKKA 3J7MA 4IV1A 1RJ7A 3RJ2X 1UU4A 1POV0 4QGNA 3RZGA 3N9MA 4LE3A 4X8NA 1FYUA 3OG2A 4Q8KA 5CZKA 1IKPA 3K4DA 4RHV3 2VZVA 3BI3A 2ZEWA 3T2OA 4ES8A 1RC6A 1AL22 2K9ZA 2WO2A 3TWIA 5FZBA 4IL7A 3WDUA 4AI2A 1F4HA 2XH6A 1PVC2 3I97A 1S0EA 3E5XA 5JCTA 3P1IA 4UFJA 1RIRA 1MR5A 4PLOA 5FPLA 1SEFA 3RFRA 1HN0A 1QH6A 3AMQA 1POV1 2XLGA 2Q1FA 2D97A 1J59A 1OA2A 4GJZA 2WWSA 2X29A 4KWJA 3T0DA 1DU3D 4Q27A 1QNWA 3VKMA 4IV3A 1YO8A 4LULA 2D3SA 5FZGA 1UOGA 1VBC1 1WD3A 4I09A 5FXWA 4JQRA 4LJHA 4N43C 5E16A 3WF1A 5L7OA 2W08A 1WLCA 2WNUC 5FYVA 4LLFA 5FZOB 1BVP1 2WNVB 4YFWA 4ZHNA 4JGYC 3RZJA 1J58A 4R52A 3K51A 1O59A 2BYVE 1SFPA 5HXVA 3TEXA 4AZZA 1RHI3 2HEWF 4E4DX 4GMP1 2VQTA 5A32B 2WQ8A 4I0AA 2PAEA 4CSWA 4OZOA 2Q5TA 2DU0A 5IVJA 5FYIA 1AR72 1LU1A 3PIJA 4WVZA 2NZ9A 4XCAA 2JB4A 2R071 3ZSKA 2HWF2 3H8RA 4DUVA 1HIXA 4S2FA 3ROUA 1IZ3A 3E6CC 2Y33A 2HWC1 1OQ1A 5LK5A 2PYTA 1H8VA 2JDAA 2ZOEB 3OUIA 1FNYA 4NPRA 5D8AB 3VBSB 4P9IA 2RDNA 1O4TA 2OUJA 3K3OA 5FOJB 1NXMA 1BYHA 2PN5A 4Y1UA 2C1FA 3KT7A 1VAKA 1Y4WA 3WNLA 4W8JA 3B7MA 3THCA 4CUCA 4IERA 5EP9A 2XONA 4HG6B 4MYEA 1W0PA 4LA3A 2RE9A 3ACIA 2DU1A 3VZKA 4LKSA 2DDUA 2WLQA 4EN7B 1MS8A 1HRI2 5DAXA 4CDUB 5C3PA 1AL0G 3MIEA 3HQXA 4GIQA 1PO22 1WW7A 2DBNA 3DXUA 3HVDA 3MFCA 4IEVA 3B00A 4XDQA 5HCFA 1OD3A 3CLPA 2VJXA 2XVGA 5IWFA 1VBE3 2QBXA 3AB0A 3C7EA 4Y4RA 5GZFA 1GKBA 2P2KA 3CQOA 3NW4A 3WP6A 1MS1A 4HKOA 4HETA 1DCSA 1OOPB 5IVCA 1ULFA 4BIFA 2RDSA 4KU7A 1W6NB 5FZFA 1NCRB 1I5ZA 5GZEA 1NA1A 3H3UA 1ULEA 2WIIB 2D6MA 3MLJA 3MI8A 3AVRA 3KF3A 2LS6A 3OCPA 3MUZ1 4Y3OA 3TB0A 4ZU5A 2B5HA 2W87A 5FZ0A 1POQA 2W68A 4CU6A 2FD8A 1CZSA 2GC3A 4EN0A 2ZGOA 1SMVA 2WZR1 1H2NA 2TEPA 2FDKA 2VOVA 4LE4A 4YW5A 4CDWA 5I93A 1JYTA 1WMEA 2VW1A 1XC6A 2Y6HA 3KV4A 1LAJA 3O14A 1RXFA 2AGSA 1TE1B 3CJIA 1VBD2 4F3JA 1VBB3 1VRH2 1GQPA 2YHJA 5GZDA 2ZMKA 4FPOB 5A7NA 2VVDA 2Y0IA 2VMEA 2LUWA 3AX4A 4U2AA 2QCSB 1LOFC 5J96B 4IE4A 2Q30A 2BFUS 3VDDC 3BIEA 2DWRA 5T52A 5LRRA 3OEBA 3N9NA 4QU1A 2ZEXA 4IEQA 2RS31 3JD72 4LHNA 4NROA 4CA9A 5JMOA 1EUUA 4FPHA 1OVPA 2CAVA 5LBBA 3PHMA 5HPOA 3TNPB 1HW5A 3BIWE 1QF3A 3K48A 1UX7A 1VAVA 5IUQA 1GOGA 2H0VA 5A6ZA 5T5JA 1BMV1 2ARAA 2R0HA 4XDOA 4AVSA 4CUBA 1R092 4YG3A 3WP3A 2XG3A 1S0IA 4IGPA 2VTXJ 3IPVB 3A7QA 1K3IA 1N1VA 4XUOA 3QD6A 3KGLA 3N7LA 2HYXA 5A33B 1MEC2 1S0GA 5H9QA 5JOYA 5JWPA 2VOKA 3GCWA 4GMP3 4GWJA 2Y8KA 1CAUA 1RITA 3I2OA 5A70A 4RQPA 1SCSA 4P08A 2GSYA 3SKJE 2OZ6A 2RS51 4DO0A 1I3HA 2DFBA 3LZZA 3O1PA 1JOJA 1PO21 5A80A 2JB8A 3P5BA 4NE9A 3VZOA 4P9YA 1AHSA 1AYM2 1LOAA 1T2XA 2VAUA 4BOWA 4DY3A 3ZPYA 5A1FA 1UY1A 1GV9A 5EQUA 2ZX2A 3WNMA 3I2IA 3RZZA 3W59A 4D0QA 1FV3A 1QU0A 1K45A 1YJKA 2NQYA 2HWD2 1HRV1 2HWC2 1ND2A 4HOOA 4HVQA 1OI6A 4NWVA 3OUHA 1OPMA 3VBUA 4P9LA 1RUD1 4AHXA 1ND3B 3ZYIB 3I2DA 5IVFA 2TNFA 3GGLA 3ZFGC 3GHNA 1HKDA 4BQ2A 4QX7A 5A7PA 1AX2A 3ZXKA 2W0XA 1A3KA 4AGGA 1GQGA 3PUAA 4JDMA 3VGIA 1QQP3 2QQNA 3ZN5A 4A45A 4PQQA 4BK4A 4HKLA 1SLIA 2RR11 2V5DA 3KV9A 3V0BA 2WT0A 1TNRA 4XUTA 2O8QA 4GKYA 5LA9A 1RUG1 4IEUA 4MGTA 3MV01 1H2KA 2XLAA 4AQ2A 2GC2A 2HWB2 3I2FA 4GJYA 4MXWA 4N8MA 1Z78A 4AG4A 4DUXA 3OY8A 4Q4W3 4YRDA 4IQPA 2W5FA 4DUWA 1D7PM 4AGVA 5FXZA 1G6NA 3X29B 2H0BA 3JUUA 4ONUA 1GOHA 3I59B 4PIZA 4Q29A 4OQ9A 2JECA 3WNKA 1ZRCA 1IHMA 2H6BA 4IESA 4S2GA 3O7OA 5EXOA 1C8NA 1OSGA 4AEDC 4W65A 5T5LA 1UY0A 4H2AA 2JWPA 5CKQA 2C6SA 2E7AA 3HEIA 3NJYA 2ZX1A 3JQXA 2GH2A 2GAUA 1UN1A 3DUIA 1RUE1 2VZQA 4G4FA 5D8AA 5C3RA 3NAPA 4YYOA 4QX8A 1VBB2 2BBVA 2VQAA 1AR82 2WZR3 1JBCA 4RQPC 2OS2A 1PNGA 2MNGA 2F4PA 1JOPA 5IVBA 1ULDA 2WWUA 4I2OA 2V73A 5DPNA 1V6MA 4FPFA 4M3CE 4COUA 4MZUA 4GA9A 5GJ6A 1VE0A 5GLWA 4WM8B 2QTWB 3DECA 4D8MA 3JB4C 2GNTA 2IXIA 4OFGA 3WG2A 1JOBA 1V70A 2RS33 3B5LB 5DUWA 5A3NA 2DCJA 4QHOA 2HWF1 1Y7BA 2VZSA 2Q1MA 4NO4A 1ZZBA 2BGOA 1I6XA 5FPVA 3O0WA 1KQRA 3VZJA 5ACA1 3THPA 5G04L 2WR9A 4I02A 3U1XA 2IUWA 4OYUA 5HCAA 4HFSA 5K0UC 4XJAA 1RUOA 4M3CB 3U75A 2IWGB 1COV2 4UFLA 4XCBA 4OUEA 2FDHA 2WS91 5GLVA 5JI9A 2PLV1 2HH9A 3HQRA 5J36A 5FMDA 4CUAA 5HV4A 4DPNA 2RJ2A 5FOBB 4FXGB 1RUE2 3LOBA 1OA4A 2QQIA 1OHFA 5FDBA 3SITA 3WW4A 4IV1B 1F15A 1UKRA 1PX4A 2DCYA 1JYXA 2RS52 2W1WA 4GZ9A 2ZHNA 4Q8LA 2A73B 1MACA 3TAYA 1Q8QA 4YNIA 3JZVA 5JPNB 1QY4A 2DVFA 4XETA 1G9CA 1K5MB 2BJSA 2WZEA 5FYMA 3VZMA 1DFQA 2XWBB 3DL3A 4LR4A 1HRV2 4LOTA 3I2JA 1ONAA 1AR93 1S2EA 1UQXA 2O8OA 3FBYA 4IEYA 4PHZA 3WQ0A 3BALA 1XPWA 4N9HA 3WD5A 3A4UA 4YVSC 3W20A 2HWD3 5CFDA 2OYZA 3DPRC 1HB1A 2PQQA 5SV8A 1XE7A 2I74A 3THTA 4AVAA 3CJXA 4ZPIA 3ZXFA 5FYTA 4JV4A 4K40A 1WMFA 3AFKA 4Z07A 1W6OA 4C1XA 4FO9A 2CWSA 1JW6A 5AC91 1WBFA 2E7QA 3BCWA 2BWAA 3CJIC 2A6VA 3UYJA 1LGNA 1UY3A 4W4ZA 5LBEA 3ACHA 5EJZB 1LKNA 5FZOA 5ABJA 2RS12 3RYPA 4META 2BRTA 1A8MA 4FOVA 2YFUA 3MIHA 1SLAA 1RMU1 3KZ4C 2JENA 3GZAA 4K8FA 5FQ0B 4X8PA 4CXXA 1PHMA 2JDUA 3LA2A 3EBRA 3TRSB 2IFWA 2E51A 1LR5A 4XTMA 4A3XA 2Q8OA 5E89A 1RHI1 1GFF2 1E5HA 2KD7A 4QQLA 4BQXA 4YZ4A 5A32A 3RZHA 1HRI1 2D93A 3NJVA 2QZ3A 3UETA 2DYCA 3A23A 5DAWA 3D4KA 3LDBA 3JBG1 2EXJA 3WDVA 3AP6A 1S2BA 3ZXDA 4RHV2 4KL1A 4Q2FA 1UY4A 4B1MA 1ZRIA 4MSVA 1Y9GA 3I54A 3OB8A 1XYNA 5BPXA 3AYEA 3RYKA 5FUPA 4AEMA 4FT8A 3PL0A 3FHQA 5L73A 1KFXL 4HVOA 4K6BA 4Q4Y1 3CF6E 1PNFA 4W50A 4XUNA 5DAQA 3MDPA 3LFIA 4U36A 2N7GA 3KWVA 4OLLA 4AWDA 5F3CA 2G4IA 3V0BB 1LEDA 4FP2A 2AR6A 2DVAA 1QH7A 5F3EA 4IGQA 5LWBA 2YYOA 4MXWB 1QJU3 1IS3A 2Q0AA 5FZ6A 4P00B 2AEZA 4CDUA 2XVLA 4IXLA 5GLTA 2E9QA 3TEYA 1UIJA 1HJFA 3N36A 5A7WA 2WNOA 1UPSA 4Y22B 3RZMA 3AKQA 1OA3A 1LOEA 4H7LA 1D2SA 2YMZA 3I3EA 1Q43A 2ZMNA 5C8WA 3FFQA 1XB9A 2XJSA 4AAPA 1ZVFA 2GZWA 4QX0A 2WRAA 4NHLA 1Q8VA 2UY8A 3ALQA 5F3GA 1BEV3 1CAXB 2RS13 4XIKA 3KCCA 5T55A 4C0BA 1FOD3 1VBA3 2PHXA 3ACLA 3J7HA 5ABJC 2UURA 2Q8CA 4W6XA 1J1TA 4YGEA 4QDQA 3KQ4B 2W47A 4K21A 5FK8A 2WFPA 2VZUA 3FC0A 1NAEA 4NWWA 2XJPA 3OSDA 1BMV2 1N1TA 1UZWA 2ZGUA 1KITA 1Q8PA 2R0FA 3F95A 4XURA 3RVHA 1RUG3 4YW1A 1S1AA 3O1RA 1PIV2 3AP9A 4I01A 1UXXX 4WZCA 3BOWA 2HWE1 3ZFEB 3OJBA 3ZMOA 5KC5A 3ES4A 4N53A 2VNGA 4IV3B 5DQ0A 1IKQA 4GALA 1V9U2 5FMCA 4XAEA 4CCDA 2VULA 3EHKA 4HZFA 5FR3A 5E6HA 3NV1A 4NIIA 1QOTA 3U07A 1N3OA 5FJHA 3V0AB 5CISA 2UU8A 2P3JA 2FDFA 5K8SA 1RUD3 4IW3A 3T3YA 3FL7A 3Q8AA 5AFEA 4AFCA 3IN9A 1A34A 5F5IA 2WQZC 3BOPA 4Y20B 1H8TB 4E27A 2DTYA 1WKYA 1GNHA 5CBLA 4X6RB 1AF9A 1VRH3 3V65A 2BUKA 3UK9A 1RUE3 1HQNA 3M3EA 2ZXQA 3MBWA 4DXSA 2X53S 1GWMA 2NMNA 2PELA 1KS5A 5C8CB 4NIGA 2ENRA 1XRUA 4CVUA 1BK1A 1XYPA 4K20A 5F32A 1OFNA 2ZGRA 5J48A 3UV9A 1ODNA 3SEPA 1W28A 1F5JA 2B8MA 1PGW1 3JQWA 3RS6A 4CPBA 4RA0A 4KWUA 3S6PA 3N4MA 4FOQA 2RMU2 3WW2A 1UYZA 4JAAA 1UMIA 3GYDA 2D5FA 2Y60A 2QQWA 5IK4A 3THDA 2GMPA 5BNPC 3VBOC 1AYN3 2FZ2A 2RR12 3SLIA 2C4XA 3QOPA 1SLLA 5E1RA 1G9AA 1H4HA 4LBQD 4Z2AA 1AR62 2PHUA 2W46A 5FO8B 3KCYA 4URTA 1S0CA 3LDKA 3TN93 5A7QA 2JE9A 3NJXA 1HB3A 4ITCA 1SPPA 4QX2A 2A70A 5IJRA 1QQP1 5KHGA 1JZ5A 1FPN1 1ZREA 5FZEA 3FHAA 3BU0A 2PHDA 3D0JA 1M4WA 3AKPA 1O3TA 2JICA 3OGSA 3SH4A 2AYHA 2LALA 3VBUB 3MZHA 5AC93 1F5FA 2A71A 2XJTA 4YW4A 4RL7A 4OHXA 2EAKA 4QU2A 1GP5A 4UW4A 1VMHA 3HR9A 3U14A 4DNYA 1OD5A 1PX3A 1V6JA 3EXUA 1DGWA 1GNZA 4N53C 5T54A 1QJEA 2WINB 2PA7A 2X10A 3LFMA 2PQSA 2R30A 3WR0A 1VBB1 3RMXA 4CDQC 4QWNA 4EE2A 1AR91 2D3PA 1PO23 1HX6A 4XOGA 1S55A 4QD2A 1DZTA 1HQWA 1VBA1 1Z0HA 3WF2A 4YM3A 2OPWA 2VZ3A 3MICA 5FQ0A 4LT5A 2BQPA 4UW3A 5EWSA 4XQWA 1BZWA 1BEV1 4TWTA 4CEYB 1X8MA 2W1UA 1V6IA 3I59A 1UF2C 4CCKA 1URXA 1YRZA 1N3QA 3SXWA 1LGCA 3SHRA 5DMYA 4AHZA 3OOXA 4XJ8A 3SCHA 4UW6A 1ZRDA 2WFF1 3POJA 2R6QA 1QOOA 4KQ7A 4XJWA 2IXCA 3WDWA 5FIXA 3VDBA 1ND2C 4TSVA 4OQ8A 4OVEA 3FWEA 2VTXA 2WABA 4BU2A 1QKQA 5BV6A 5BYNA 2FBEA 2WS93 4D6SA 2V4VA 3C3VA 4FTSA 3PLQA 1LGBA 1FPN2 1UWWA 2JDYA 2OXBA 2Y6GA 4AXOA 2PXJA 4LBLA 3UL2A 2VVEA 1FOD2 1EPZA 2VO5A 2YBPA 4XW3A 1AR83 4EROA 3MHZA 2VUCA 1CX4A 1VALA 1WGPA 1YI7A 3GZUC 3VHNA 3RG0A 2ETEA 3NNJA 4CEWB 4B1LA 5FJKA 4AEJA 1OLQA 4JKKA 3W58A 1H1MA 4WM7A 3D0SA 4QGMA 2FDJA 2VMGA 4QKDA 5FY4A 1GMMA 2JDPA 1SDDB 3JXSA 3WQ1A 3WX5A 3HT1A 1W6QA 4M01A 2R7EB 4B4PA 4CCJA 3VKLA 1V9U3 2YDEA 2W1SA 1UOJA 2CWMA 2VCCA 3MIGA 3OBZA 4LO5B 2D7FA 5F8PA 3U10A 5FYHA 2VOWA 4LHKA 1NG0A 5FMOL 3RWNA 2XB6C 3Q9OA 5CFDC 5I8TA 1JUIA 4QKBA 3CKHA 4YVSA 2XR4A 2B42B 1XNCA 4JGYA 2XJRA 3L2YA 4O61A 3KHBA 1W8OA 1DG6A 1WBLA 1AYN1 2ZJCA 1JH5A 1MZEA 1W3VA 3HN1A 2ZGSA 1W2AX 5GZGA 1EY2A 1RUI2 2WAAA 2AEYA 4XUPA 4HLTA 5B4XA 3WSOA 4CCNA 3CEWA 4CCCA 5CFDB 2ZX4A 3H1YA 1ZZ6A 3A0NA 1EUTA 4ISQA 2W92A 3FHIB 1QGLA 2AACA 2ZPXA 5CEHA 4AI3A 4XF1A 2C5DA 2CDOA 1K5MA 3HN3A 4P9XA 5F5QA 4LBQA 4L9BA 4E9KA 4TLFA 3O1VA 2J1AA 3M3QA 2LW8A 1ZRRA 3PJQA 4P14A 2VCBA 2DVDA 2J1VA 3R4UA 4JKMA 4Z1VA 2RJKA 1O3QA 3NNLA 4LNVA 2R16A 2YC4A 1DYOA 5F37A 2VXRA 2EIEA 4FBFA 5FP3A 3FBMA 4EN6B 3GCXA 5KXBA 3FJSA 2KXLA 1POV3 4PLMA 5F9TA 2P34A 2FQPA 3WDTA 4D94A 1ENSA 1ZZ9A 2E53A 5JDBA 1BHGA 4Y1VA 2BWCA 4LBMA 4IV1C 4KGQA 1PGL2 1TMF3 3BODA 4CP1A 4LBKA 2XBO2 5JIUA 5JLVA 4AHYA 1FV2A 1Q5OA 4MGZE 1EP0A 4JDOA 5DAPA 1ZX5A 5FXXA 5KHIA 2ZHKA 3PUHA 4AI1A 2A6WA 4CCLA 1NA1C 4ZU4A 1UZ0A 5L36A 2FZ1A 3T1LA 3WNOA 4LHSA 3U4SA 2W94A 4EN8B 5FO9B 1LHVA 1UAIA 1V6LA 4XFCA 1JS9A 4PIXA 3L9JT 3ZOIA 1VRH1 1GR3A 3H7JA 3KMHA 4C8DA 3E6BA 1SPPB 2DVGA 3RGBA 4QPIC 2BVBA 1RJ8A 1BKZA 2ZGNA 5LY1A 1W9SA 3PVEA 3LD8A 3AC0A 1RUJ3 4CE8A 2QQKA 4EZHA 2ZEYA 2GNDA 4NRQA 3NO8A 4AOCA 1WA6X 5JPMB 3VN4A 2VZ1A 1RUC2 1NCQC 1X33A 2WNVC 2WZ8A 3LF7A 1W9YA 4OULA 4WVMA 5FBZA 1CONA 4DINB 4NIAA 5C4WA 2XJVA 2LTNA 3JD73 4UWDA 1CD3G 2RG4A 2FDGA 5IK5A 2BBAA 1E5RA 3AFGA 5EPAA 3ZFFB 1X7NA 1C1FA 5A1AA 4V2VA 3HIFA 4M0HA 5DUXA 5A3WA 1C8M3 3T1MA 1D4M2 1UX6A 3N7MA 2WZPP 1KJLA 5BY5A 1ZBE1 3AZVA 4LTAA 1QJX2 2JG9B 1RUI1 1WA4A 2A75A 2XHNA 1Q56A 5HXMA 3Q8CA 3AYAA 5GKAC 1B35B 2OKXA 1UU6A 2XBO1 4DOUA 5CVRA 3MYXA 4MGSA 3OYWB 2JDMA 3C7OA 2VZTA 1J83A 2BGCA 4MUVA 3ZN6B 3B69A 2JG8C 3NMBA 5BNQA 4NPLA 2BW8A 2JD9A 3H8OA 2J1SA 2HBTA 3MW3A 3LE0A 1BK0A 4BLJA 1OMIA 3OPZA 3R4SA 1D0GA 2WT2A 4E4HA 4ZXEA 2WN2A 4Y1ZA 1CVNA 2VNRA 5JXHA 1OH4A 3IDEA 1OUXA 4M3CA 5FZAA 1RUI3 1OQEA 2MPFA 3BPZA 3LKJA 4LLOA 1ZBE3 1BJQA 4Q0UA 5FYCA 1HV1A 4Q4X1 1GWLA 3AM2A 2A3XA 5FZ1A 3Q8BA 1R082 4V2WA 4MO3M 3QACA 1C3HA 3APBA 1QNYA 3ILFA 2YU2A 4IUGA 3VBFA 4CU9A 3ZXGA 5BNOB 2QUOA 1CAWA 2OUHA 2CNAA 2KA3A 4QQHA 4XVHA 5EFUA 1D2QA 2AH2A 4QXHA 2NLRA 1RUJ1 1CIYA 4N7IA 1YIFA 5JSRA 1W6PA 4XUQA 1ZA4A 3BUCA 1QJY1 3AMNA 4K3UA 1W6QB 1WCQA 4ES9A 4IDZA 1QJX1 2Y0OA 5I0TA 3HT2A 5FK7A 2JIJA 3C8XA 2ADDA 1J3RA 5LW9A 1SG3A 2DUQA 5KXCA 1W3XA 4E8CA 2X8KA 4UAPA 3O1MA
chains in the Genus database with same CATH topology
2WUHA 4OUEA 1OT5A 1ULOA 1GOFA 4CUAA 1JU3A 4A3ZA 1YQ2A 3NRUA 2RJ2A 1US2A 5LA0A 2QQIA 4JHZA 2J1UA 3VD7A 4PT6A 2WO3A 1OF3A 1NKGA 1PX4A 2C26A 2W1WA 3LQCA 4GZ9A 4ZZ5A 1JYXA 5JR2A 4YPJA 2Y6KA 1F4AA 2EIDA 3ECQA 5LA2A 5JXIA 2VZOA 3CMGA 1SHWB 2J22A 1KEXA 2WN3A 2WZEA 4QDSA 4UI9L 2W3JA 3I2JA 1XPWA 3GM8A 4DXTA 2J1EA 1CZTA 4RYDA 1TVGA 2YG0A 3UESA 4DEVA 3P6BA 2Z4FA 2VZRA 2BGPA 4QPWA 2XQXA 5C70A 3W5NA 3I3DA 2WAOA 2HLEA 2EICA 1UY3A 4W4ZA 3ACHA 3T2PA 4P5YA 5EJZB 3D3AA 3K77A 3K46A 3DYPA 4ARYA 2YFUA 3BGAA 2E31A 4KMQA 3MO4A 2W1QA 2VR4A 4BXSV 3LEKA 1W99A 4OMCA 2KD7A 2E32A 3SEEA 1JHJA 1GNYA 1XNTA 2EIBA 3NJVA 3UETA 3A23A 1NUKA 2E33A 5B4NA 1UY4A 3BN6A 3WF4A 3OB8A 3WNPA 5FUIA 2VZPA 3FHQA 2WBKA 4W50A 4XUNA 4E8CA 2VL4A 4A4AA 4A44A 2W91A 3OGRA 3K4ZA 4P00B 1L7QA 1RYYA 4KI5M 2VMCA 3K75B 1GUIA 2E26A 3IIIA 2W95A 4JKLA 3I3EA 2X05A 2VTFA 2VCAA 2Y6LA 4QX0A 5IFTA 5IHRA 4LQRA 4QB1A 4MADA 1US3A 2QQJA 5I0DA 2Y6JA 1GU3A 2ZEZA 3J7HA 5C7GA 3WF3A 4A41A 4QDQA 3UNPA 2W47A 5JXGA 3ETPA 3LPGA 3WF0A 2VZUA 1IQDC 1W0NA 1DLCA 1NAEA 3K4AA 3WQBA 4XURA 1I5PA 1UXXX 2QQOA 1JZ6A 3T0BA 1JYWA 5DQ0A 1W9WA 5F7UA 2VC9A 4BDVB 4L0PA 3PUIA 2ID4A 5EIYB 2J1TA 4UOJA 3T09A 4QX3A 4MGQA 3FL7A 3HPNA 3I2KA 2ORXA 3C7GA 1OF4A 1K42A 1LNSA 3VD4A 1K12A 2B9VA 1WKYA 4DXRA 4OMDA 4RN5A 1W9TA 3I2GA 2ZXQA 3MBWA 2WO1A 1MPXA 4DXSA 2RVAA 1JZ4A 4CVUA 2WDBA 3C7FA 1H6XA 3CDZB 4QAWA 3SEPA 3FN9A 4ZY9A 1UY2A 4KWUA 4MOAA 1ULPA 1UYZA 3IB3A 1UMIA 4ZZ8A 3VD5A 2CDPA 3OG2A 3THDA 5CZKA 3WNNA 3K4DA 2VZVA 2ZEWA 2C4XA 3T2OA 3NQHA 4Z2AA 2W46A 2WO2A 1DP0A 3E1F1 1F4HA 3I97A 3NJXA 3P1IA 4QX2A 1H6YA 5IJRA 1JZ5A 3FHAA 3SKVA 3OGSA 2J7MA 3EYPA 2BZDA 3T0DA 3T08A 1UXZA 3IAPA 1PX3A 2X10A 2PQSA 3WF1A 3CZUA 2WYSA 2Y64A 4AAXA 5EJ1B 2YC2A 3WF2A 2VZ3A 1O59A 5LCWL 3C7HA 4M4PA 2W1UA 2VQTA 3A21A 2WQ8A 4M4RA 1HN1A 4OZOA 5DMYA 5DN2A 3IAQA 4GWIA 4DUVA 2J1RA 5LA1A 1O8SA 1UYYA 3VDBA 2JDAA 2WABA 2YB7A 2V4VA 1UWWA 5IYYA 3MV11 3WNLA 4W8JA 2Y6GA 4CUCA 3THCA 1JZ3A 2XONA 1UYXA 4XZUG 2VO5A 4HG6B 3OGVA 3ACIA 4LKSA 3GDBA 2DDUA 2VM9A 4QDRA 2X09A 3HJRA 2VQUA 3MUY1 4ARXA 5C71A 4JKKA 1OD3A 5G05L 3EB7A 4DEQA 2VJXA 4E8DA 1GMMA 2YFZA 1SDDB 3JXSA 2QBXA 3C7EA 3OEAA 3CQOA 1L7RA 2R7EB 3OBAA 2W1SA 2VCCA 4QX1A 2RV9A 4A6OA 5IFPA 2QQMA 3LEIA 2LS6A 3CKHA 3MUZ1 2W87A 1CZVA 4CU6A 1CZSA 1XNAA 2B4KA 2VOTA 4ET7A 1W8OA 2VMDA 3F2ZA 1XC6A 1NX9A 2Y6HA 2DCKA 4A42A 4PF1A 5J1XA 2WAAA 3VDCA 1O8PA 4XUPA 1GQPA 5B4XA 3WSOA 3CIHA 1EUTA 2W92A 2VMEA 1W8NA 5CYYA 2CDOA 3HN3A 3OEBA 2J1AA 2ZEXA 2LW8A 1UMHA 2VCBA 5JMOA 2J1VA 1EUUA 4JKMA 5JXJA 4BJ0A 3T2QA 2YC4A 1DYOA 1PMJX 5HPOA 1KGYA 2EIEA 2VMFA 1UX7A 1GOGA 2QQLA 1PMHX 4CUBA 1TG7A 2XOMA 1BHGA 2V72A 3A7QA 1K3IA 4XUOA 3ZM8A 2HYXA 3A22A 4GWJA 2Y8KA 3HNBM 3PUHA 2BERA 3DYOA 1J84A 1UZ0A 4P08A 3SKJE 1JZ7A 1JYVA 3WNOA 3CZJA 4LHSA 3LEGA 2W94A 1T2XA 3GXUA 3HOBA 1UY1A 1JZ8A 3WNMA 3I2IA 4D0QA 1K45A 3ACFA 1W9SA 3AC0A 2QQKA 2ZEYA 3ACGA 2VZ1A 2W9XA 2WZ8A 3GGLA 4TTGA 1R64A 4A45A 2QQNA 3ABZA 4PQQA 4BK4A 2V5DA 2BBAA 2L9LA 4TXWA 4XUTA 5A1AA 3HNMA 3W5MA 2ORZA 3MV01 1JZ2A 3I2FA 4QB6A 4DUXA 4AG4A 4JX0A 2XHNA 5HXMA 1JYNA 2W5FA 3IDAA 4DUWA 1D7PM 2JKXA 2OKXA 4MGSA 3HNYM 1GOHA 3C7OA 2VZTA 1J83A 3WNKA 1P8JA 3DYMA 2JE8A 1UY0A 2JD9A 2J1SA 3T0AA 3WEZA 3LE0A 3HEIA 4ZXEA 4P02B 2WN2A 2VZQA 5JXHA 1OH4A 4BK5A 1CX1A 4CU7A 5DPNA 5JUVA 4MO3M 1JI6A 4IUGA 3DECA 4LPLA 4CU9A 4D8MA 4QB2A 2C9KA 3I3BA 4XVHA 3VDAA 2DCJA 2VZSA 3VD9A 3VD3A 1CIYA 4XUQA 3LPFA 2BGOA 1WCQA 3NNGA 4CU8A 3U37A 4FI9A 5G04L 3I2HA 1JU4A 3C8XA 1SG3A 4OYUA 4UAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WUH A;  4OUE A;  1OT5 A;  1ULO A;  1GOF A;  4CUA A;  1JU3 A;  4A3Z A;  1YQ2 A;  3NRU A;  2RJ2 A;  1US2 A;  5LA0 A;  2QQI A;  4JHZ A;  2J1U A;  3VD7 A;  4PT6 A;  2WO3 A;  1OF3 A;  1NKG A;  1PX4 A;  2C26 A;  2W1W A;  3LQC A;  4GZ9 A;  4ZZ5 A;  1JYX A;  5JR2 A;  4YPJ A;  2Y6K A;  1F4A A;  2EID A;  3ECQ A;  5LA2 A;  5JXI A;  2VZO A;  3CMG A;  1SHW B;  2J22 A;  1KEX A;  2WN3 A;  2WZE A;  4QDS A;  4UI9 L;  2W3J A;  3I2J A;  1XPW A;  3GM8 A;  4DXT A;  2J1E A;  1CZT A;  4RYD A;  1TVG A;  2YG0 A;  3UES A;  4DEV A;  3P6B A;  2Z4F A;  2VZR A;  2BGP A;  4QPW A;  2XQX A;  5C70 A;  3W5N A;  3I3D A;  2WAO A;  2HLE A;  2EIC A;  1UY3 A;  4W4Z A;  3ACH A;  3T2P A;  4P5Y A;  5EJZ B;  3D3A A;  3K77 A;  3K46 A;  3DYP A;  4ARY A;  2YFU A;  3BGA A;  2E31 A;  4KMQ A;  3MO4 A;  2W1Q A;  2VR4 A;  4BXS V;  3LEK A;  1W99 A;  4OMC A;  2KD7 A;  2E32 A;  3SEE A;  1JHJ A;  1GNY A;  1XNT A;  2EIB A;  3NJV A;  3UET A;  3A23 A;  1NUK A;  2E33 A;  5B4N A;  1UY4 A;  3BN6 A;  3WF4 A;  3OB8 A;  3WNP A;  5FUI A;  2VZP A;  3FHQ A;  2WBK A;  4W50 A;  4XUN A;  4E8C A;  2VL4 A;  4A4A A;  4A44 A;  2W91 A;  3OGR A;  3K4Z A;  4P00 B;  1L7Q A;  1RYY A;  4KI5 M;  2VMC A;  3K75 B;  1GUI A;  2E26 A;  3III A;  2W95 A;  4JKL A;  3I3E A;  2X05 A;  2VTF A;  2VCA A;  2Y6L A;  4QX0 A;  5IFT A;  5IHR A;  4LQR A;  4QB1 A;  4MAD A;  1US3 A;  2QQJ A;  5I0D A;  2Y6J A;  1GU3 A;  2ZEZ A;  3J7H A;  5C7G A;  3WF3 A;  4A41 A;  4QDQ A;  3UNP A;  2W47 A;  5JXG A;  3ETP A;  3LPG A;  3WF0 A;  2VZU A;  1IQD C;  1W0N A;  1DLC A;  1NAE A;  3K4A A;  3WQB A;  4XUR A;  1I5P A;  1UXX X;  2QQO A;  1JZ6 A;  3T0B A;  1JYW A;  5DQ0 A;  1W9W A;  5F7U A;  2VC9 A;  4BDV B;  4L0P A;  3PUI A;  2ID4 A;  5EIY B;  2J1T A;  4UOJ A;  3T09 A;  4QX3 A;  4MGQ A;  3FL7 A;  3HPN A;  3I2K A;  2ORX A;  3C7G A;  1OF4 A;  1K42 A;  1LNS A;  3VD4 A;  1K12 A;  2B9V A;  1WKY A;  4DXR A;  4OMD A;  4RN5 A;  1W9T A;  3I2G A;  2ZXQ A;  3MBW A;  2WO1 A;  1MPX A;  4DXS A;  2RVA A;  1JZ4 A;  4CVU A;  2WDB A;  3C7F A;  1H6X A;  3CDZ B;  4QAW A;  3SEP A;  3FN9 A;  4ZY9 A;  1UY2 A;  4KWU A;  4MOA A;  1ULP A;  1UYZ A;  3IB3 A;  1UMI A;  4ZZ8 A;  3VD5 A;  2CDP A;  3OG2 A;  3THD A;  5CZK A;  3WNN A;  3K4D A;  2VZV A;  2ZEW A;  2C4X A;  3T2O A;  3NQH A;  4Z2A A;  2W46 A;  2WO2 A;  1DP0 A;  3E1F 1;  1F4H A;  3I97 A;  3NJX A;  3P1I A;  4QX2 A;  1H6Y A;  5IJR A;  1JZ5 A;  3FHA A;  3SKV A;  3OGS A;  2J7M A;  3EYP A;  2BZD A;  3T0D A;  3T08 A;  1UXZ A;  3IAP A;  1PX3 A;  2X10 A;  2PQS A;  3WF1 A;  3CZU A;  2WYS A;  2Y64 A;  4AAX A;  5EJ1 B;  2YC2 A;  3WF2 A;  2VZ3 A;  1O59 A;  5LCW L;  3C7H A;  4M4P A;  2W1U A;  2VQT A;  3A21 A;  2WQ8 A;  4M4R A;  1HN1 A;  4OZO A;  5DMY A;  5DN2 A;  3IAQ A;  4GWI A;  4DUV A;  2J1R A;  5LA1 A;  1O8S A;  1UYY A;  3VDB A;  2JDA A;  2WAB A;  2YB7 A;  2V4V A;  1UWW A;  5IYY A;  3MV1 1;  3WNL A;  4W8J A;  2Y6G A;  4CUC A;  3THC A;  1JZ3 A;  2XON A;  1UYX A;  4XZU G;  2VO5 A;  4HG6 B;  3OGV A;  3ACI A;  4LKS A;  3GDB A;  2DDU A;  2VM9 A;  4QDR A;  2X09 A;  3HJR A;  2VQU A;  3MUY 1;  4ARX A;  5C71 A;  4JKK A;  1OD3 A;  5G05 L;  3EB7 A;  4DEQ A;  2VJX A;  4E8D A;  1GMM A;  2YFZ A;  1SDD B;  3JXS A;  2QBX A;  3C7E A;  3OEA A;  3CQO A;  1L7R A;  2R7E B;  3OBA A;  2W1S A;  2VCC A;  4QX1 A;  2RV9 A;  4A6O A;  5IFP A;  2QQM A;  3LEI A;  2LS6 A;  3CKH A;  3MUZ 1;  2W87 A;  1CZV A;  4CU6 A;  1CZS A;  1XNA A;  2B4K A;  2VOT A;  4ET7 A;  1W8O A;  2VMD A;  3F2Z A;  1XC6 A;  1NX9 A;  2Y6H A;  2DCK A;  4A42 A;  4PF1 A;  5J1X A;  2WAA A;  3VDC A;  1O8P A;  4XUP A;  1GQP A;  5B4X A;  3WSO A;  3CIH A;  1EUT A;  2W92 A;  2VME A;  1W8N A;  5CYY A;  2CDO A;  3HN3 A;  3OEB A;  2J1A A;  2ZEX A;  2LW8 A;  1UMH A;  2VCB A;  5JMO A;  2J1V A;  1EUU A;  4JKM A;  5JXJ A;  4BJ0 A;  3T2Q A;  2YC4 A;  1DYO A;  1PMJ X;  5HPO A;  1KGY A;  2EIE A;  2VMF A;  1UX7 A;  1GOG A;  2QQL A;  1PMH X;  4CUB A;  1TG7 A;  2XOM A;  1BHG A;  2V72 A;  3A7Q A;  1K3I A;  4XUO A;  3ZM8 A;  2HYX A;  3A22 A;  4GWJ A;  2Y8K A;  3HNB M;  3PUH A;  2BER A;  3DYO A;  1J84 A;  1UZ0 A;  4P08 A;  3SKJ E;  1JZ7 A;  1JYV A;  3WNO A;  3CZJ A;  4LHS A;  3LEG A;  2W94 A;  1T2X A;  3GXU A;  3HOB A;  1UY1 A;  1JZ8 A;  3WNM A;  3I2I A;  4D0Q A;  1K45 A;  3ACF A;  1W9S A;  3AC0 A;  2QQK A;  2ZEY A;  3ACG A;  2VZ1 A;  2W9X A;  2WZ8 A;  3GGL A;  4TTG A;  1R64 A;  4A45 A;  2QQN A;  3ABZ A;  4PQQ A;  4BK4 A;  2V5D A;  2BBA A;  2L9L A;  4TXW A;  4XUT A;  5A1A A;  3HNM A;  3W5M A;  2ORZ A;  3MV0 1;  1JZ2 A;  3I2F A;  4QB6 A;  4DUX A;  4AG4 A;  4JX0 A;  2XHN A;  5HXM A;  1JYN A;  2W5F A;  3IDA A;  4DUW A;  1D7P M;  2JKX A;  2OKX A;  4MGS A;  3HNY M;  1GOH A;  3C7O A;  2VZT A;  1J83 A;  3WNK A;  1P8J A;  3DYM A;  2JE8 A;  1UY0 A;  2JD9 A;  2J1S A;  3T0A A;  3WEZ A;  3LE0 A;  3HEI A;  4ZXE A;  4P02 B;  2WN2 A;  2VZQ A;  5JXH A;  1OH4 A;  4BK5 A;  1CX1 A;  4CU7 A;  5DPN A;  5JUV A;  4MO3 M;  1JI6 A;  4IUG A;  3DEC A;  4LPL A;  4CU9 A;  4D8M A;  4QB2 A;  2C9K A;  3I3B A;  4XVH A;  3VDA A;  2DCJ A;  2VZS A;  3VD9 A;  3VD3 A;  1CIY A;  4XUQ A;  3LPF A;  2BGO A;  1WCQ A;  3NNG A;  4CU8 A;  3U37 A;  4FI9 A;  5G04 L;  3I2H A;  1JU4 A;  3C8X A;  1SG3 A;  4OYU A;  4UAP A; 
#chains in the Genus database with same CATH topology
 1J3P A;  1E5I A;  2UWA A;  4FPK A;  4YGD A;  1OT5 A;  3ON7 A;  1ULO A;  3IZO A;  4XIO A;  3ZYP A;  2TBV A;  1YQ2 A;  5JSP A;  3ZSJ A;  4YG6 A;  1HLC A;  2D6O X;  5K0U B;  2VXJ A;  4SBV A;  1X9P A;  5FTT C;  3DN7 A;  2WO3 A;  5A6X A;  2C26 A;  1NKG A;  2YU1 A;  5JR2 A;  1WCK A;  4P9G A;  3K2O A;  1XNK A;  3ECQ A;  2WO7 A;  2XPJ A;  1WZX A;  3O1O A;  3CMG A;  1SHW B;  4WVV A;  4YLZ A;  1AYM 3;  3AJZ A;  2VNV A;  3MLK A;  2GMM A;  3GJA A;  2ZGQ A;  4XMA A;  2HWD 1;  1O6U A;  4Y5Z 0;  3H50 A;  3IKW A;  1RVF 1;  2JG8 B;  2VVF A;  3VKN A;  4BYY A;  4GB3 3;  1AJO A;  2QQV A;  4JDN A;  4JGZ B;  4DXT A;  5C8C C;  5HCH A;  5ACA 3;  1MEC 3;  3SH5 A;  1VIW B;  1C1L A;  5FY9 A;  4RYD A;  1QJY 3;  2JDN A;  5FRA A;  3L2H A;  1PZ9 A;  1X36 A;  5CKM A;  2A6Y A;  4UXA A;  1AUY A;  3TEZ A;  2GNB A;  3LEM A;  5FZL A;  4GH4 B;  4RS5 C;  5D21 A;  3UKV A;  2ZGK A;  3OD0 A;  3LB9 A;  5EV7 A;  5J98 B;  1CPM A;  3T2P A;  4P5Y A;  2GNM A;  5H9R A;  1EV1 2;  3T4H B;  4I3P A;  1SDW A;  3BGA A;  2WNU B;  4KMQ A;  1NE6 A;  4EV0 A;  1H9W A;  2VR4 A;  4AVT A;  1LHO A;  3IM0 A;  1AZD A;  5FXV A;  2TUN A;  1W99 A;  3VBO B;  5C33 A;  5DZE A;  3R4D B;  3WW1 A;  1OLR A;  4COY A;  1XNT A;  2EIB A;  2GN3 A;  5LAT A;  4E2S A;  2ZGP A;  5L9V A;  4ASM B;  3ELN A;  1DQ5 A;  2BPA 2;  2K46 A;  3VL8 A;  4M0N A;  2XJU A;  4AYU A;  5B4N A;  3FE5 A;  2BP6 A;  3LAG A;  3WG3 A;  1GAN A;  3WF4 A;  1XQN A;  1O3S A;  1LOD A;  2Z69 A;  5FKC A;  3N35 A;  2GME A;  1K5J A;  1GZW B;  1H30 A;  2P1B A;  1R08 1;  1WW4 A;  4P9W A;  4TYS A;  3WG4 A;  4AE2 A;  3M7A A;  5C5T A;  3POI A;  2HEV F;  2GDF A;  4DS0 A;  2RDQ A;  3RI8 A;  1QDO A;  1IQA A;  3S57 A;  4GXL A;  5FKB A;  3CNA A;  4A4A A;  1W9F A;  4Y20 A;  3OGR A;  1UO9 A;  2F17 A;  3PNA A;  4OUS A;  1CIW A;  4XTP A;  1AX1 A;  2ATF A;  2CU5 A;  3RI9 A;  3SCG A;  4R9B A;  1Q8S A;  1CWP A;  2VMC A;  4FPL A;  1GUI A;  1OPO A;  5FLJ A;  1O91 A;  1LOG A;  2CSG A;  3AL6 A;  3ES1 A;  1RUD 2;  3MW4 A;  3VDD A;  3E97 A;  4XDP A;  3ZFG B;  1RUC 1;  1HB4 A;  3EQE A;  4MGK E;  3AYD A;  5CFC B;  1XYO A;  3KM5 A;  4NHY A;  1SAC A;  2VTF A;  1R1A 2;  2BU9 A;  2VCA A;  3NV4 A;  5JI7 A;  1V0A A;  1AR7 1;  1TZO A;  4O7X A;  3OBT A;  4D7T A;  1RIN A;  2E63 A;  4FFG A;  5IHR A;  1BQP A;  1EV1 3;  4QB1 A;  3CBN A;  3ZLI A;  1KJR A;  1GU3 A;  1L3J A;  2Y6J A;  1NY7 2;  3M3C A;  1X8E A;  1CAV A;  1NZC A;  3PVO A;  5C7G A;  4A41 A;  3E6D A;  3S7E A;  1U0A A;  4LBQ B;  4YM0 A;  1NQJ A;  4CDQ B;  3OGJ A;  1IQD C;  3ILN A;  1ENR A;  3LSE A;  5IAX A;  3T30 A;  1AL2 1;  1DLC A;  5IAV A;  2WSU A;  1GQH A;  1XE8 A;  4HSL A;  3VV1 A;  3W9A A;  3C2U A;  1A8D A;  2EIG A;  3ZXA C;  2WA4 A;  1CAW B;  3LA3 A;  2P6H A;  4Q4W 1;  2QQO A;  2FCU A;  1JZ6 A;  2C0Z A;  4CDX C;  3MEP A;  3NJZ A;  1W9W A;  1NE4 A;  2LRP A;  5F6L B;  3RQ0 A;  4O65 A;  2VC9 A;  4R4X A;  4XBN A;  3UGG A;  5IT6 A;  2NP0 A;  1AR6 3;  4L0P A;  3ILR A;  1W6M A;  5EIY B;  1JYC A;  2J1T A;  4UOJ A;  3T09 A;  3VHO A;  1O5L A;  1NCQ A;  1LCL A;  2R07 2;  3M8L A;  3WT3 A;  4BQ3 A;  3ZSE A;  4RR3 C;  1SBE A;  3IIA A;  5GAL A;  3C7G A;  5FV3 A;  1PK6 C;  1LNS A;  1U5Y A;  4A7Z A;  4HT1 T;  1WCS A;  3QBQ A;  1DGW X;  3S7I A;  1DGR N;  2B9V A;  1YC6 1;  4RHV 1;  4QXB A;  5J7M A;  1LUL A;  4R9D A;  5FZ4 A;  4LO8 A;  4FFF A;  5FLH A;  1GZ9 A;  4ATE A;  4K7J A;  4L11 A;  2FMY A;  2XL9 A;  4NID A;  1HRV 3;  4ASL A;  1IOA A;  1J3Q A;  4NIH A;  4UFH A;  4YM1 A;  1VMF A;  1AL2 3;  5CIR A;  2WDB A;  2WZR 2;  2WSV A;  4QAW A;  1G8W A;  3LWC A;  3ZXJ A;  5C4W C;  3FN9 A;  4Q4Y 2;  4ZY9 A;  2Q8E A;  1C5H A;  1QXP A;  2QZ2 A;  5IVE A;  1PZ8 A;  5L7O B;  1EV1 1;  1RTV A;  4MOA A;  1ULP A;  1QJY 2;  3IB3 A;  3VD5 A;  5ACA 2;  5FYU A;  2CDP A;  4AQS A;  1KRI A;  1HV0 A;  2P3Y A;  3VUO A;  1OLM A;  1TME 3;  1SZB A;  4LBJ A;  1ASJ 2;  3GZE A;  5FZM A;  3VBS A;  1DYK A;  3WNN A;  1UZZ A;  3I4I A;  4FXK B;  4QKN A;  4FAH A;  2XXZ A;  3NQH A;  1CES A;  1DP0 A;  4HPK B;  3E1F 1;  1D4M 1;  4LOR A;  4LK6 A;  5A3L A;  1V6K A;  1ZBE 2;  4J25 A;  4GAZ A;  1LES A;  4H7M A;  4Q4W 2;  1PIV 3;  1OQD A;  1SFY A;  1XU2 A;  4QX5 A;  2F6B A;  2JG8 A;  5JOW A;  3O1T A;  4FOY A;  4KWL A;  3WCR A;  4Y24 A;  1H1A A;  2VBD A;  3SKV A;  1V9U 1;  1VMJ A;  2UYA A;  2VBP A;  1RB8 G;  2EAL A;  2BZD A;  4NHK A;  3BTX A;  1QXR A;  4D69 A;  4YVW C;  5EHD A;  1DZR A;  1B35 A;  1YJL A;  3BB6 A;  4W6W A;  3T08 A;  5K4L A;  4N9I A;  5BNP A;  1UXZ A;  1JHN A;  1WMX A;  5IAT A;  3IAP A;  3AKT A;  1ST8 A;  1O4Z A;  2BDR A;  1XJA A;  2MEV 2;  2SBA A;  5BXX A;  2UY9 A;  2VE1 A;  3R6S A;  3ZDS A;  4JTN A;  4SLI A;  3NAP C;  1YI9 A;  3QCW A;  5L9B A;  4B3N A;  4Z92 B;  1AR8 1;  3AJY A;  1W05 A;  2RHP A;  2Y64 A;  2ZS6 B;  3PUS A;  1GSL A;  4QGL A;  1S4C A;  4AAX A;  2JG9 A;  2X5I C;  4YZ3 A;  3HBK A;  2YC2 A;  3NST A;  3DCQ A;  1F2N A;  1GYK A;  4YVW B;  4TZD A;  1I1E A;  1NLQ A;  3C7H A;  4M4P A;  5C6C A;  3N9P A;  3QLQ A;  3VLB B;  5FZC A;  4M4R A;  3WG1 A;  4CDW B;  5BNO C;  2R06 3;  2ILM A;  1W8H A;  3D82 A;  4XZP A;  1XE0 A;  3ZYG A;  1OOP A;  5K7P A;  1SQ4 A;  1RUH 3;  4IE0 A;  1UZV A;  2WFF 3;  1RUJ 2;  4GWI A;  3TYJ A;  2ZML A;  5FP9 A;  4J6G A;  3N7J A;  1UYY A;  5JAX A;  4AW7 A;  4N43 B;  2FDI A;  2JIG A;  5ERL A;  5CG8 A;  5FY1 A;  3PMS A;  2D6L X;  2YB7 A;  1DGL A;  2VW0 A;  4PDW B;  3T4V A;  4XBL A;  1OXC A;  4ZXK A;  1O7F A;  3WUD A;  1PMI A;  4Q4V 2;  4EWA A;  3WDY A;  1BBT 1;  4QHB A;  4UFI A;  1LB2 A;  3OGV A;  3VBU C;  3VBS C;  2QQP A;  4NUB A;  2WNV A;  1RVF 3;  1RUG 2;  2O14 A;  2IXL A;  1WMD A;  1SLT A;  2QVS B;  4QDR A;  3SMH A;  2X09 A;  3ZN4 A;  4EQV A;  5BNO A;  2BNM A;  1AX0 A;  4KGG A;  5C9A B;  3MUY 1;  5KR7 A;  4ARX A;  1W2U A;  1PZ7 A;  4XJU A;  4KU8 A;  4QHZ A;  1NZI A;  5G05 L;  3EB7 A;  3RJR A;  3ST7 A;  4E8D A;  2YFZ A;  3FLP A;  4XBQ A;  4YGB A;  4YGC A;  4COZ A;  2A6Z A;  3URF A;  1Y9M A;  3FMG A;  1L7R A;  1ZBA 2;  5LZ6 A;  5CFC A;  2JEM A;  1NOV A;  3CL1 A;  1STM A;  3RSJ A;  4RGA A;  4A2U A;  1VBA 2;  3KVB A;  4JQT A;  4BQ1 A;  4D7S A;  3NKT A;  5EZW A;  5FYZ A;  5IFP A;  4KWK A;  5KHK A;  2BVV A;  3KT1 A;  2Y6F A;  2ZAH A;  3LEI A;  1QJZ A;  3TN9 1;  4XQD A;  1GBG A;  4IE5 A;  2YUE A;  3ZYJ B;  2B4K A;  1TMF 2;  1VBE 2;  2VOT A;  5LY2 A;  4URA A;  2PHW A;  4BLI A;  4ET7 A;  2FMD A;  4C90 A;  2VMD A;  4K9S A;  3ZX7 A;  1K5M C;  4LO7 A;  4CDQ A;  5AVP A;  5BNN C;  2SLI A;  4HMZ A;  5A7S A;  3H8U A;  4YW2 A;  2KM2 A;  5A33 A;  1M06 G;  5APA A;  3ASI A;  1Y9Q A;  3WZ1 A;  4AFD A;  1DYP A;  1ND2 B;  2HWB 1;  4PBO A;  4PF1 A;  3VDC A;  3KHC A;  2B39 A;  2ZCW A;  1O8P A;  3ZDV A;  4BWO A;  3CIH A;  1JMU B;  2OW4 A;  1YFX A;  3RZL A;  2OVU A;  2Q1Z B;  3DPR B;  3LSD A;  4R4Z A;  2XDV A;  3H8X A;  3FLR A;  3LIH A;  2VMH A;  4BB3 A;  4AI0 A;  1PO1 1;  2DCZ A;  4LXL A;  5C3S A;  4BME A;  1NY7 1;  3MF6 A;  4N90 A;  4B7E A;  1FNZ A;  2VMI A;  3O12 A;  4YFZ A;  1UMH A;  1NCQ B;  1AJK A;  5FCC A;  1RMU 2;  5JXJ A;  1FI2 A;  4JHT A;  4RR3 B;  5CNA A;  5DAV A;  3GBG A;  3T2Q A;  2IXH A;  1KGY A;  3U11 A;  2HWF 3;  1OUR A;  1W8U A;  1LHU A;  4XXP A;  1AXZ A;  2QQL A;  2Y38 A;  5F39 A;  2W39 A;  4QMA A;  2HKX A;  1JN2 P;  1RUF 2;  3PME A;  1TG7 A;  2XOM A;  5KXE A;  1W8T A;  1VBC 2;  1IPK A;  3PTY A;  5GLZ A;  5F5C A;  3ZM8 A;  2F4L A;  5DXD A;  2CTV A;  3A22 A;  4ZS2 A;  5L19 A;  1RGS A;  3EJK A;  4P9J A;  4AQ6 A;  2PLV 3;  3HNB M;  3IDC B;  1HXS 1;  3OF1 A;  4HAN A;  4G3Y C;  1RUH 2;  3NKG A;  4HL0 A;  1JZ7 A;  5J37 A;  1WD4 A;  3D8C A;  3PVN A;  3G7D A;  1BEV 2;  4B8E A;  4CP2 A;  3CZJ A;  4Q5O A;  1JYV A;  1N1S A;  3WQ7 A;  2DUP A;  4OHZ A;  2ZTN A;  2PAK A;  3GXU A;  1YQ8 A;  1VBD 1;  3Q8F A;  4LMF A;  3ZN6 A;  1JZ8 A;  5DAB A;  4NAM A;  1X9T A;  4WM8 A;  1LEN A;  1YFY A;  2CYF A;  2V09 A;  3KV6 A;  4HKW A;  3O1S A;  3BKZ A;  1LOC A;  1Q3E A;  1LHW A;  4S2H A;  2Y26 A;  3AZX A;  4V1P A;  5FPA A;  3AP4 A;  3ACG A;  1H9P A;  1C28 A;  4PI0 A;  1DLL A;  5JR7 B;  3ATG A;  2JDZ A;  3EO6 A;  3LA7 A;  3P3N A;  2PLV 2;  4AR2 A;  3ZR6 A;  4TTG A;  2BOI A;  5FFO C;  4IEZ A;  2VW2 A;  4AED B;  1E5S A;  4Q4V 1;  1XNB A;  1NCR C;  2ZX3 A;  1X82 A;  5FPU A;  1KD7 A;  3NV3 A;  4H14 A;  2L9L A;  4LBO A;  4XAB A;  4R9C A;  3CU7 A;  1H4G A;  3NNF A;  4EWD A;  3DGT A;  1SBD A;  5FZK A;  3E5U A;  1CAU B;  4RD7 A;  4GH4 C;  4IE7 A;  4RS5 B;  4AVB A;  4H55 A;  2YGL A;  2UWB A;  4RQP B;  4JX0 A;  5A3U A;  4Y26 A;  2AEN A;  2XKP A;  4OUM A;  1JYN A;  4Q4Y 3;  3MIB A;  1XBF A;  1CAV B;  4O9E A;  1FX5 A;  4FFH A;  3AXE A;  2JKX A;  4XF9 A;  2R04 3;  3MID A;  4FOW A;  5KXD A;  4LBN A;  4FQZ A;  2VQ0 A;  1BVV A;  4XFI A;  4C0H A;  4IE6 A;  5J09 A;  3RYR A;  1P8J A;  1ASJ 3;  4BM8 A;  1COV 3;  4CDX B;  3T0A A;  5FZD A;  1HXS 3;  1NLS A;  2HWB 3;  5M0T A;  1SFN A;  2DF7 A;  5KWR A;  1VAM A;  1ENX A;  1B35 C;  3AK0 A;  1ACC A;  3HAG A;  3BVC A;  2BFU L;  4QQO A;  1TMF 1;  4JVA A;  1BLZ A;  2J42 A;  1NYW A;  4COW A;  1UCX A;  2P17 A;  1UOF A;  4BK5 A;  1CX1 A;  3PDQ A;  4CU7 A;  3FLT A;  4AVC A;  5DZF A;  5F2W A;  2YXS A;  4I30 A;  3ZVX A;  3AMM A;  1EAH 3;  2D44 A;  5H9S A;  1PGL 1;  3WDX A;  4IGO A;  3WCS A;  3ZKU A;  3N7K A;  3FX3 A;  4XF3 A;  2CGN A;  4NHX A;  4Y1X A;  4FFI A;  4XF4 A;  1PM7 A;  2JDK A;  4OI0 A;  1IS4 A;  3B9C A;  3I3B A;  3AKR A;  4LKE A;  1ND3 A;  3FUQ A;  4COV A;  4F7Z A;  1U5I A;  5LAS A;  2ET1 A;  4Y1Y A;  5DG2 A;  1PO1 3;  5CFC C;  3LPF A;  2XJQ A;  3AZY A;  1UIK A;  1W6O B;  5T5P A;  4AK3 A;  2I45 A;  3AP7 A;  4CU8 A;  3GJB A;  3DV8 A;  3U37 A;  4R8H A;  4OCT A;  5KC6 A;  1JU4 A;  3J7L A;  4C1W A;  1R1A 1;  3KVA A;  4S2D A;  2P4E A;  2YC0 A;  3KCX A;  5LBC A;  4BH9 A;  3NWK A;  1Q8O A;  3UT0 A;  5DG1 A;  5E88 A;  2D6K A;  3M3O A;  2RS5 3;  3OY8 B;  5F2S A;  5HV0 A;  1VLN A;  5JOX A;  1Z7S 3;  2WUH A;  3N3H A;  2LM3 A;  3MW2 A;  2QKD A;  4A3Z A;  2OT7 A;  3NRU A;  2B9U A;  1US2 A;  4GH4 A;  5LEK A;  3GF6 A;  4X6Q B;  2YPJ A;  4C91 A;  1VRB A;  4PT6 A;  4UW5 A;  1RUH 1;  1ZBA 1;  1C57 A;  1OF3 A;  3LQC A;  4ZZ5 A;  4RGG A;  1NA1 B;  5AVA A;  3MF9 A;  4YPJ A;  2VBB A;  4NOT A;  2R06 1;  3NAP B;  3DPR A;  2Y6K A;  1IS6 A;  2PMW B;  5CA6 A;  1ULG A;  1TNF A;  2VPV A;  1LU2 A;  3N9L A;  2P6C A;  1RED A;  2RM2 2;  1KEX A;  4AHW A;  4FSJ A;  2WN3 A;  1H1I A;  1CR7 A;  4QDS A;  5F5A A;  2X5I B;  1WCD J;  2A6X A;  2QNK A;  3PUQ A;  5IW0 A;  1MZF A;  3W21 A;  1W0O A;  2D5H A;  4UI9 L;  3VL9 A;  2NYY A;  1DGR A;  5A7O A;  5C8C A;  2YZ4 A;  5C5U A;  4Y4Y A;  3VHP A;  1MQT C;  3GM8 A;  1V00 A;  3EMR A;  3MIF A;  1CZT A;  1TVG A;  5C3Q A;  3VBR B;  4WVW A;  2Z4F A;  4DRR A;  4BQ4 A;  4NAO A;  4CPB D;  5JIA A;  3HBZ A;  3MGU A;  2IVJ A;  1QWR A;  3BTA A;  3I3D A;  2OA2 A;  2WAO A;  4IEO A;  4AVV A;  5FWE A;  1MZ5 A;  4XPV A;  3D3A A;  3K77 A;  5IVY A;  1CAX A;  2RMU 1;  1EPW A;  1MQT B;  2HBU A;  3DYP A;  4ARY A;  4BQW A;  4OHY A;  2I2S A;  3USU B;  4H3W A;  1YEW A;  3J8F 2;  4NMI A;  1D4M 3;  1XSR A;  4L92 A;  4ZS3 A;  2RMU 3;  4BXS V;  4QXC A;  5CG9 A;  4XXA A;  5A7W B;  3LEK A;  4OMC A;  4PBP A;  1W03 A;  2E32 A;  4FAG A;  3TBD A;  2HEY F;  3M4F A;  4FQ4 A;  1C5I A;  4YW7 A;  5A6Q A;  4KG0 A;  2ZGL A;  1JTZ X;  1G9D A;  5A6Y A;  2WQ4 A;  3H1M A;  2NM1 A;  1NUK A;  4GWM A;  1YXW A;  4UYB A;  2Q8D A;  4ASK A;  2EAA A;  3TNQ A;  2Z2S B;  4WBB A;  5FZI A;  4CXW A;  5C9A A;  4XFH A;  1MEC 1;  1FAT A;  1VJ2 A;  2A3W A;  4B7K A;  3POS A;  4Q0S A;  2VCM A;  5IK7 A;  1GLH A;  5FUI A;  5A3M A;  2VZP A;  2ES3 A;  1W6M B;  4MXV A;  3RMY A;  1DF0 A;  3UGH A;  3ME2 A;  2IVI B;  1V6N A;  2A7A A;  1YHF A;  2VL4 A;  4QQ2 A;  5GZC A;  5A3T A;  3DKW A;  1ENQ A;  1H8T A;  5JVV A;  3WY6 A;  4A44 A;  1J1L A;  5I8S A;  5BNN B;  3LDR A;  3K4Z A;  1O5U A;  5ANN A;  1RYY A;  1AR6 1;  2HWC 3;  4NN0 A;  2GC1 A;  2R06 2;  3PVB B;  2VG9 A;  3OGG A;  4KI5 M;  2WC2 A;  4WV8 A;  1FPN 3;  3OD4 A;  2E26 A;  4FCA A;  3WOG A;  1LOB A;  3III A;  1LJ7 A;  2R07 3;  3U4X A;  2VU9 A;  4KH9 A;  2AC1 A;  1R1Z A;  1VPH A;  3DF0 A;  4JKL A;  3KB5 A;  2X05 A;  4TLG A;  5JZG B;  3S0M A;  4CDX A;  4D7Y A;  4EWE A;  4HXC A;  2JD4 A;  1DDL A;  5IFT A;  1CGP A;  1SLC A;  3KD4 A;  5LK7 B;  2OZJ A;  2WNE A;  1TQ5 A;  2QQJ A;  1IG3 A;  1PGW 2;  4B4Q A;  5I0D A;  1GP6 A;  2ZEZ A;  1XSQ A;  4AI9 A;  4NPM A;  4AQT A;  3GBW A;  3KF5 A;  5LB6 A;  3ZXL A;  2IC1 A;  4Q0Q A;  4A7K A;  1F35 A;  4LHL A;  2A1X A;  3ETP A;  3LPG A;  5FZ8 A;  3WF0 A;  2JJ6 A;  1W0N A;  4BQY A;  4IV3 C;  4NVP A;  3K3N A;  4CRQ A;  4PQ9 A;  4QPG B;  4MG2 A;  1X50 A;  2ZAA A;  1WLW A;  4RR3 A;  5DUV A;  1BBT 2;  1W04 A;  2E6V A;  1I5P A;  1JOD A;  4LA2 A;  4XQ4 A;  2ZA9 A;  1QJU 2;  4I3G A;  5FZ7 A;  3SQO A;  1PM4 A;  2R49 A;  2VEC A;  3VBH A;  2PHR A;  3T0B A;  1HJG A;  1JYW A;  3J8F 1;  1NQD A;  2EXK A;  1YNA A;  2C9A A;  2OX0 A;  2BNO A;  3CO2 A;  3NVC A;  4K1Z A;  4GKX A;  4UF0 B;  2VGD A;  4CYD A;  1F9K A;  1H2L A;  4HPK A;  4BDV B;  1VR3 A;  2O0O A;  3ZSM A;  3RZK A;  2JDH A;  3U0Z A;  3WP4 A;  4QX3 A;  4Q26 A;  3AL5 A;  1DQ6 A;  5FZH A;  3AMP A;  3E5Q A;  4MHU A;  2ORX A;  2ZZJ A;  3RWK X;  1ZYB A;  3JBG 2;  2P3I A;  2VUD A;  3QH7 A;  1K12 A;  2OQ7 A;  2CY6 A;  4GB3 2;  3D6E A;  4DXR A;  1UPI A;  4BPZ A;  1I9R A;  2V5Y A;  2WJS A;  3FZ3 A;  1W9T A;  4AGR A;  4JC1 A;  1FXZ A;  1VBD 3;  2YBS A;  1ODM A;  4FPC A;  2WO1 A;  1MPX A;  4QPI A;  2EVX A;  3H1W A;  2R1D A;  2WLP A;  4MV2 A;  4YSF A;  1RXG A;  4Z8B A;  1YFU A;  5CKN A;  3POB A;  3NL1 A;  4JTO A;  1UY2 A;  5DUU A;  3AYC A;  4D6R A;  5F7U A;  2QQU A;  2RS1 1;  4F8A A;  3AVS A;  1ND3 C;  1UNB A;  2R04 1;  4TN7 A;  4ZZ8 A;  1RUN A;  1F8V A;  2C24 A;  5CAZ A;  4LIT A;  1JYI A;  1PK6 A;  3Q8E A;  3WV6 A;  2DV9 A;  4MH0 E;  3ZFE A;  2XHK A;  1ZNP A;  2W52 A;  3M70 A;  3PUR A;  4LK7 A;  4YVW A;  3USS A;  1TEI A;  3AZW A;  3D5O A;  3VKO A;  2CGO A;  4BHP A;  2Y34 A;  1LRH A;  1PO1 2;  3V0A A;  1KXG A;  2XL7 A;  1OFS A;  5F1R A;  2RM2 3;  4XYX A;  1H6Y A;  2A3Y A;  1LEC A;  1Y3T A;  2RS3 2;  3JD7 1;  4RS5 A;  3WHU A;  4NJ4 A;  5I0U A;  1OUS A;  2JG9 C;  2J7M A;  4P5H A;  3EYP A;  4J1W A;  5ISL A;  5EYX A;  2P37 A;  3ZO0 B;  2XLF A;  4FPJ A;  1IS5 A;  1ZZ7 A;  2ZZQ A;  5FP8 A;  1UKG A;  1W90 A;  1ZRF A;  3MFA A;  2PAM A;  1O4Y A;  4GB3 1;  2BEO A;  1HDK A;  2YPD A;  2AZ5 A;  2B7Y A;  5ANQ A;  4DFS A;  3CZU A;  3H7Y A;  2OPK A;  2XWJ B;  1UYP A;  2WYS A;  4Y5T A;  5FYB A;  3JBG 3;  4HK8 A;  2DCT A;  5KHH A;  3KS7 A;  1S0F A;  4ISR A;  1HRI 3;  1FAY A;  1VB4 A;  3GAL A;  5EJ1 B;  4XEZ A;  1W2O A;  2JXA A;  2CAU A;  2ZGM A;  4MLO A;  4YWA A;  3WW3 A;  4FTE A;  3HMY A;  3M2M A;  4PDW C;  5LCW L;  3DEM A;  4HK9 A;  3A21 A;  4YM2 A;  3TN9 2;  1HN1 A;  4CP9 A;  3BPS A;  1ALY A;  1AVB A;  4PIY A;  1DHK B;  5DN2 A;  4NRP A;  2VD7 A;  2QFE A;  1YQ5 A;  3IAQ A;  4HSJ A;  1XND A;  5C3O A;  1AYN 2;  5T3N A;  5ABJ B;  1U12 A;  2J1R A;  2WYF A;  2ZAB A;  1O8S A;  5DDJ 3;  5AC9 2;  4E4S A;  5LA1 A;  3OUJ A;  4OI1 A;  2BTV C;  1DQ4 A;  2G19 A;  5FAX A;  1R09 1;  1GP4 A;  3B02 A;  3NNM A;  3FUO A;  3WUC A;  3R05 A;  4KG8 A;  4ZKT B;  5JSO A;  1MZ6 A;  4CUG A;  4HVR A;  1QQP 2;  2PHL A;  5IYY A;  3MV1 1;  2MEV 3;  1G9F A;  2ARE A;  2PHT A;  4FTB A;  2HJI A;  1JZ3 A;  4XZU G;  1UYX A;  4PF5 A;  3JB8 A;  1ZZC A;  4OHW A;  3KSC A;  1S0J A;  4WZF A;  3ETQ A;  5DZG A;  3GDB A;  3ENR A;  3N9O A;  5BNN A;  2VM9 A;  2WT1 A;  3HJR A;  1A78 A;  2VQU A;  1N1Y A;  5TSW A;  5C71 A;  4UT5 A;  4FPG A;  4Q1P A;  4DEQ A;  4DY5 A;  4CEY A;  5KBF A;  1GZC A;  3ITQ A;  3MPB A;  1WW6 A;  3OEA A;  1XOY A;  3SH3 A;  4CCO A;  1R09 3;  2PTM A;  1RUF 1;  4NRM A;  4M3C F;  3BU7 A;  3OBA A;  1REF A;  1OLM E;  3VBR C;  3WVJ A;  4E2Q A;  4QX1 A;  4XFB A;  2RV9 A;  2O1Q A;  2ARB A;  4A6O A;  3LIG A;  5GLU A;  4RFR B;  4DB5 A;  5C9A C;  4OZX A;  5T50 A;  2QQM A;  2ARC A;  3WNX A;  3UJO A;  1AXK A;  3UGF A;  2DUO A;  1VP6 A;  3P3P A;  2G9Z A;  1WCU A;  2V4A A;  1CZV A;  3A0K A;  4LEJ A;  1HXS 2;  1XNA A;  2VH9 A;  1GWK A;  2H6C A;  2WL1 A;  2XKO A;  1XXN A;  3F2Z A;  3POW A;  4CXY A;  1MS5 A;  4QM8 A;  1QIQ A;  4N7U A;  4BA6 A;  1NX9 A;  2DTW A;  1SCR A;  2DCK A;  3SIS A;  4I0B A;  4QPG C;  4XAA A;  4KBZ A;  3U78 A;  4A42 A;  5J1X A;  4CEW A;  1CJP A;  5FY7 A;  1JUH A;  1YWK A;  1ASJ 1;  2GAL A;  1KS4 A;  3VBH B;  2G9F A;  1EYB A;  2D6P A;  3DXT A;  1G7Y A;  3KV5 A;  1W8N A;  3RPQ A;  3AP5 A;  5CYY A;  5FYY A;  4CEW C;  3M3I A;  4CDW C;  1AXY A;  3WXP A;  4MHR A;  4Z82 A;  3J26 N;  1QDC A;  3KQR A;  4JRL A;  1CN1 A;  4I0W B;  4MX3 A;  4AFB A;  5FWJ A;  3POF A;  3RDI A;  2GU9 A;  4BJ0 A;  1C8M 1;  5A1L A;  1PMJ X;  1W6N A;  3VZN A;  2VMF A;  4QM9 A;  3I7D A;  2WNU A;  5FRE A;  1PMH X;  4Y5S A;  1WLD A;  4YVS B;  3S5Q A;  2VUA A;  4BQ5 A;  1LOF A;  2VUJ A;  1ZBA 3;  4JRA A;  3POE A;  2OII A;  4N53 B;  4D6Q A;  5C4W B;  1PIV 1;  1B09 A;  2V72 A;  5FZ9 A;  2WS9 2;  1OKO A;  1OH3 A;  3PU3 A;  5FP7 A;  1YUD A;  3S30 A;  5LEJ A;  3H42 B;  3N9Q A;  4OI4 A;  1H0B A;  1LTE A;  3WP5 A;  4J1X A;  2NN8 A;  3CJI B;  4W6Y A;  1W8F A;  4QPY A;  2NMO A;  1W8W A;  1ULC A;  4LIU A;  4LO6 B;  2D6N A;  2DVB A;  4E2G A;  1APN A;  2JE7 A;  4LO4 B;  2BER A;  1MS4 A;  3DYO A;  1J84 A;  4QKF A;  1PK6 B;  4RGK A;  3USU A;  3TEW A;  2IZW A;  1UD1 A;  2YGM A;  4M00 A;  3LEG A;  4JGY B;  5LRS A;  4CTE A;  1N3P A;  1R1A 3;  3O1U A;  5EJ3 A;  3OYW A;  3SC7 X;  5B2G B;  3HOB A;  3BYW A;  2EXH A;  2MHF A;  1OBN A;  4EYU A;  5FY0 A;  2D3R A;  1FMD 3;  1QXJ A;  4LIV A;  4BIO A;  4XHX A;  3B9I A;  1D4V B;  4PI2 A;  3ZIW A;  5FPZ A;  4QT6 A;  2XGX A;  3ACF A;  3WLU A;  1W2N A;  1QMJ A;  4AFA A;  3IWZ A;  3DKQ A;  3AXD A;  1S0B A;  2EXI A;  2W9X A;  4LOS A;  1MS3 A;  5KHJ A;  4XFA A;  4LUK A;  5D1I A;  4HN1 A;  1UOB A;  1W6P B;  3IPV A;  1R64 A;  3OPT A;  3H3L A;  3KT4 A;  2UWC A;  1QEX A;  3ABZ A;  1S2K A;  1ZA7 A;  2RR1 3;  4GMP 0;  4Z2W A;  2FCT A;  2BNN A;  4TXW A;  4CZS A;  3VB9 A;  3LGR A;  4L99 A;  3VKF C;  3HNM A;  4IND A;  1YIP A;  2ORZ A;  3VBF B;  5IVV A;  1JZ2 A;  3J8F 3;  3W5M A;  3TOJ A;  1PVC 1;  4K8R B;  4QB6 A;  2GP5 A;  1W8Z A;  1TME 1;  4CEY C;  3IDA A;  3BTZ A;  4YW3 A;  4AFM A;  3B93 A;  2D40 A;  4PLN A;  2YRO A;  4BE3 A;  4CDU C;  3HNY M;  4YW6 A;  3VBH C;  3B01 A;  4IEW A;  3AZZ A;  1IPJ A;  4GQ7 A;  4OHV A;  1D0H A;  1W06 A;  3DYM A;  2JE8 A;  5JZG A;  5I8Y A;  3WEZ A;  1CJD A;  4YAR A;  2JX9 A;  4YZ1 A;  3ZR5 A;  1C8M 2;  4P02 B;  1YCI A;  3OBR A;  3UJQ A;  2P5B A;  2JKB A;  2KR2 A;  4WVM B;  4YG0 A;  4GUL A;  1MS9 A;  1NXD 1;  1PVC 3;  4BMB A;  5K9Y A;  1QHD A;  1DQ2 A;  2ZBJ A;  3ZKY A;  2X5I A;  2EF6 A;  5JMC A;  5JUV A;  1RUC 3;  1VB2 A;  1JI6 A;  2VNO A;  4CCE A;  5K0U A;  4B4R A;  4LPL A;  5AFB A;  3I49 A;  2BOJ A;  2ADE A;  2LRO A;  4QB2 A;  2G1M A;  2C9K A;  4MVT A;  2XVK A;  3ZYH A;  5HI0 A;  1WLT A;  4UFM A;  3VDA A;  4GWN A;  1RVF 2;  2WFF 2;  1OC1 A;  3ZYR A;  3VD3 A;  3VD9 A;  3AMH A;  3VBR A;  2YY1 A;  3HD8 B;  2YV8 A;  1R08 3;  1HQL A;  4RSU A;  4UF0 A;  5FLI A;  2R04 2;  1FMD 1;  3PTR B;  4QXK A;  4JGZ C;  2ZGT A;  3NNG A;  4JCK A;  3NV2 A;  1IG0 A;  4FI9 A;  2ZX0 A;  3I2H A;  1TME 2;  1PVX A;  3ZYB A;  1QJF A;  2XML A;  1BBT 3;  3G6J B;  1YFW A;  2QJV A;  2EA7 A;  4JGZ A;  4L8Q A;  4ATF A;  1V6O A;  4Q1R A;  2GH8 A;  1E57 A;  2RDR A;  4MGI E;  4QPI B;  4WM7 B;  3LCP A;  2W2I A;  1AR7 3;  1HB2 A;  1GOF A;  2IXJ A;  2ARX A;  1JU3 A;  5CB7 A;  1G9B A;  1EAH 2;  1SLB A;  4XFF A;  5E8A A;  1L7L A;  4AEK A;  5LA0 A;  1WUV A;  2DFC A;  4JHZ A;  3PIG A;  1RHI 2;  2J1U A;  1RL3 A;  2NPI A;  3O5S A;  4FPY A;  5FO7 B;  3VD7 A;  2Q4S A;  1KFU L;  3VHR A;  1MQT A;  4Q4X 2;  3UKT A;  3J9S A;  1QOS A;  3OTF A;  1NT0 A;  5DDJ 2;  3ZFE C;  1F4A A;  1QJU 1;  2EID A;  5LA2 A;  3IMM A;  3QH6 A;  2HWE 2;  3R0R A;  4KBB A;  4WM7 C;  2VZO A;  3ZYF A;  5BNP B;  5JXI A;  2J22 A;  2XUM A;  1WWY A;  4AL9 A;  2HYK A;  2FHR A;  5CU1 A;  5JZG C;  4EJR A;  1DZQ A;  1ZZ8 A;  5D2A A;  1RUF 3;  3UKN A;  1VBE 1;  2W3J A;  5LBF A;  3ZXE A;  4XF0 A;  4F83 A;  3JCI A;  4A6S A;  3O0V A;  3GZT B;  3FFZ A;  2PFW A;  4D3W A;  5J3U A;  4XC9 A;  4EZ4 A;  2J1E A;  4BIS A;  2CL2 A;  2YG0 A;  4HBN A;  4Q0P A;  3UES A;  1GZW A;  4OI2 A;  3P6B A;  4DEV A;  5CAD A;  1IGO A;  4L97 A;  1CPN A;  5EYY A;  4JZR A;  2VZR A;  5FMO S;  2BGP A;  4AI8 A;  1IPS A;  2B46 X;  2AUY A;  3ZPO A;  3ZMN A;  4QPW A;  2XQX A;  2QDR A;  5FY8 A;  5C70 A;  5I91 A;  3W5N A;  2WWJ A;  5FMB A;  2HLE A;  4L2N A;  1O3R A;  2CGP A;  2DUR A;  2EIC A;  2I07 B;  3HQU A;  3OPW A;  3RNS A;  1KDK A;  3K46 A;  3PJY A;  4GD4 A;  3H0O A;  4N43 A;  5L7O C;  2DBI A;  1RMU 3;  2E31 A;  1EAH 1;  1F31 A;  2XQR A;  3I8T A;  2W1Q A;  3MO4 A;  1DQ1 A;  1FT9 A;  1BXH A;  4O9G A;  4PDW A;  4G9S B;  4UBH A;  2CV6 A;  2GC0 A;  4LUM A;  1A6C A;  1BCX A;  3SNM A;  1PGS A;  3SEE A;  1JHJ A;  1W39 A;  1XU1 A;  4BXF A;  1GNY A;  4EN9 B;  1DQ0 A;  1YQ6 A;  1UZY A;  4DQA A;  3INA A;  5FZ3 A;  2E33 A;  1H8T C;  1U5X A;  1Z7S 1;  4XAC A;  1H2M A;  3BN6 A;  5A3O A;  3WNP A;  1QJX 3;  3H9A A;  4IEX A;  5JOZ A;  4IET A;  4E4Z A;  5HBA A;  3IT8 A;  4R9A A;  1N47 A;  3CHX A;  3J7N A;  1NLR A;  4LKF A;  1T6G C;  3LOI A;  4B29 A;  1OOP C;  3IMN A;  4IEP A;  1ZM1 A;  4NHM A;  2OQ6 A;  2K0G A;  2PHF A;  2ZAC A;  2WBK A;  4UFK A;  4A7Y A;  1VBC 3;  4HN0 A;  2MEV 1;  2ZHL A;  3H3Z A;  4QPG A;  4ZU7 A;  1AYM 1;  5IK8 A;  2ZHM A;  3IBM A;  4QQP A;  3KLS A;  5F6K A;  1REE A;  2W91 A;  4PCR A;  1AR9 2;  4DXZ A;  5H9P A;  2K2S A;  3WIN E;  2ZKN A;  4FP3 A;  2YBK A;  3JU9 A;  4HON A;  1L7Q A;  3PU8 A;  4MGY E;  4Q4V 3;  2IFR A;  2UYB A;  3GHM A;  3RRD A;  5FPX A;  3K75 B;  4XHB A;  4XIL A;  5DDJ 1;  4FVV A;  2ERF A;  1FMD 2;  5BUV A;  3VBO A;  4BCU A;  3S5A A;  2W95 A;  4AF9 A;  2RM2 1;  3HWJ A;  1LHN A;  1OVS A;  1SBF A;  3O0X A;  3ZFF A;  2A5Z A;  2Y6L A;  2Z5W A;  4LQR A;  4XE9 A;  4MAD A;  4XMI A;  1NCR A;  1US3 A;  5D8A C;  1JXN A;  4YZ2 A;  1COV 1;  4ZON A;  3VZL A;  1UU5 A;  3VBF C;  2ET7 A;  1S0D A;  3M1H A;  3T2T A;  5T5O A;  2IXK A;  2ZKL A;  4Q0V A;  3AKS A;  5FYS A;  3ZFF C;  5FBJ A;  4DIQ A;  3IDB B;  3MLL A;  1UL9 A;  1WW5 A;  3GBF A;  3ORJ A;  3WF3 A;  4CP0 A;  2XBO 3;  3SCF A;  5I0R A;  5JXG A;  3UNP A;  1KDM A;  3I3M A;  3B3Q E;  1Z7S 2;  4CCM A;  2QDN A;  2WA3 A;  4XFG A;  4XJ9 A;  5A3P A;  2D43 A;  3K4A A;  3GNE A;  4PJY A;  3ZSL A;  3WQB A;  3KGZ A;  1G86 A;  4BZ4 A;  1YYN A;  1YLL A;  3J4U H;  2Z42 A;  1OKQ A;  3ZIX A;  2P3K A;  1MS0 A;  4NR1 A;  5FP4 A;  5FY5 A;  4AED A;  1W2T A;  1YQC A;  2D98 A;  4UBG A;  3V64 A;  2FCV A;  1UW8 A;  2CHH A;  4Y22 A;  3VDD B;  5I0S A;  5SV5 A;  2R1B A;  2RJL A;  1MVE A;  1CQ9 A;  3PUI A;  2HWE 3;  2ID4 A;  5FPB A;  1C4R A;  1UMZ A;  3BTY A;  2BV4 A;  4MGQ A;  2R32 A;  5HCB A;  2VY0 A;  3POG A;  2GP3 A;  1DBN A;  3HPN A;  3POY A;  4RFT 0;  3I2K A;  1U5Z A;  4FPE A;  1DIW A;  1GZT A;  1OF4 A;  3B94 A;  3MPP G;  4Q4X 3;  1GIC A;  4Y33 A;  4DRV A;  4YZ5 A;  1K42 A;  3VD4 A;  1Y43 B;  3WHT A;  2VOX A;  5F3I A;  2B45 X;  2GN7 A;  4OMD A;  2XUE A;  2E7T A;  4K1Y A;  4RN5 A;  3I2G A;  5FUN A;  4WM8 C;  5L9R A;  3V56 A;  4DMI A;  2RVA A;  1T6B X;  2Z79 A;  1JZ4 A;  3ZFG A;  4KNC A;  1LEM A;  4ORF A;  4XJZ A;  4CP9 B;  4DZG A;  5GM0 A;  3C7F A;  1H6X A;  3CDZ B;  4LKD A;  1FOD 1;  2G9G A;  3I3Q A;  1MVQ A;  2QE3 A;  2WKK A;  3J7M A;  4IV1 A;  1RJ7 A;  3RJ2 X;  1UU4 A;  1POV 0;  4QGN A;  3RZG A;  3N9M A;  4LE3 A;  4X8N A;  1FYU A;  3OG2 A;  4Q8K A;  5CZK A;  1IKP A;  3K4D A;  4RHV 3;  2VZV A;  3BI3 A;  2ZEW A;  3T2O A;  4ES8 A;  1RC6 A;  1AL2 2;  2K9Z A;  2WO2 A;  3TWI A;  5FZB A;  4IL7 A;  3WDU A;  4AI2 A;  1F4H A;  2XH6 A;  1PVC 2;  3I97 A;  1S0E A;  3E5X A;  5JCT A;  3P1I A;  4UFJ A;  1RIR A;  1MR5 A;  4PLO A;  5FPL A;  1SEF A;  3RFR A;  1HN0 A;  1QH6 A;  3AMQ A;  1POV 1;  2XLG A;  2Q1F A;  2D97 A;  1J59 A;  1OA2 A;  4GJZ A;  2WWS A;  2X29 A;  4KWJ A;  3T0D A;  1DU3 D;  4Q27 A;  1QNW A;  3VKM A;  4IV3 A;  1YO8 A;  4LUL A;  2D3S A;  5FZG A;  1UOG A;  1VBC 1;  1WD3 A;  4I09 A;  5FXW A;  4JQR A;  4LJH A;  4N43 C;  5E16 A;  3WF1 A;  5L7O A;  2W08 A;  1WLC A;  2WNU C;  5FYV A;  4LLF A;  5FZO B;  1BVP 1;  2WNV B;  4YFW A;  4ZHN A;  4JGY C;  3RZJ A;  1J58 A;  4R52 A;  3K51 A;  1O59 A;  2BYV E;  1SFP A;  5HXV A;  3TEX A;  4AZZ A;  1RHI 3;  2HEW F;  4E4D X;  4GMP 1;  2VQT A;  5A32 B;  2WQ8 A;  4I0A A;  2PAE A;  4CSW A;  4OZO A;  2Q5T A;  2DU0 A;  5IVJ A;  5FYI A;  1AR7 2;  1LU1 A;  3PIJ A;  4WVZ A;  2NZ9 A;  4XCA A;  2JB4 A;  2R07 1;  3ZSK A;  2HWF 2;  3H8R A;  4DUV A;  1HIX A;  4S2F A;  3ROU A;  1IZ3 A;  3E6C C;  2Y33 A;  2HWC 1;  1OQ1 A;  5LK5 A;  2PYT A;  1H8V A;  2JDA A;  2ZOE B;  3OUI A;  1FNY A;  4NPR A;  5D8A B;  3VBS B;  4P9I A;  2RDN A;  1O4T A;  2OUJ A;  3K3O A;  5FOJ B;  1NXM A;  1BYH A;  2PN5 A;  4Y1U A;  2C1F A;  3KT7 A;  1VAK A;  1Y4W A;  3WNL A;  4W8J A;  3B7M A;  3THC A;  4CUC A;  4IER A;  5EP9 A;  2XON A;  4HG6 B;  4MYE A;  1W0P A;  4LA3 A;  2RE9 A;  3ACI A;  2DU1 A;  3VZK A;  4LKS A;  2DDU A;  2WLQ A;  4EN7 B;  1MS8 A;  1HRI 2;  5DAX A;  4CDU B;  5C3P A;  1AL0 G;  3MIE A;  3HQX A;  4GIQ A;  1PO2 2;  1WW7 A;  2DBN A;  3DXU A;  3HVD A;  3MFC A;  4IEV A;  3B00 A;  4XDQ A;  5HCF A;  1OD3 A;  3CLP A;  2VJX A;  2XVG A;  5IWF A;  1VBE 3;  2QBX A;  3AB0 A;  3C7E A;  4Y4R A;  5GZF A;  1GKB A;  2P2K A;  3CQO A;  3NW4 A;  3WP6 A;  1MS1 A;  4HKO A;  4HET A;  1DCS A;  1OOP B;  5IVC A;  1ULF A;  4BIF A;  2RDS A;  4KU7 A;  1W6N B;  5FZF A;  1NCR B;  1I5Z A;  5GZE A;  1NA1 A;  3H3U A;  1ULE A;  2WII B;  2D6M A;  3MLJ A;  3MI8 A;  3AVR A;  3KF3 A;  2LS6 A;  3OCP A;  3MUZ 1;  4Y3O A;  3TB0 A;  4ZU5 A;  2B5H A;  2W87 A;  5FZ0 A;  1POQ A;  2W68 A;  4CU6 A;  2FD8 A;  1CZS A;  2GC3 A;  4EN0 A;  2ZGO A;  1SMV A;  2WZR 1;  1H2N A;  2TEP A;  2FDK A;  2VOV A;  4LE4 A;  4YW5 A;  4CDW A;  5I93 A;  1JYT A;  1WME A;  2VW1 A;  1XC6 A;  2Y6H A;  3KV4 A;  1LAJ A;  3O14 A;  1RXF A;  2AGS A;  1TE1 B;  3CJI A;  1VBD 2;  4F3J A;  1VBB 3;  1VRH 2;  1GQP A;  2YHJ A;  5GZD A;  2ZMK A;  4FPO B;  5A7N A;  2VVD A;  2Y0I A;  2VME A;  2LUW A;  3AX4 A;  4U2A A;  2QCS B;  1LOF C;  5J96 B;  4IE4 A;  2Q30 A;  2BFU S;  3VDD C;  3BIE A;  2DWR A;  5T52 A;  5LRR A;  3OEB A;  3N9N A;  4QU1 A;  2ZEX A;  4IEQ A;  2RS3 1;  3JD7 2;  4LHN A;  4NRO A;  4CA9 A;  5JMO A;  1EUU A;  4FPH A;  1OVP A;  2CAV A;  5LBB A;  3PHM A;  5HPO A;  3TNP B;  1HW5 A;  3BIW E;  1QF3 A;  3K48 A;  1UX7 A;  1VAV A;  5IUQ A;  1GOG A;  2H0V A;  5A6Z A;  5T5J A;  1BMV 1;  2ARA A;  2R0H A;  4XDO A;  4AVS A;  4CUB A;  1R09 2;  4YG3 A;  3WP3 A;  2XG3 A;  1S0I A;  4IGP A;  2VTX J;  3IPV B;  3A7Q A;  1K3I A;  1N1V A;  4XUO A;  3QD6 A;  3KGL A;  3N7L A;  2HYX A;  5A33 B;  1MEC 2;  1S0G A;  5H9Q A;  5JOY A;  5JWP A;  2VOK A;  3GCW A;  4GMP 3;  4GWJ A;  2Y8K A;  1CAU A;  1RIT A;  3I2O A;  5A70 A;  4RQP A;  1SCS A;  4P08 A;  2GSY A;  3SKJ E;  2OZ6 A;  2RS5 1;  4DO0 A;  1I3H A;  2DFB A;  3LZZ A;  3O1P A;  1JOJ A;  1PO2 1;  5A80 A;  2JB8 A;  3P5B A;  4NE9 A;  3VZO A;  4P9Y A;  1AHS A;  1AYM 2;  1LOA A;  1T2X A;  2VAU A;  4BOW A;  4DY3 A;  3ZPY A;  5A1F A;  1UY1 A;  1GV9 A;  5EQU A;  2ZX2 A;  3WNM A;  3I2I A;  3RZZ A;  3W59 A;  4D0Q A;  1FV3 A;  1QU0 A;  1K45 A;  1YJK A;  2NQY A;  2HWD 2;  1HRV 1;  2HWC 2;  1ND2 A;  4HOO A;  4HVQ A;  1OI6 A;  4NWV A;  3OUH A;  1OPM A;  3VBU A;  4P9L A;  1RUD 1;  4AHX A;  1ND3 B;  3ZYI B;  3I2D A;  5IVF A;  2TNF A;  3GGL A;  3ZFG C;  3GHN A;  1HKD A;  4BQ2 A;  4QX7 A;  5A7P A;  1AX2 A;  3ZXK A;  2W0X A;  1A3K A;  4AGG A;  1GQG A;  3PUA A;  4JDM A;  3VGI A;  1QQP 3;  2QQN A;  3ZN5 A;  4A45 A;  4PQQ A;  4BK4 A;  4HKL A;  1SLI A;  2RR1 1;  2V5D A;  3KV9 A;  3V0B A;  2WT0 A;  1TNR A;  4XUT A;  2O8Q A;  4GKY A;  5LA9 A;  1RUG 1;  4IEU A;  4MGT A;  3MV0 1;  1H2K A;  2XLA A;  4AQ2 A;  2GC2 A;  2HWB 2;  3I2F A;  4GJY A;  4MXW A;  4N8M A;  1Z78 A;  4AG4 A;  4DUX A;  3OY8 A;  4Q4W 3;  4YRD A;  4IQP A;  2W5F A;  4DUW A;  1D7P M;  4AGV A;  5FXZ A;  1G6N A;  3X29 B;  2H0B A;  3JUU A;  4ONU A;  1GOH A;  3I59 B;  4PIZ A;  4Q29 A;  4OQ9 A;  2JEC A;  3WNK A;  1ZRC A;  1IHM A;  2H6B A;  4IES A;  4S2G A;  3O7O A;  5EXO A;  1C8N A;  1OSG A;  4AED C;  4W65 A;  5T5L A;  1UY0 A;  4H2A A;  2JWP A;  5CKQ A;  2C6S A;  2E7A A;  3HEI A;  3NJY A;  2ZX1 A;  3JQX A;  2GH2 A;  2GAU A;  1UN1 A;  3DUI A;  1RUE 1;  2VZQ A;  4G4F A;  5D8A A;  5C3R A;  3NAP A;  4YYO A;  4QX8 A;  1VBB 2;  2BBV A;  2VQA A;  1AR8 2;  2WZR 3;  1JBC A;  4RQP C;  2OS2 A;  1PNG A;  2MNG A;  2F4P A;  1JOP A;  5IVB A;  1ULD A;  2WWU A;  4I2O A;  2V73 A;  5DPN A;  1V6M A;  4FPF A;  4M3C E;  4COU A;  4MZU A;  4GA9 A;  5GJ6 A;  1VE0 A;  5GLW A;  4WM8 B;  2QTW B;  3DEC A;  4D8M A;  3JB4 C;  2GNT A;  2IXI A;  4OFG A;  3WG2 A;  1JOB A;  1V70 A;  2RS3 3;  3B5L B;  5DUW A;  5A3N A;  2DCJ A;  4QHO A;  2HWF 1;  1Y7B A;  2VZS A;  2Q1M A;  4NO4 A;  1ZZB A;  2BGO A;  1I6X A;  5FPV A;  3O0W A;  1KQR A;  3VZJ A;  5ACA 1;  3THP A;  5G04 L;  2WR9 A;  4I02 A;  3U1X A;  2IUW A;  4OYU A;  5HCA A;  4HFS A;  5K0U C;  4XJA A;  1RUO A;  4M3C B;  3U75 A;  2IWG B;  1COV 2;  4UFL A;  4XCB A;  4OUE A;  2FDH A;  2WS9 1;  5GLV A;  5JI9 A;  2PLV 1;  2HH9 A;  3HQR A;  5J36 A;  5FMD A;  4CUA A;  5HV4 A;  4DPN A;  2RJ2 A;  5FOB B;  4FXG B;  1RUE 2;  3LOB A;  1OA4 A;  2QQI A;  1OHF A;  5FDB A;  3SIT A;  3WW4 A;  4IV1 B;  1F15 A;  1UKR A;  1PX4 A;  2DCY A;  1JYX A;  2RS5 2;  2W1W A;  4GZ9 A;  2ZHN A;  4Q8L A;  2A73 B;  1MAC A;  3TAY A;  1Q8Q A;  4YNI A;  3JZV A;  5JPN B;  1QY4 A;  2DVF A;  4XET A;  1G9C A;  1K5M B;  2BJS A;  2WZE A;  5FYM A;  3VZM A;  1DFQ A;  2XWB B;  3DL3 A;  4LR4 A;  1HRV 2;  4LOT A;  3I2J A;  1ONA A;  1AR9 3;  1S2E A;  1UQX A;  2O8O A;  3FBY A;  4IEY A;  4PHZ A;  3WQ0 A;  3BAL A;  1XPW A;  4N9H A;  3WD5 A;  3A4U A;  4YVS C;  3W20 A;  2HWD 3;  5CFD A;  2OYZ A;  3DPR C;  1HB1 A;  2PQQ A;  5SV8 A;  1XE7 A;  2I74 A;  3THT A;  4AVA A;  3CJX A;  4ZPI A;  3ZXF A;  5FYT A;  4JV4 A;  4K40 A;  1WMF A;  3AFK A;  4Z07 A;  1W6O A;  4C1X A;  4FO9 A;  2CWS A;  1JW6 A;  5AC9 1;  1WBF A;  2E7Q A;  3BCW A;  2BWA A;  3CJI C;  2A6V A;  3UYJ A;  1LGN A;  1UY3 A;  4W4Z A;  5LBE A;  3ACH A;  5EJZ B;  1LKN A;  5FZO A;  5ABJ A;  2RS1 2;  3RYP A;  4MET A;  2BRT A;  1A8M A;  4FOV A;  2YFU A;  3MIH A;  1SLA A;  1RMU 1;  3KZ4 C;  2JEN A;  3GZA A;  4K8F A;  5FQ0 B;  4X8P A;  4CXX A;  1PHM A;  2JDU A;  3LA2 A;  3EBR A;  3TRS B;  2IFW A;  2E51 A;  1LR5 A;  4XTM A;  4A3X A;  2Q8O A;  5E89 A;  1RHI 1;  1GFF 2;  1E5H A;  2KD7 A;  4QQL A;  4BQX A;  4YZ4 A;  5A32 A;  3RZH A;  1HRI 1;  2D93 A;  3NJV A;  2QZ3 A;  3UET A;  2DYC A;  3A23 A;  5DAW A;  3D4K A;  3LDB A;  3JBG 1;  2EXJ A;  3WDV A;  3AP6 A;  1S2B A;  3ZXD A;  4RHV 2;  4KL1 A;  4Q2F A;  1UY4 A;  4B1M A;  1ZRI A;  4MSV A;  1Y9G A;  3I54 A;  3OB8 A;  1XYN A;  5BPX A;  3AYE A;  3RYK A;  5FUP A;  4AEM A;  4FT8 A;  3PL0 A;  3FHQ A;  5L73 A;  1KFX L;  4HVO A;  4K6B A;  4Q4Y 1;  3CF6 E;  1PNF A;  4W50 A;  4XUN A;  5DAQ A;  3MDP A;  3LFI A;  4U36 A;  2N7G A;  3KWV A;  4OLL A;  4AWD A;  5F3C A;  2G4I A;  3V0B B;  1LED A;  4FP2 A;  2AR6 A;  2DVA A;  1QH7 A;  5F3E A;  4IGQ A;  5LWB A;  2YYO A;  4MXW B;  1QJU 3;  1IS3 A;  2Q0A A;  5FZ6 A;  4P00 B;  2AEZ A;  4CDU A;  2XVL A;  4IXL A;  5GLT A;  2E9Q A;  3TEY A;  1UIJ A;  1HJF A;  3N36 A;  5A7W A;  2WNO A;  1UPS A;  4Y22 B;  3RZM A;  3AKQ A;  1OA3 A;  1LOE A;  4H7L A;  1D2S A;  2YMZ A;  3I3E A;  1Q43 A;  2ZMN A;  5C8W A;  3FFQ A;  1XB9 A;  2XJS A;  4AAP A;  1ZVF A;  2GZW A;  4QX0 A;  2WRA A;  4NHL A;  1Q8V A;  2UY8 A;  3ALQ A;  5F3G A;  1BEV 3;  1CAX B;  2RS1 3;  4XIK A;  3KCC A;  5T55 A;  4C0B A;  1FOD 3;  1VBA 3;  2PHX A;  3ACL A;  3J7H A;  5ABJ C;  2UUR A;  2Q8C A;  4W6X A;  1J1T A;  4YGE A;  4QDQ A;  3KQ4 B;  2W47 A;  4K21 A;  5FK8 A;  2WFP A;  2VZU A;  3FC0 A;  1NAE A;  4NWW A;  2XJP A;  3OSD A;  1BMV 2;  1N1T A;  1UZW A;  2ZGU A;  1KIT A;  1Q8P A;  2R0F A;  3F95 A;  4XUR A;  3RVH A;  1RUG 3;  4YW1 A;  1S1A A;  3O1R A;  1PIV 2;  3AP9 A;  4I01 A;  1UXX X;  4WZC A;  3BOW A;  2HWE 1;  3ZFE B;  3OJB A;  3ZMO A;  5KC5 A;  3ES4 A;  4N53 A;  2VNG A;  4IV3 B;  5DQ0 A;  1IKQ A;  4GAL A;  1V9U 2;  5FMC A;  4XAE A;  4CCD A;  2VUL A;  3EHK A;  4HZF A;  5FR3 A;  5E6H A;  3NV1 A;  4NII A;  1QOT A;  3U07 A;  1N3O A;  5FJH A;  3V0A B;  5CIS A;  2UU8 A;  2P3J A;  2FDF A;  5K8S A;  1RUD 3;  4IW3 A;  3T3Y A;  3FL7 A;  3Q8A A;  5AFE A;  4AFC A;  3IN9 A;  1A34 A;  5F5I A;  2WQZ C;  3BOP A;  4Y20 B;  1H8T B;  4E27 A;  2DTY A;  1WKY A;  1GNH A;  5CBL A;  4X6R B;  1AF9 A;  1VRH 3;  3V65 A;  2BUK A;  3UK9 A;  1RUE 3;  1HQN A;  3M3E A;  2ZXQ A;  3MBW A;  4DXS A;  2X53 S;  1GWM A;  2NMN A;  2PEL A;  1KS5 A;  5C8C B;  4NIG A;  2ENR A;  1XRU A;  4CVU A;  1BK1 A;  1XYP A;  4K20 A;  5F32 A;  1OFN A;  2ZGR A;  5J48 A;  3UV9 A;  1ODN A;  3SEP A;  1W28 A;  1F5J A;  2B8M A;  1PGW 1;  3JQW A;  3RS6 A;  4CPB A;  4RA0 A;  4KWU A;  3S6P A;  3N4M A;  4FOQ A;  2RMU 2;  3WW2 A;  1UYZ A;  4JAA A;  1UMI A;  3GYD A;  2D5F A;  2Y60 A;  2QQW A;  5IK4 A;  3THD A;  2GMP A;  5BNP C;  3VBO C;  1AYN 3;  2FZ2 A;  2RR1 2;  3SLI A;  2C4X A;  3QOP A;  1SLL A;  5E1R A;  1G9A A;  1H4H A;  4LBQ D;  4Z2A A;  1AR6 2;  2PHU A;  2W46 A;  5FO8 B;  3KCY A;  4URT A;  1S0C A;  3LDK A;  3TN9 3;  5A7Q A;  2JE9 A;  3NJX A;  1HB3 A;  4ITC A;  1SPP A;  4QX2 A;  2A70 A;  5IJR A;  1QQP 1;  5KHG A;  1JZ5 A;  1FPN 1;  1ZRE A;  5FZE A;  3FHA A;  3BU0 A;  2PHD A;  3D0J A;  1M4W A;  3AKP A;  1O3T A;  2JIC A;  3OGS A;  3SH4 A;  2AYH A;  2LAL A;  3VBU B;  3MZH A;  5AC9 3;  1F5F A;  2A71 A;  2XJT A;  4YW4 A;  4RL7 A;  4OHX A;  2EAK A;  4QU2 A;  1GP5 A;  4UW4 A;  1VMH A;  3HR9 A;  3U14 A;  4DNY A;  1OD5 A;  1PX3 A;  1V6J A;  3EXU A;  1DGW A;  1GNZ A;  4N53 C;  5T54 A;  1QJE A;  2WIN B;  2PA7 A;  2X10 A;  3LFM A;  2PQS A;  2R30 A;  3WR0 A;  1VBB 1;  3RMX A;  4CDQ C;  4QWN A;  4EE2 A;  1AR9 1;  2D3P A;  1PO2 3;  1HX6 A;  4XOG A;  1S55 A;  4QD2 A;  1DZT A;  1HQW A;  1VBA 1;  1Z0H A;  3WF2 A;  4YM3 A;  2OPW A;  2VZ3 A;  3MIC A;  5FQ0 A;  4LT5 A;  2BQP A;  4UW3 A;  5EWS A;  4XQW A;  1BZW A;  1BEV 1;  4TWT A;  4CEY B;  1X8M A;  2W1U A;  1V6I A;  3I59 A;  1UF2 C;  4CCK A;  1URX A;  1YRZ A;  1N3Q A;  3SXW A;  1LGC A;  3SHR A;  5DMY A;  4AHZ A;  3OOX A;  4XJ8 A;  3SCH A;  4UW6 A;  1ZRD A;  2WFF 1;  3POJ A;  2R6Q A;  1QOO A;  4KQ7 A;  4XJW A;  2IXC A;  3WDW A;  5FIX A;  3VDB A;  1ND2 C;  4TSV A;  4OQ8 A;  4OVE A;  3FWE A;  2VTX A;  2WAB A;  4BU2 A;  1QKQ A;  5BV6 A;  5BYN A;  2FBE A;  2WS9 3;  4D6S A;  2V4V A;  3C3V A;  4FTS A;  3PLQ A;  1LGB A;  1FPN 2;  1UWW A;  2JDY A;  2OXB A;  2Y6G A;  4AXO A;  2PXJ A;  4LBL A;  3UL2 A;  2VVE A;  1FOD 2;  1EPZ A;  2VO5 A;  2YBP A;  4XW3 A;  1AR8 3;  4ERO A;  3MHZ A;  2VUC A;  1CX4 A;  1VAL A;  1WGP A;  1YI7 A;  3GZU C;  3VHN A;  3RG0 A;  2ETE A;  3NNJ A;  4CEW B;  4B1L A;  5FJK A;  4AEJ A;  1OLQ A;  4JKK A;  3W58 A;  1H1M A;  4WM7 A;  3D0S A;  4QGM A;  2FDJ A;  2VMG A;  4QKD A;  5FY4 A;  1GMM A;  2JDP A;  1SDD B;  3JXS A;  3WQ1 A;  3WX5 A;  3HT1 A;  1W6Q A;  4M01 A;  2R7E B;  4B4P A;  4CCJ A;  3VKL A;  1V9U 3;  2YDE A;  2W1S A;  1UOJ A;  2CWM A;  2VCC A;  3MIG A;  3OBZ A;  4LO5 B;  2D7F A;  5F8P A;  3U10 A;  5FYH A;  2VOW A;  4LHK A;  1NG0 A;  5FMO L;  3RWN A;  2XB6 C;  3Q9O A;  5CFD C;  5I8T A;  1JUI A;  4QKB A;  3CKH A;  4YVS A;  2XR4 A;  2B42 B;  1XNC A;  4JGY A;  2XJR A;  3L2Y A;  4O61 A;  3KHB A;  1W8O A;  1DG6 A;  1WBL A;  1AYN 1;  2ZJC A;  1JH5 A;  1MZE A;  1W3V A;  3HN1 A;  2ZGS A;  1W2A X;  5GZG A;  1EY2 A;  1RUI 2;  2WAA A;  2AEY A;  4XUP A;  4HLT A;  5B4X A;  3WSO A;  4CCN A;  3CEW A;  4CCC A;  5CFD B;  2ZX4 A;  3H1Y A;  1ZZ6 A;  3A0N A;  1EUT A;  4ISQ A;  2W92 A;  3FHI B;  1QGL A;  2AAC A;  2ZPX A;  5CEH A;  4AI3 A;  4XF1 A;  2C5D A;  2CDO A;  1K5M A;  3HN3 A;  4P9X A;  5F5Q A;  4LBQ A;  4L9B A;  4E9K A;  4TLF A;  3O1V A;  2J1A A;  3M3Q A;  2LW8 A;  1ZRR A;  3PJQ A;  4P14 A;  2VCB A;  2DVD A;  2J1V A;  3R4U A;  4JKM A;  4Z1V A;  2RJK A;  1O3Q A;  3NNL A;  4LNV A;  2R16 A;  2YC4 A;  1DYO A;  5F37 A;  2VXR A;  2EIE A;  4FBF A;  5FP3 A;  3FBM A;  4EN6 B;  3GCX A;  5KXB A;  3FJS A;  2KXL A;  1POV 3;  4PLM A;  5F9T A;  2P34 A;  2FQP A;  3WDT A;  4D94 A;  1ENS A;  1ZZ9 A;  2E53 A;  5JDB A;  1BHG A;  4Y1V A;  2BWC A;  4LBM A;  4IV1 C;  4KGQ A;  1PGL 2;  1TMF 3;  3BOD A;  4CP1 A;  4LBK A;  2XBO 2;  5JIU A;  5JLV A;  4AHY A;  1FV2 A;  1Q5O A;  4MGZ E;  1EP0 A;  4JDO A;  5DAP A;  1ZX5 A;  5FXX A;  5KHI A;  2ZHK A;  3PUH A;  4AI1 A;  2A6W A;  4CCL A;  1NA1 C;  4ZU4 A;  1UZ0 A;  5L36 A;  2FZ1 A;  3T1L A;  3WNO A;  4LHS A;  3U4S A;  2W94 A;  4EN8 B;  5FO9 B;  1LHV A;  1UAI A;  1V6L A;  4XFC A;  1JS9 A;  4PIX A;  3L9J T;  3ZOI A;  1VRH 1;  1GR3 A;  3H7J A;  3KMH A;  4C8D A;  3E6B A;  1SPP B;  2DVG A;  3RGB A;  4QPI C;  2BVB A;  1RJ8 A;  1BKZ A;  2ZGN A;  5LY1 A;  1W9S A;  3PVE A;  3LD8 A;  3AC0 A;  1RUJ 3;  4CE8 A;  2QQK A;  4EZH A;  2ZEY A;  2GND A;  4NRQ A;  3NO8 A;  4AOC A;  1WA6 X;  5JPM B;  3VN4 A;  2VZ1 A;  1RUC 2;  1NCQ C;  1X33 A;  2WNV C;  2WZ8 A;  3LF7 A;  1W9Y A;  4OUL A;  4WVM A;  5FBZ A;  1CON A;  4DIN B;  4NIA A;  5C4W A;  2XJV A;  2LTN A;  3JD7 3;  4UWD A;  1CD3 G;  2RG4 A;  2FDG A;  5IK5 A;  2BBA A;  1E5R A;  3AFG A;  5EPA A;  3ZFF B;  1X7N A;  1C1F A;  5A1A A;  4V2V A;  3HIF A;  4M0H A;  5DUX A;  5A3W A;  1C8M 3;  3T1M A;  1D4M 2;  1UX6 A;  3N7M A;  2WZP P;  1KJL A;  5BY5 A;  1ZBE 1;  3AZV A;  4LTA A;  1QJX 2;  2JG9 B;  1RUI 1;  1WA4 A;  2A75 A;  2XHN A;  1Q56 A;  5HXM A;  3Q8C A;  3AYA A;  5GKA C;  1B35 B;  2OKX A;  1UU6 A;  2XBO 1;  4DOU A;  5CVR A;  3MYX A;  4MGS A;  3OYW B;  2JDM A;  3C7O A;  2VZT A;  1J83 A;  2BGC A;  4MUV A;  3ZN6 B;  3B69 A;  2JG8 C;  3NMB A;  5BNQ A;  4NPL A;  2BW8 A;  2JD9 A;  3H8O A;  2J1S A;  2HBT A;  3MW3 A;  3LE0 A;  1BK0 A;  4BLJ A;  1OMI A;  3OPZ A;  3R4S A;  1D0G A;  2WT2 A;  4E4H A;  4ZXE A;  2WN2 A;  4Y1Z A;  1CVN A;  2VNR A;  5JXH A;  1OH4 A;  3IDE A;  1OUX A;  4M3C A;  5FZA A;  1RUI 3;  1OQE A;  2MPF A;  3BPZ A;  3LKJ A;  4LLO A;  1ZBE 3;  1BJQ A;  4Q0U A;  5FYC A;  1HV1 A;  4Q4X 1;  1GWL A;  3AM2 A;  2A3X A;  5FZ1 A;  3Q8B A;  1R08 2;  4V2W A;  4MO3 M;  3QAC A;  1C3H A;  3APB A;  1QNY A;  3ILF A;  2YU2 A;  4IUG A;  3VBF A;  4CU9 A;  3ZXG A;  5BNO B;  2QUO A;  1CAW A;  2OUH A;  2CNA A;  2KA3 A;  4QQH A;  4XVH A;  5EFU A;  1D2Q A;  2AH2 A;  4QXH A;  2NLR A;  1RUJ 1;  1CIY A;  4N7I A;  1YIF A;  5JSR A;  1W6P A;  4XUQ A;  1ZA4 A;  3BUC A;  1QJY 1;  3AMN A;  4K3U A;  1W6Q B;  1WCQ A;  4ES9 A;  4IDZ A;  1QJX 1;  2Y0O A;  5I0T A;  3HT2 A;  5FK7 A;  2JIJ A;  3C8X A;  2ADD A;  1J3R A;  5LW9 A;  1SG3 A;  2DUQ A;  5KXC A;  1W3X A;  4E8C A;  2X8K A;  4UAP A;  3O1M A; 
#chains in the Genus database with same CATH homology
 2WUH A;  4OUE A;  1OT5 A;  1ULO A;  1GOF A;  4CUA A;  1JU3 A;  4A3Z A;  1YQ2 A;  3NRU A;  2RJ2 A;  1US2 A;  5LA0 A;  2QQI A;  4JHZ A;  2J1U A;  3VD7 A;  4PT6 A;  2WO3 A;  1OF3 A;  1NKG A;  1PX4 A;  2C26 A;  2W1W A;  3LQC A;  4GZ9 A;  4ZZ5 A;  1JYX A;  5JR2 A;  4YPJ A;  2Y6K A;  1F4A A;  2EID A;  3ECQ A;  5LA2 A;  5JXI A;  2VZO A;  3CMG A;  1SHW B;  2J22 A;  1KEX A;  2WN3 A;  2WZE A;  4QDS A;  4UI9 L;  2W3J A;  3I2J A;  1XPW A;  3GM8 A;  4DXT A;  2J1E A;  1CZT A;  4RYD A;  1TVG A;  2YG0 A;  3UES A;  4DEV A;  3P6B A;  2Z4F A;  2VZR A;  2BGP A;  4QPW A;  2XQX A;  5C70 A;  3W5N A;  3I3D A;  2WAO A;  2HLE A;  2EIC A;  1UY3 A;  4W4Z A;  3ACH A;  3T2P A;  4P5Y A;  5EJZ B;  3D3A A;  3K77 A;  3K46 A;  3DYP A;  4ARY A;  2YFU A;  3BGA A;  2E31 A;  4KMQ A;  3MO4 A;  2W1Q A;  2VR4 A;  4BXS V;  3LEK A;  1W99 A;  4OMC A;  2KD7 A;  2E32 A;  3SEE A;  1JHJ A;  1GNY A;  1XNT A;  2EIB A;  3NJV A;  3UET A;  3A23 A;  1NUK A;  2E33 A;  5B4N A;  1UY4 A;  3BN6 A;  3WF4 A;  3OB8 A;  3WNP A;  5FUI A;  2VZP A;  3FHQ A;  2WBK A;  4W50 A;  4XUN A;  4E8C A;  2VL4 A;  4A4A A;  4A44 A;  2W91 A;  3OGR A;  3K4Z A;  4P00 B;  1L7Q A;  1RYY A;  4KI5 M;  2VMC A;  3K75 B;  1GUI A;  2E26 A;  3III A;  2W95 A;  4JKL A;  3I3E A;  2X05 A;  2VTF A;  2VCA A;  2Y6L A;  4QX0 A;  5IFT A;  5IHR A;  4LQR A;  4QB1 A;  4MAD A;  1US3 A;  2QQJ A;  5I0D A;  2Y6J A;  1GU3 A;  2ZEZ A;  3J7H A;  5C7G A;  3WF3 A;  4A41 A;  4QDQ A;  3UNP A;  2W47 A;  5JXG A;  3ETP A;  3LPG A;  3WF0 A;  2VZU A;  1IQD C;  1W0N A;  1DLC A;  1NAE A;  3K4A A;  3WQB A;  4XUR A;  1I5P A;  1UXX X;  2QQO A;  1JZ6 A;  3T0B A;  1JYW A;  5DQ0 A;  1W9W A;  5F7U A;  2VC9 A;  4BDV B;  4L0P A;  3PUI A;  2ID4 A;  5EIY B;  2J1T A;  4UOJ A;  3T09 A;  4QX3 A;  4MGQ A;  3FL7 A;  3HPN A;  3I2K A;  2ORX A;  3C7G A;  1OF4 A;  1K42 A;  1LNS A;  3VD4 A;  1K12 A;  2B9V A;  1WKY A;  4DXR A;  4OMD A;  4RN5 A;  1W9T A;  3I2G A;  2ZXQ A;  3MBW A;  2WO1 A;  1MPX A;  4DXS A;  2RVA A;  1JZ4 A;  4CVU A;  2WDB A;  3C7F A;  1H6X A;  3CDZ B;  4QAW A;  3SEP A;  3FN9 A;  4ZY9 A;  1UY2 A;  4KWU A;  4MOA A;  1ULP A;  1UYZ A;  3IB3 A;  1UMI A;  4ZZ8 A;  3VD5 A;  2CDP A;  3OG2 A;  3THD A;  5CZK A;  3WNN A;  3K4D A;  2VZV A;  2ZEW A;  2C4X A;  3T2O A;  3NQH A;  4Z2A A;  2W46 A;  2WO2 A;  1DP0 A;  3E1F 1;  1F4H A;  3I97 A;  3NJX A;  3P1I A;  4QX2 A;  1H6Y A;  5IJR A;  1JZ5 A;  3FHA A;  3SKV A;  3OGS A;  2J7M A;  3EYP A;  2BZD A;  3T0D A;  3T08 A;  1UXZ A;  3IAP A;  1PX3 A;  2X10 A;  2PQS A;  3WF1 A;  3CZU A;  2WYS A;  2Y64 A;  4AAX A;  5EJ1 B;  2YC2 A;  3WF2 A;  2VZ3 A;  1O59 A;  5LCW L;  3C7H A;  4M4P A;  2W1U A;  2VQT A;  3A21 A;  2WQ8 A;  4M4R A;  1HN1 A;  4OZO A;  5DMY A;  5DN2 A;  3IAQ A;  4GWI A;  4DUV A;  2J1R A;  5LA1 A;  1O8S A;  1UYY A;  3VDB A;  2JDA A;  2WAB A;  2YB7 A;  2V4V A;  1UWW A;  5IYY A;  3MV1 1;  3WNL A;  4W8J A;  2Y6G A;  4CUC A;  3THC A;  1JZ3 A;  2XON A;  1UYX A;  4XZU G;  2VO5 A;  4HG6 B;  3OGV A;  3ACI A;  4LKS A;  3GDB A;  2DDU A;  2VM9 A;  4QDR A;  2X09 A;  3HJR A;  2VQU A;  3MUY 1;  4ARX A;  5C71 A;  4JKK A;  1OD3 A;  5G05 L;  3EB7 A;  4DEQ A;  2VJX A;  4E8D A;  1GMM A;  2YFZ A;  1SDD B;  3JXS A;  2QBX A;  3C7E A;  3OEA A;  3CQO A;  1L7R A;  2R7E B;  3OBA A;  2W1S A;  2VCC A;  4QX1 A;  2RV9 A;  4A6O A;  5IFP A;  2QQM A;  3LEI A;  2LS6 A;  3CKH A;  3MUZ 1;  2W87 A;  1CZV A;  4CU6 A;  1CZS A;  1XNA A;  2B4K A;  2VOT A;  4ET7 A;  1W8O A;  2VMD A;  3F2Z A;  1XC6 A;  1NX9 A;  2Y6H A;  2DCK A;  4A42 A;  4PF1 A;  5J1X A;  2WAA A;  3VDC A;  1O8P A;  4XUP A;  1GQP A;  5B4X A;  3WSO A;  3CIH A;  1EUT A;  2W92 A;  2VME A;  1W8N A;  5CYY A;  2CDO A;  3HN3 A;  3OEB A;  2J1A A;  2ZEX A;  2LW8 A;  1UMH A;  2VCB A;  5JMO A;  2J1V A;  1EUU A;  4JKM A;  5JXJ A;  4BJ0 A;  3T2Q A;  2YC4 A;  1DYO A;  1PMJ X;  5HPO A;  1KGY A;  2EIE A;  2VMF A;  1UX7 A;  1GOG A;  2QQL A;  1PMH X;  4CUB A;  1TG7 A;  2XOM A;  1BHG A;  2V72 A;  3A7Q A;  1K3I A;  4XUO A;  3ZM8 A;  2HYX A;  3A22 A;  4GWJ A;  2Y8K A;  3HNB M;  3PUH A;  2BER A;  3DYO A;  1J84 A;  1UZ0 A;  4P08 A;  3SKJ E;  1JZ7 A;  1JYV A;  3WNO A;  3CZJ A;  4LHS A;  3LEG A;  2W94 A;  1T2X A;  3GXU A;  3HOB A;  1UY1 A;  1JZ8 A;  3WNM A;  3I2I A;  4D0Q A;  1K45 A;  3ACF A;  1W9S A;  3AC0 A;  2QQK A;  2ZEY A;  3ACG A;  2VZ1 A;  2W9X A;  2WZ8 A;  3GGL A;  4TTG A;  1R64 A;  4A45 A;  2QQN A;  3ABZ A;  4PQQ A;  4BK4 A;  2V5D A;  2BBA A;  2L9L A;  4TXW A;  4XUT A;  5A1A A;  3HNM A;  3W5M A;  2ORZ A;  3MV0 1;  1JZ2 A;  3I2F A;  4QB6 A;  4DUX A;  4AG4 A;  4JX0 A;  2XHN A;  5HXM A;  1JYN A;  2W5F A;  3IDA A;  4DUW A;  1D7P M;  2JKX A;  2OKX A;  4MGS A;  3HNY M;  1GOH A;  3C7O A;  2VZT A;  1J83 A;  3WNK A;  1P8J A;  3DYM A;  2JE8 A;  1UY0 A;  2JD9 A;  2J1S A;  3T0A A;  3WEZ A;  3LE0 A;  3HEI A;  4ZXE A;  4P02 B;  2WN2 A;  2VZQ A;  5JXH A;  1OH4 A;  4BK5 A;  1CX1 A;  4CU7 A;  5DPN A;  5JUV A;  4MO3 M;  1JI6 A;  4IUG A;  3DEC A;  4LPL A;  4CU9 A;  4D8M A;  4QB2 A;  2C9K A;  3I3B A;  4XVH A;  3VDA A;  2DCJ A;  2VZS A;  3VD9 A;  3VD3 A;  1CIY A;  4XUQ A;  3LPF A;  2BGO A;  1WCQ A;  3NNG A;  4CU8 A;  3U37 A;  4FI9 A;  5G04 L;  3I2H A;  1JU4 A;  3C8X A;  1SG3 A;  4OYU A;  4UAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...