4ZZ5A

X-ray crystal structure of chitosan-binding module 2 derived from chitosanase/glucanase from paenibacillus sp. ik-5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
HNLALNKATATSSIETAGHEGDKAVDGNAATRWASAYGASPQWIYINLGSTQSISRVKLNWEDAYATAYSIQVSNDSGSTPTNWTTVYSTTTGDGAIDDITFAATNAKFVRVYATTRATAYGYSLWEFEVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucanase/chitosanase
publication title Mechanism of chitosan recognition by CBM32 carbohydrate-binding modules from a Paenibacillus sp. IK-5 chitosanase/glucanase
pubmed doi rcsb
source organism Paenibacillus fukuinensis
molecule tags Hydrolase
total genus 32
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature ec 3.2.1.132: Chitosanase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4zz5A00
3HN3A 1O8PA 3PUHA 2QQJA 3T2QA 4P02B 4QPWA 1GOFA 2W3JA 3IDAA 3WF1A 4QB6A 4DXSA 2VMFA 2V72A 2W46A 4GWJA 3C7OA 3P1IA 3PUIA 2VZVA 3GM8A 2E26A 4A44A 1K42A 3HOBA 3I97A 3K77A 3SEEA 5IFPA 3NRUA 4AG4A 2JDAA 2X09A 2J1TA 4DUWA 3OB8A 5B4XA 2J1VA 2YG0A 1F4HA 1GU3A 1K3IA 5IFTA 3MUY1 1JYXA 1H6XA 3C8XA 1EUTA 3WNLA 4TXWA 2WBKA 3UESA 1ULPA 3CIHA 3DECA 3T09A 3DYOA 1NKGA 1NAEA 1KEXA 1W9SA 5F7UA 4A42A 2WUHA 1GQPA 1K45A 1SHWB 2JKXA 2YC2A 4RN5A 1J84A 4RYDA 3SKVA 5C71A 3LEGA 4QX2A 4CU9A 3EB7A 4BJ0A 1T2XA 3ACIA 5DQ0A 3OGRA 5DN2A 3JXSA 3K4ZA 2LS6A 2VZ1A 4XUQA 5EIYB 2CDOA 3FL7A 2Y6JA 3K4DA 3K4AA 3U37A 1US3A 3GDBA 2E32A 3I2IA 1W9TA 2WO3A 1F4AA 2W94A 4IUGA 3UNPA 2W92A 4CUBA 2VMCA 3I2KA 3WQBA 4KI5M 3SKJE 4QDQA 1UYXA 2JD9A 4TTGA 2E33A 5C7GA 4ZZ8A 2YB7A 3NJVA 1UZ0A 3ACGA 3CMGA 3MV01 1JU3A 2WAOA 2Y64A 3W5MA 4QDSA 5B4NA 1JZ2A 5IJRA 2KD7A 1UX7A 4A3ZA 4UAPA 3ETPA 2EIBA 4P08A 2WN2A 3OGVA 1R64A 1DLCA 3THCA 1SG3A 3A7QA 1UXZA 5G05L 3BN6A 4JHZA 4XURA 1WCQA 1XNAA 2ID4A 2VZUA 2VZOA 3VDAA 3LPGA 4DEVA 3WNKA 2WN3A 2QQNA 4CU7A 4CU6A 1TVGA 1XNTA 3DYPA 3HNMA 5FUIA 4OMCA 4UOJA 3UETA 2VZ3A 4JKMA 1JZ5A 2Y6KA 3K46A 4MGQA 5IHRA 3HNBM 2VM9A 4YPJA 1CZSA 3ABZA 3A23A 4D8MA 2BGPA 3WEZA 2VQTA 2YFZA 2LW8A 4P00B 1J83A 4PQQA 2VZQA 2VJXA 4ZZ5A 2VCBA 3IB3A 2W5FA 1WKYA 4M4PA 2Y8KA 1W9WA 4PT6A 2W47A 3SEPA 2BBAA 2J7MA 4W8JA 4DEQA 1I5PA 4XUOA 1GUIA 5DMYA 1NUKA 1KGYA 1UXXX 5EJZB 3GXUA 4QB2A 1OD3A 5IYYA 1UYZA 5LCWL 3WNOA 1UWWA 1CZTA 5A1AA 2QQOA 4XZUG 1OF4A 3CDZB 2HLEA 4ARYA 2BZDA 5C70A 2X10A 2R7EB 4L0PA 1O8SA 2VMEA 1TG7A 1IQDC 2V5DA 1HN1A 3BGAA 3CZJA 3NJXA 5JUVA 4XVHA 3LQCA 2XOMA 2ZEYA 2X05A 4OMDA 1D7PM 5JXGA 2Y6LA 1RYYA 1JZ4A 1W0NA 3OGSA 1JZ3A 2XHNA 2EIDA 4JKKA 4DXTA 1W8OA 4P5YA 1GOGA 2W1WA 2CDPA 1L7QA 2VR4A 3I2HA 3CZUA 5JXHA 1UMHA 2VTFA 1GOHA 3IIIA 3WF4A 1JU4A 3C7HA 3I2FA 3ECQA 5CYYA 2VZPA 2OKXA 1XC6A 1L7RA 5HXMA 3FHAA 3CQOA 2BERA 4CUAA 3I3BA 3NNGA 2VCCA 2W1QA 4CU8A 1O59A 2C26A 4KWUA 2J1SA 2VQUA 4BDVB 2JE8A 2W9XA 4QX0A 2ORXA 4M4RA 2HYXA 2VL4A 2W1SA 3WF0A 1BHGA 1JZ7A 4XUPA 4E8CA 2ZEZA 3FN9A 4HG6B 2EIEA 3VD7A 2RVAA 2WZ8A 1JYNA 3I2GA 2VZSA 4QAWA 3MV11 1CX1A 4ZY9A 3LEKA 1JHJA 2PQSA 2VOTA 4UI9L 4W4ZA 5JXJA 2WABA 4BXSV 4A6OA 4GZ9A 4FI9A 2XQXA 4MO3M 4OUEA 1US2A 2WDBA 3FHQA 1UY1A 1GNYA 4XUTA 4AAXA 3C7EA 4E8DA 1K12A 4JX0A 3VD5A 3GGLA 3WF2A 1MPXA 1SDDB 2WO1A 3W5NA 3WSOA 2QQMA 5DPNA 5LA2A 2QQLA 3LE0A 1NX9A 1UYYA 2QQKA 2J22A 3HNYM 3I2JA 3OG2A 1UY0A 3P6BA 2C4XA 2Z4FA 3AC0A 3IAPA 3VDCA 3T08A 3HPNA 4ARXA 3C7FA 5JMOA 1W99A 4LKSA 3VD9A 2DDUA 1H6YA 3ACHA 5EJ1B 1JYVA 3I3DA 5I0DA 2WAAA 2QQIA 2ZEWA 4DXRA 2W91A 4D0QA 3D3AA 2RJ2A 4A4AA 1P8JA 3ACFA 1OH4A 3T2PA 4ET7A 1UY3A 2W1UA 5CZKA 2DCKA 3CKHA 1JYWA 4QX1A 4QDRA 2VMDA 4CUCA 5G04L 4DUVA 2B4KA 2BGOA 3E1F1 2B9VA 2EICA 3THDA 2ZEXA 5JR2A 2VC9A 3VD3A 1UMIA 4MADA 3F2ZA 1UY2A 4LPLA 5LA1A 1DP0A 3C7GA 1JZ8A 4BK4A 3T0BA 1OT5A 3NQHA 4MOAA 4QB1A 2YFUA 1CZVA 2W87A 4Z2AA 5HPOA 3A22A 1EUUA 3EYPA 3WNNA 1UY4A 4MGSA 1CIYA 3LEIA 4OZOA 4LHSA 3K75B 3WF3A 4A41A 2J1UA 1YQ2A 2J1AA 5JXIA 2E31A 4A45A 1JZ6A 2C9KA 2V4VA 3HJRA 1W8NA 2VZTA 3WNPA 2Y6GA 2WQ8A 2L9LA 3MO4A 2ZXQA 1ULOA 1JI6A 2XONA 2J1RA 1PMJX 3OBAA 3T0AA 3ZM8A 3MUZ1 4BK5A 3MBWA 2YC4A 4JKLA 3I3EA 3A21A 1GMMA 3VD4A 1DYOA 4OYUA 4LQRA 4GWIA 2WYSA 1OF3A 3T0DA 2WZEA 2QBXA 3DYMA 1LNSA 2WO2A 4QX3A 4CVUA 3VDBA 3OEAA 3HEIA 3J7HA 2VCAA 4XUNA 1XPWA 2RV9A 1PMHX 4DUXA 5J1XA 1PX3A 4KMQA 2Y6HA 4W50A 2ORZA 4PF1A 4ZXEA 3WNMA 2VO5A 2W95A 3T2OA 2DCJA 2VZRA 3IAQA 2J1EA 1PX4A 5LA0A 3LPFA 3OEBA
chains in the Genus database with same CATH superfamily
1L3JA 2NYYA 3HN3A 5A32B 3T2QA 2QDRA 4CDUB 1LCLA 4TLGA 4YRDA 4QPWA 2X8KA 1V6LA 4OI2A 4ITCA 1GOFA 2GC0A 2W3JA 2W2IA 4AQ2A 1OURA 3WF1A 2VMFA 4K9SA 1FNYA 3VDDB 1EPZA 1KDMA 2DVBA 1Z7S1 3PLQA 1REEA 1W6OA 4IXLA 3KZ4C 1RHI1 2R062 4UFMA 2P3KA 3Q8CA 4AGVA 1MEC1 1GWLA 5CU1A 2YU2A 1H9WA 4XIOA 5FXZA 5GALA 3E5XA 1PGW2 4OI4A 1PNGA 2HH9A 3U4XA 1RUD2 4A44A 3NWKA 4INDA 5F3EA 1AR82 1VE0A 1AX2A 3PL0A 5FXWA 2F4LA 3T30A 3ZFFB 4Y24A 5IFPA 2E6VA 2JDAA 3U14A 2O8OA 2J1TA 4JVAA 2CGOA 2J1VA 4FT8A 1GFF2 4GMP3 1NA1C 4HSJA 2UWAA 4Q4W1 1JYXA 5BV6A 4EN8B 2H6BA 2YV8A 3SLIA 3KT1A 5J09A 1EUTA 3I3QA 1PZ8A 4HZFA 1Z7S3 4N9IA 4YWAA 1ULPA 3WNLA 2EXHA 4GWNA 4YVSC 2ZGKA 1WMFA 3T09A 2VUCA 2DUPA 1MEC3 4CP0A 5FO7B 5K8SA 4KBZA 4QHZA 4D7TA 5FOJB 2DWRA 1UPSA 4HK8A 2CHHA 3RRDA 4UW6A 1YQ5A 4PDWA 2GALA 2HWC2 4Q4X3 1AYN3 5CFDC 1VBC1 4IL7A 1UZYA 3OF1A 4OCTA 1NE6A 1S2BA 3POIA 1LOCA 3ZPOA 3MPBA 3FZ3A 4IEXA 4N43A 4NRMA 3AZWA 4QWNA 3VBRA 3IKWA 4CU9A 2GMEA 2RR12 2JDZA 4JGZB 4P9JA 5FY8A 5F8PA 5DQ0A 4Q4W3 4LIVA 2WNOA 1QQP3 1ZA7A 4PF5A 5BNOA 1JOPA 1OVSA 5FY1A 1SCRA 1ASJ2 1AYM1 1IS6A 3R4SA 4G3YC 4YVWC 2LS6A 5J96B 1QGLA 4Q5OA 4LBOA 5KHJA 2CDOA 3K4DA 3WZ1A 4AL9A 3UGHA 1RXFA 2VTXJ 5J7MA 4NMIA 1POV0 5HCBA 3A0NA 2YDEA 2WNUA 4FTBA 3P3NA 4R9CA 2PHWA 4N7UA 3WNXA 5IK5A 5EHDA 3I2IA 2RDSA 3POJA 1OQDA 3I7DA 1EV13 4XYXA 4QU2A 1FOD1 2Q1MA 4BH9A 1PIV1 4WZFA 3E6CC 1F4AA 1GNZA 2JG8B 1F35A 4O7XA 2JENA 4Q4V2 4N8MA 1B09A 4R8HA 3I2DA 4CUBA 1FPN2 2D3PA 4H55A 5F3CA 2EXIA 4YZ4A 4CTEA 2DUQA 1PO21 1KJRA 2WT1A 1BMV2 3MFAA 4XABA 3B69A 3SKJE 4ES9A 4OHVA 5HXVA 1HKDA 1VMFA 2J42A 2PN5A 3NV3A 3BIEA 3LAGA 2WAOA 1UN1A 4AAPA 2I45A 2Y64A 2CTVA 1UD1A 3W5MA 1R083 4WM7C 4AW7A 3R05A 1DQ1A 5JPMB 4E4HA 2DUOA 3R0RA 4B8EA 5B4NA 4CDWB 3ZXLA 4FOVA 2YZ4A 1Q8QA 3ENRA 2KD7A 4NOTA 4K3UA 3GCWA 2K9ZA 1OOPB 5F3IA 5E1RA 4AEMA 1F5JA 3GJAA 4UAPA 4RHV2 3RZJA 3ETPA 4JQTA 4BWOA 4CZSA 4IV3B 1AHSA 4D7SA 2WN2A 3IDBB 4HK9A 3SH4A 1DLCA 4R4ZA 5FYZA 1FV2A 4EWDA 2YROA 1DQ0A 4JHZA 3KMHA 3JCIA 2BEOA 2HWF1 1A8DA 4LA2A 4LBMA 4JCKA 4QGMA 4B4QA 3SMHA 1IPKA 3OBRA 1Q5OA 2RJLA 2SBAA 2VQ0A 2XWBB 3K51A 2QQNA 2HWD1 2GC3A 4AFDA 3C2UA 5D1IA 2RS12 5AVPA 2WWUA 2OUJA 3MYXA 4UW3A 5DAVA 3DYPA 3HNMA 1E5HA 2WT0A 1SBEA 4AHYA 5FZOA 1TZOA 5GLZA 5F5IA 1LOAA 1ZZCA 5FWJA 2Y6KA 3K46A 4FPYA 4UW4A 1MS4A 1AL0G 1W28A 2VM9A 1C5HA 2QZ3A 1S0GA 1OH3A 4XXPA 4NPMA 1U12A 2JG9B 3BVCA 5FP8A 2DFCA 1FAYA 3AVRA 4CCEA 3G7DA 3ZFGB 2VBDA 1R1A2 1W8HA 2HWF3 2FCTA 3OYWA 2VZQA 1GYKA 4H14A 2Y26A 5M0TA 4XDQA 2W5FA 2GH8A 3WHTA 5FUPA 1PGL1 4N7IA 1W0OA 3AJZA 1AJKA 1H8VA 4PDWC 3VBSB 1FT9A 4P9LA 3AKQA 3AYCA 2D6PA 3C3VA 1I5PA 4GULA 3CO2A 4XUOA 2D3RA 5FZHA 5K4LA 3VBRC 3W21A 1TMF2 3ETQA 3LZZA 4OI1A 1AR92 3GBWA 4CYDA 3WXPA 2ZA9A 4IGPA 5J36A 5JOYA 4LEJA 2ZKLA 1VAKA 1J59A 1W8UA 3KF3A 5IYYA 5SV8A 3O1SA 1QWRA 1OA4A 4YNIA 5BNOC 5K7PA 2TBVA 3V64A 4S2GA 1B35B 5I91A 3V0AB 4UF0B 1CZTA 2OS2A 4KWLA 2O14A 3GZUC 1Z7S2 4LBQB 1CAWB 1ULEA 2A6YA 3CDZB 3RPQA 2FQPA 1RUH1 5JOZA 4FTEA 3WDWA 5C70A 1RHI2 1DLLA 4LLFA 1MEC2 2Q8EA 4YW6A 1OI6A 2D93A 4LBLA 2WNUC 2DURA 3J9SA 5J48A 3PJQA 1HX6A 1LGBA 2XVGA 3VHNA 2FCVA 2PFWA 5CADA 1HN1A 1OKOA 3AP7A 3RNSA 3H8OA 1PVXA 5FZ7A 2R071 2VMHA 1UX6A 4NN0A 3AK0A 4N9HA 4Q26A 1IS5A 5C9AA 4LA3A 1JXNA 2JDMA 4DS0A 1STMA 1NY71 2V4AA 4FPCA 4QPIA 5FLJA 1S0DA 4Q4W2 4BLJA 1YJLA 4BYYA 3OGSA 1DZRA 1R092 2D43A 4JKKA 4DXTA 1IKPA 4P5YA 4Y1YA 2XB6C 2UU8A 1RUH3 2CDPA 4GIQA 3I2HA 3CZUA 4J25A 3RJ2X 1JYCA 2B42B 3USSA 3VBUA 4AR2A 2R0HA 3VKFC 2CY6A 1RUNA 1AL23 2VD7A 4JDOA 1VBC2 5CYYA 2VZPA 2XJUA 2XVKA 5FPBA 3ZSEA 2E7QA 2LALA 4IGQA 4Y1ZA 1SLAA 2ZS6B 3M1HA 3MLLA 3M8LA 1NG0A 1L7RA 4ASKA 5FZDA 5LATA 2DVFA 2HWE1 1XNKA 1DZTA 2WLQA 4M0HA 2YPJA 1O59A 1XQNA 3MLJA 1BK0A 1BXHA 1AR71 2ZAAA 3KWVA 3POFA 4PLMA 5GZEA 1WW5A 3N9MA 4KGGA 4PCRA 3AXDA 1YI7A 4K1ZA 1AYM2 3F95A 5F6LB 3WDTA 1KJLA 4BDVB 5A6ZA 4A6SA 2BVVA 3K3OA 4Y4RA 5APAA 1C28A 2W1SA 1JZ7A 1N1SA 2WNVB 4DRRA 4OZXA 3CJIB 1X36A 4HG6B 2D98A 3FBMA 1RGSA 2WZ8A 1JYNA 4QX7A 3B93A 4U36A 4QPYA 4DFSA 3MF6A 1FOD2 2VZSA 1PIV2 4Y20A 5LBBA 4E2GA 2W0XA 2XJRA 3B94A 4NROA 4QAWA 5DZGA 3VHPA 4NHMA 1Q8PA 1ULGA 4N90A 1HB4A 4XFFA 2PQSA 2VOTA 3V65A 3BB6A 4Y5TA 4IEWA 1AR73 4TWTA 1QJY1 1UOFA 4YGBA 1IQAA 3UV9A 3WDXA 2W08A 1W2OA 1PO22 5IAVA 4GZ9A 4XETA 5BPXA 4A6OA 4NPLA 4EN7B 1VBA3 3FHQA 1GZWB 1W8TA 5T52A 3N35A 1D2QA 3VD5A 1QDOA 5IK4A 1OUXA 3CJXA 4YZ1A 5EJ3A 4TZDA 3PMEA 1UYYA 3PVEA 3VKLA 1OC1A 5KC5A 3ZXKA 3BTXA 1HJFA 1WGPA 4K1YA 4UBGA 4AEKA 1H2NA 3HNYM 3OG2A 3S7IA 1ENSA 1VMJA 1YYNA 5GLWA 2XL9A 2DFBA 5CVRA 5IT6A 3FUQA 5CKQA 4HETA 4KWJA 3C7FA 4IDZA 1W99A 2P17A 2IXKA 5FZLA 2BFUL 4I3GA 1DFQA 1HQNA 5F2WA 2HWF2 3O0WA 3I3DA 4Y22B 2A6ZA 4WVVA 3ZN6A 5KXDA 5CA6A 2ZACA 3T4HB 2HWD2 4NAMA 1DF0A 5FY9A 1POV1 4WVMB 4DXRA 2PAEA 1V00A 2DCYA 2B46X 2DTYA 2VW2A 2WJSA 1Y9MA 3D82A 4I30A 2H0BA 3ACFA 1NQDA 1RVF1 1SPPB 5FXXA 3NAPB 4FPLA 3WP3A 4YM3A 4I3PA 1V6KA 4ET7A 3JBG1 4I0AA 4LUMA 2BU9A 5JMCA 4WBBA 1CIWA 3HT1A 4OULA 4QQ2A 4Z07A 5DG2A 5C9AC 2VMDA 3JU9A 4HT1T 3AP5A 5G04L 4RR3B 4CP1A 3PMSA 2FZ2A 4QPIC 1PNFA 2KR2A 1OA3A 3O1UA 3GYDA 3RI8A 5HCAA 3FHIB 3LIGA 1G9CA 4AQ6A 2CAVA 1SLBA 2EICA 2MNGA 2RMU3 3PU8A 1C3HA 2ARAA 3LFMA 2WNEA 3VD3A 1UMIA 4YM0A 4AFCA 1XOYA 1YFWA 5B2GB 1UY2A 3VBUC 4YYOA 3POYA 4YFWA 4F3JA 1UAIA 4O9GA 1W05A 4BK4A 1POV3 5I8TA 5A6YA 3QACA 4HKWA 4LOSA 2Z69A 1RVF3 3I3MA 3JUUA 3GZAA 1JUHA 1C5IA 3JBG3 4MUVA 3KLSA 4EZHA 1H8TA 1DYKA 1EUUA 1GZTA 2ERFA 3RG0A 2R1DA 1SBDA 4AVCA 1CIYA 2CYFA 4QXCA 1PGSA 4OHWA 5FQ0A 2Y0OA 3N36A 2ZGLA 3ON7A 4FPJA 2P2KA 3ILNA 3KQ4B 4LBQD 4Q0PA 3ZN5A 2VULA 4XF4A 2EALA 4CP9A 5F5AA 1LOFA 4QPGB 2YHJA 4EN0A 3U10A 1W04A 3O1PA 3IPVA 1GV9A 4RD7A 5E89A 3HJRA 1W8NA 1ULDA 1F15A 2XQRA 1O3TA 1APNA 4GD4A 5EYYA 5L7OB 4WVWA 4WM7B 3ES1A 3UJQA 2BQPA 5C8WA 4NJ4A 1OFNA 2P34A 3OPWA 2I07B 2WS93 2Z5WA 4IGOA 4NRPA 5T5LA 2WFF1 1POQA 4LBKA 2XONA 4X6RB 1PMJX 2OVUA 4RS5A 4WM8A 5GLVA 1WLCA 4HN1A 2R072 4ZKTB 3OBAA 5FMOS 3V0BA 4AZZA 3PJYA 3IDEA 1NY72 3OPTA 5C4WB 3I3EA 4MGYE 2JECA 1VPHA 3A21A 4QQHA 3ZYBA 3VD4A 4LQRA 1DG6A 3T0DA 1QKQA 3VKMA 1GBGA 4BM8A 4COUA 1NCQA 1VBD1 3NV2A 5A7OA 3DYMA 4KU8A 2WO2A 5A33A 3THTA 2PHUA 3PTRB 2FD8A 2IFWA 3OY8B 4GB31 4A7ZA 3W20A 1XPWA 2RV9A 1HXS1 4C1XA 3URFA 2Y6HA 2XL7A 1OA2A 2VXJA 4QM8A 1A6CA 4LR4A 1W8ZA 4QQLA 2ZGUA 5HCFA 1QJX2 5BXXA 4XF9A 4CSWA 1VB4A 2WT2A 4MGTA 1NCRA 2PAKA 1Y43B 2HWE2 4XMAA 1PX4A 4UW5A 3OEBA 5FPZA 4FPKA 1O5UA 2ENRA 3HN1A 3KGZA 3PUHA 4S2HA 4XDOA 5ANNA 2HWC1 1RUD3 2DCTA 1AR72 4RGAA 5FZCA 1QXRA 4IE5A 5KXCA 1AR83 5LEJA 3BPZA 3VN4A 4M01A 1ND2A 4QB6A 4DXSA 2ETEA 4HL0A 5ABJB 4IV1C 3HQRA 1ZNPA 1TQ5A 1GQGA 2ZBJA 5C3PA 3ASIA 1YIPA 4GWJA 3GF6A 4YG6A 5FREA 3ME2A 1W8WA 3P1IA 3PUIA 1QXJA 1C1LA 1CAVB 4AVVA 4L2NA 5FJHA 5DAXA 2QNKA 2PA7A 1D4M1 4EE2A 4TSVA 3HOBA 3AP6A 3K77A 2GC2A 3WG4A 3ZXEA 2NMOA 4AG4A 3O1TA 4Q4Y1 1RITA 1TEIA 3IT8A 2HWC3 2OPWA 4ZS2A 5B4XA 1QJY2 2YG0A 4URTA 1JODA 1F4HA 1K3IA 1DIWA 3LDRA 4ZHNA 5F39A 2PYTA 1OUSA 1W6PA 1G86A 2CU5A 4A3XA 3C8XA 4QM9A 2WBKA 1F31A 3N3HA 3ZN4A 5H9RA 1U0AA 3WDYA 3DYOA 1IGOA 3E5UA 1NKGA 1NAEA 4XJWA 2OYZA 1QOSA 4MH0E 5IWFA 1WD3A 3H1YA 4V2WA 1ASJ3 1GQPA 1BMV1 1SHWB 3M3IA 1BBT1 1S0IA 1GWMA 2XJQA 5BUVA 2P3IA 2ZGQA 1QH6A 1H8TC 3TNQA 2A75A 3GZTB 5A7WA 3TEYA 5A3PA 2ZZJA 5F5CA 1KXGA 3EB7A 4EV0A 3M70A 4LIUA 1HDKA 1QJZA 3IBMA 5FTTC 3ACIA 4IE6A 1PZ7A 1Y4WA 2XHKA 2X5IA 3AYAA 1LOFC 3KF5A 4HOOA 3HR9A 5FAXA 2YGLA 5T5JA 4XXAA 1OVPA 4AYUA 4M3CA 5JOWA 5FYCA 5LBFA 3Q8BA 3NW4A 4Y3OA 4Q4V3 2XR4A 2GMPA 4COWA 2ZGPA 5FZ0A 3AX4A 3VBOB 5EIYB 5FCCA 2MEV1 2PXJA 5T5PA 4NWVA 1LTEA 3PVNA 3K4AA 1ZA4A 3BU7A 1CAUB 3DUIA 4MHUA 1BBT3 1US3A 1YO8A 2VNRA 3Q9OA 3U37A 1DQ2A 1MZ6A 1Q8OA 1RVF2 1YC61 3ZFEB 1LULA 2AH2A 2WC2A 4RS5C 4WM8C 2AREA 3JBG2 3WDUA 4Z1VA 5A3OA 1CR7A 5EV7A 1G6NA 2D5HA 1C8NA 4K8FA 5DAWA 4HBNA 3L9JT 3BALA 1ZRRA 3UNPA 4J1WA 2W92A 3WG2A 1S55A 3I2KA 1RUF1 3FX3A 3QBQA 4YARA 5L9VA 3WQBA 1K5MC 3CNAA 4IEPA 4AHZA 4N53C 1NCQC 3WQ7A 4QDQA 4RHV3 4TTGA 2AACA 5GKAC 1JOBA 1MZEA 2YB7A 4NO4A 2DBIA 2ILMA 5FO9B 3ACGA 3J7NA 4JTNA 5DG1A 3MV01 2D3SA 1JU3A 1V0AA 1GWKA 3EJKA 1YFYA 3PIGA 3EQEA 1R1A1 4PBPA 4QDSA 2QFEA 2VPVA 1U5ZA 2DF7A 2JWPA 3O5SA 3WP5A 5A3UA 4XF1A 4CXWA 3AZVA 3E97A 1I5ZA 4A3ZA 2VQAA 3AM2A 4PBOA 3DPRB 1HV0A 1EY2A 5IK7A 3HBKA 2BTVC 3I59B 2I74A 2EIBA 5ANQA 3ZYPA 1MVEA 1W3VA 2RS13 4XHXA 1RUF3 3EMRA 4LNVA 1GP6A 2KA3A 1SG3A 5A7NA 3NNLA 3OBTA 5C3SA 4LBJA 1UXZA 5FR3A 4YGEA 1RJ7A 1UCXA 1XNAA 4ZPIA 2ID4A 4KWKA 5FBZA 2VU9A 2HYKA 4YZ2A 5FLIA 2Q8CA 1S2KA 2Q4SA 3DXUA 2ZJCA 4FP2A 3BTYA 3ZKYA 2D6KA 4NIAA 1K5JA 4LE4A 2ZX1A 4M0NA 3MF9A 4DEVA 2FDFA 1LU1A 5JI9A 1R1A3 3VBFB 1XNTA 1O5LA 4K21A 4R52A 4M3CF 4MLOA 3D0SA 2WFF2 1OPMA 5FUIA 3T3YA 5FPLA 2R0FA 2UY9A 1JZ5A 1UW8A 3ZXDA 4MGQA 1WLTA 4JV4A 2WFPA 2XKOA 1YQ6A 1JTZX 4RL7A 1VALA 4YPJA 3ABZA 3IDCB 4ZU4A 5A7SA 2XLAA 2BNOA 4KL1A 1A8MA 3AP9A 2GNTA 5J98B 2VQTA 2G9ZA 2YFZA 5FIXA 4PLNA 1TMF3 5FMOL 4I02A 4CRQA 3DF0A 1AR93 4ATEA 1KFUL 1VBD2 5FYIA 4E4ZA 4ZZ5A 1ZZBA 3WD5A 2VCBA 3MDPA 4DINB 3AMQA 4M4PA 1ZBA1 3UKVA 1PM4A 3RWKX 4A2UA 4PT6A 4GB32 2R1BA 4Y4YA 3U1XA 1N3PA 1ND3A 1HXS2 4CEWB 1BZWA 4LJHA 4LHKA 4BZ4A 2BBAA 3GBGA 3UKTA 1R091 1V6MA 4NIDA 1BEV1 1ONAA 2ZKNA 4W8JA 2JXAA 4UFJA 4YW5A 1XE8A 2VE1A 3VZOA 4DEQA 5DMYA 5K9YA 3B00A 1NUKA 1RHI3 2OX0A 4META 4BQ2A 1W6QA 1DGWX 1DQ6A 3GXUA 4U2AA 3ZXGA 2WA3A 5IAXA 4QB2A 1OD5A 2G9GA 1H4HA 5KHHA 2B9UA 1W03A 1UYZA 4HLTA 5FZMA 3WW1A 5CBLA 3TNPB 2VGDA 2WYFA 4FPEA 2Y6FA 5I0SA 1UF2C 1YCIA 3EHKA 4I0WB 4P5HA 1UOJA 5A70A 1D0GA 4DPNA 2QQOA 3AMHA 4B7KA 2RE9A 4HPKA 4XZUG 1ZBA3 4XQDA 1BCXA 1OF4A 2E51A 2VXRA 4QGNA 1QJU1 2P3JA 2X10A 1QIQA 2BNMA 5F1RA 3ZIXA 3ZMOA 2FDJA 2VMEA 1TG7A 4UBHA 1UPIA 1NE4A 1R093 1VRBA 1IQDC 4XQ4A 3UK9A 3VZLA 3WV6A 5J37A 1YEWA 4XFCA 1D4M2 5FZ6A 5SV5A 1F9KA 3L2HA 5C33A 3CZJA 3NJXA 3H3LA 1YRZA 5E88A 4L11A 4Z92B 5HI0A 4GJZA 4Q4Y2 2GP3A 1H2LA 4FSJA 2PHTA 4R4XA 2QQWA 1VBC3 2IXCA 4EROA 2WZR1 1D7PM 4AFBA 3AB0A 4XACA 2Y6LA 4X6QB 1JZ4A 1J1TA 1J58A 2VMGA 1V9U1 3RFRA 3RYKA 4CCLA 5BNPA 4HFSA 4NPRA 3VBHB 1GOGA 1WCUA 2D6LX 5JXHA 3X29B 1UMHA 3KSCA 2VTFA 3N9LA 4CCOA 3OBZA 2YU1A 2OIIA 4CEYB 2VG9A 2QJVA 3NNJA 1AYM3 3ECQA 3M7AA 1BBT2 3AZXA 1VBE2 2OKXA 3WW3A 3MHZA 2FDGA 3UT0A 2FZ1A 3FHAA 2B39A 3I3BA 3NNGA 4LMFA 4YGDA 2WZR3 2W1QA 2WQ4A 4CU8A 3WP6A 1URXA 5HCHA 3POBA 2C26A 4JDMA 4O65A 2JX9A 1WCDJ 1W2AX 2VQUA 1FOD3 1Q8SA 4Y26A 1PIV3 1LGCA 4WZCA 2JE8A 5GLTA 5CB7A 3RZLA 3KT4A 2ORXA 4M4RA 4FFGA 4FFHA 1V6JA 2MEV2 5FUNA 1UKGA 5FWEA 3WF0A 1ENRA 2Y38A 4E8CA 1PO23 1LHUA 5T3NA 3VV1A 1QY4A 3N7KA 2V09A 3VD7A 4ASLA 3B7MA 4ASMB 1OLQA 1JYIA 3USUA 4Q29A 5C5UA 4CDQB 5CG8A 1Q56A 5JSPA 1X82A 2YYOA 4AI0A 2P3YA 4LT5A 3RZHA 4ZY9A 1SLTA 1LR5A 5CEHA 4QGLA 4J1XA 3M3CA 1SBFA 4A7YA 3ZFEA 1PM7A 2BWAA 5I0RA 1S0FA 5BNNB 1MQTB 1QNWA 1RUF2 2P37A 4W4ZA 3RYPA 5JXJA 3P3PA 3CBNA 1WMEA 3NJZA 4FI9A 3N7MA 2XQXA 4D6RA 4FOWA 4IV1B 1BQPA 3MIBA 3Q8FA 4AE2A 1O7FA 4E8DA 1X9TA 4XUTA 5K0UA 3C7EA 4AEDB 1H0BA 2EVXA 2VTXA 3KV9A 4JX0A 4XFIA 4CXYA 2DBNA 3LSEA 4Y5SA 1ND3C 1T6GC 3KVAA 3JD72 4XTPA 5DPNA 3AYDA 1VMHA 3GBFA 1X33A 1YFUA 5C8CB 5EYXA 3WT3A 5IW0A 1SFPA 1AZDA 4P9YA 3PVBB 2QQKA 4GH4A 1AXKA 4RQPA 1NXMA 3UYJA 2ZGSA 3P6BA 3PUQA 2HWD3 2R49A 4GAZA 5FYSA 5FZ4A 4Q0VA 3IAPA 3FJSA 3T08A 1MZ5A 2XJTA 4OLLA 3HPNA 1PHMA 5JZGB 1H6YA 3ACHA 4BE3A 1XB9A 4N43C 5DDJ1 1JYVA 1PK6A 2K46A 2IVIB 2ZOEB 3VZMA 4DQAA 5I0DA 2WAAA 2IVJA 3KVBA 4WVZA 4AK3A 5LBEA 3GNEA 2DCZA 4UXAA 1N47A 4JGYB 4MXWA 4W65A 2OQ7A 2VNVA 3RMXA 1C1FA 1W90A 3B9CA 4A4AA 4D7YA 2NP0A 1W6NB 1AX0A 4JTOA 5A32A 4CDUA 5JIUA 4IEYA 5CZKA 3CKHA 1MS9A 3S7EA 1YJKA 1WD4A 3TEXA 4CUCA 4BA6A 3VDDA 4C0HA 2BGOA 1SLLA 3E1F1 1W3XA 2A3YA 4FQ4A 5CFCB 4RGKA 4UWDA 1EAH1 4MG2A 3THDA 4JC1A 2XXZA 2G1MA 2VC9A 4D6QA 3PUSA 4MADA 3B02A 2DU1A 2RG4A 2YBSA 1NXD1 2JDKA 3DXTA 4OFGA 1ZBA2 3C7GA 3IMMA 3WG3A 4YFZA 1JZ8A 1I3HA 2JIJA 4CP2A 3M3OA 3IMNA 3ZFFA 3OUHA 5FYHA 2IWGB 3HT2A 1XNDA 1BEV2 5JSRA 5BY5A 2D97A 1CAXB 5HV0A 2V73A 1CZVA 2HWB1 4AGRA 3WQ0A 5CKNA 1HRV1 1XSQA 4WV8A 5IVYA 4S2DA 1LKNA 5FY5A 3ZSKA 1UY4A 4MGSA 3W58A 2AGSA 2A3XA 4XJ8A 3ZPYA 3WF3A 2VVEA 1JHNA 1HB2A 1EAH3 4N53B 3ZYGA 4CDXB 4Z8BA 1F8VA 2R073 1QJX1 2ZGMA 4XJUA 1UU6A 2A6XA 3MW2A 5JAXA 5D8AB 2C5DA 1QJU2 4UFKA 5IVCA 4LE3A 1XU2A 2Y6GA 4XFBA 2QZ2A 2BWCA 2IXHA 5JIAA 2CWSA 3MO4A 4QT6A 4F83A 3ELNA 2A73B 2ZXQA 4EZ4A 3BTAA 1YLLA 2CGPA 4JGZA 1ULOA 3OD4A 3ZSLA 1JI6A 3MLKA 4TYSA 2J1RA 4JZRA 4YW2A 3NVCA 4GQ7A 4NE9A 4CE8A 4XC9A 3SISA 1O6UA 1HJGA 4MVTA 4X8PA 1ZZ6A 4EN9B 3MI8A 3MUZ1 1ZVFA 4XHBA 2JKBA 3VKNA 2WZR2 2VUJA 1ZRFA 2WA4A 1U5YA 4LO5B 3O14A 2MHFA 1QJX3 1V9U2 3H0OA 4FP3A 1OF3A 1LJ7A 5K0UC 1Y7BA 2CSGA 4MYEA 2HWE3 1LNSA 1RUJ1 4XJAA 1LESA 4G4FA 4CVUA 1RUC1 3VDBA 3CL1A 2K2SA 1VAVA 3OPZA 2JG8A 5FJKA 4L92A 2ORZA 2ZX2A 1VBB1 3O0XA 2VO5A 4GH4C 4RQPC 4AFAA 3JQXA 4ES8A 1ZZ9A 4IEOA 4PQ9A 4LXLA 5JPNB 2XUMA 1BKZA 1VR3A 3T2OA 1TE1B 2VZRA 2XVLA 4NRQA 2J1EA 2JDUA 2F6BA 4NHYA 3WP4A 4F7ZA 3PHMA 4A7KA 5AFEA 5LA0A 1UYPA 1E5SA 1NLRA 3ES4A 4P02B 2TUNA 1CJDA 2CWMA 3S5QA 3BUCA 1UOBA 1PK6C 2GNMA 4J6GA 2XBO1 2ZHKA 2V72A 2Q1ZB 4H2AA 1ZX5A 4UYBA 3TN91 4XCAA 5F32A 2Y60A 3OOXA 4CDWA 1NA1B 1QJY3 1ZRDA 1BYHA 2ZMNA 4I09A 1OOPA 5I0UA 3C7OA 2E7AA 3JB4C 5JR7B 4DZGA 5JOXA 2NZ9A 3GM8A 4YVSB 2Y33A 2VNGA 4IV3A 2RJKA 3E6DA 3LB9A 2FMYA 1NQJA 1WW4A 3I97A 4FOYA 4HVQA 1CQ9A 3NRUA 1E5RA 5E16A 3AJYA 3VDDC 1DCSA 3U78A 5CFDB 3WCRA 2OA2A 2HEWF 4DUWA 1W2TA 5FZGA 3S30A 3IM0A 3ZYJB 5FK7A 1C8M1 1RUI1 1MS8A 5IFTA 4DOUA 1OKQA 2OW4A 1GZ9A 3TN93 3UESA 4QKFA 2C1FA 2PQQA 2HEYF 3CIHA 3DECA 4JRAA 2HKXA 2GN3A 2RS32 3MEPA 1ZBE1 2RHPA 1W9SA 1GQHA 1KEXA 2YPDA 4A42A 4XQWA 1VP6A 4R9BA 2WUHA 3ZFFC 5J3UA 3KV5A 4YVWB 2O0OA 3WOGA 1K45A 1ACCA 2JKXA 4HANA 4CCJA 3LIHA 3O1OA 2JG9A 3LA7A 4GMP0 5FMCA 4IQPA 1ZREA 1M4WA 3LEGA 5JDBA 3ZFGA 2DTWA 4AWDA 4IETA 4XIKA 1EYBA 4YLZA 3OJBA 4OUSA 2PLV2 3ZYIB 4AI9A 1T2XA 4BPZA 5FPXA 3DKWA 1C8M3 3OGRA 3FMGA 3TBDA 2EXJA 3AP4A 2Z79A 5DDJ2 4BMBA 3ZO0B 1QOTA 3DCQA 3UKNA 3LA2A 3VBSA 4IW3A 1KS5A 4E27A 2BBVA 1FATA 2VZ1A 3POEA 4E2QA 1HB1A 3MIEA 3PIJA 3FL7A 2Y6JA 4Q0UA 2BDRA 5A80A 4C90A 3MGUA 4JGZC 5KXBA 2IXJA 1KD7A 2E32A 2QDNA 3GDBA 4FQZA 3WX5A 5A3WA 5DABA 1W9TA 1AR61 3ZVXA 4DNYA 2P4EA 2WO3A 3LGRA 1SFNA 3IZOA 4XF0A 1B35A 3V0AA 3KB5A 4UF0A 3VZJA 1HLCA 2P6CA 2RDNA 5H9PA 3TOJA 2VMCA 4Q8KA 1W6MB 1GNHA 1CAWA 2CL2A 3N7JA 4LBQA 5FZFA 3I2OA 4CPBD 4FXGB 1EAH2 1AXZA 4KI5M 1CN1A 3Q8AA 1UYXA 2JD9A 2YC0A 1ENXA 3TEWA 1LOBA 3APBA 3I4IA 1VIWB 3NKGA 4YW7A 3D4KA 3S5AA 2BGCA 2JG8C 3OSDA 4BQYA 3LD8A 3E6BA 2QUOA 1W6OB 2XJVA 2ZGRA 3S6PA 2HWB2 4D3WA 1QH7A 1XE7A 1HRV2 2FHRA 1UX7A 4KH9A 1V6NA 4HKLA 5FZ3A 2Q1FA 2D6OX 4P08A 2GAUA 2P5BA 4LKEA 3VLBB 3ZYRA 1LECA 2WFF3 3GZEA 3AL5A 1R64A 2ZZQA 1WLWA 3OGVA 3PDQA 4E4DX 3A7QA 3BN6A 4QQOA 4XURA 5LBCA 2G4IA 2DYCA 4O9EA 5FKCA 5FZEA 2VZUA 1O3QA 4QKDA 2D40A 2ET7A 4CDWC 3VDAA 3H8RA 2YMZA 1RB8G 3WNKA 2FDKA 4I2OA 1SQ4A 2EAAA 1KQRA 4CU7A 4BXFA 4YG3A 1HV1A 2K0GA 2X29A 3CEWA 3OUJA 1OFSA 1NZCA 1VBD3 4IV3C 4PI2A 4OMCA 4UOJA 2XH6A 3BOPA 3RMYA 3UETA 5L36A 3MFCA 4JKMA 1GICA 5IHRA 4GB33 3UGFA 4PDWB 1HXS3 2C9AA 3A23A 1WCSA 2AZ5A 3OGGA 1JW6A 4MX3A 5A3NA 4LHNA 3VGIA 2RM21 2BGPA 1CX4A 1MS5A 4N43B 1IPJA 4V2VA 1X50A 2YBPA 3VBRB 3WHUA 4EWEA 4OI0A 1XE0A 1WA4A 4PQQA 3TAYA 2WNVA 1ENQA 4NIHA 3AL6A 1PZ9A 2VNOA 1RUJ2 4Q1RA 4QXBA 2ZHNA 3CJIA 1NLQA 2JEMA 2VAUA 2NM1A 1RUC2 1WKYA 2AUYA 4QKBA 3AMPA 4Y33A 1COV1 5BNOB 4Y5Z0 1RINA 2PAMA 4QKNA 1ZM1A 1SEFA 4HVOA 5FY0A 5T50A 1REFA 2QQVA 2EAKA 2XG3A 4BIOA 1YWKA 4IERA 1VBB2 2JG9C 1U5XA 1O4ZA 4FFIA 1GUIA 3MIGA 3HVDA 2IFRA 4EQVA 1KGYA 3J8F1 1H2KA 3ZFGC 1KDKA 3R4DB 1A3KA 1UXXX 1AX1A 4DXZA 1GZCA 3FC0A 2WNUB 4QXKA 4LO7A 1GZWA 4YSFA 1RUE1 1UKRA 1XYNA 2VECA 4E4SA 1D4M3 1VBE1 3SC7X 4BU2A 3I49A 5LCWL 3WNOA 1O4TA 4GJYA 2XBO2 2VOXA 1LHVA 4W6YA 5FXVA 1UWWA 3VBSC 2GSYA 2OQ6A 5A1AA 1DHKB 4Q4Y3 2DU0A 5LW9A 3TN92 2XJPA 2UWBA 2BZDA 3U11A 1FMD1 4MGKE 2ADEA 2R041 2R7EB 4L0PA 4P9GA 1IPSA 1O8SA 1W2UA 4BLIA 5IVVA 2AEZA 5FP7A 3WLUA 1DGRN 1FI2A 3GJBA 4IEQA 3NV1A 4YZ3A 1IG0A 4DY5A 4OHZA 4P9XA 4TLFA 3BGAA 5DUUA 5JUVA 3O12A 4P9WA 3LQCA 1IG3A 3MIFA 3RGBA 3RZKA 1RUE3 5FPAA 5HV4A 2HBUA 2JDPA 4LKDA 5FZBA 2X05A 1RJ8A 1VBE3 4OMDA 3ZIWA 2FDIA 5JXGA 1YI9A 4K8RB 4Y22A 1RYYA 1C8M2 1RUI2 5FBJA 1QOOA 1QJFA 3ZXFA 4DB5A 2E7TA 3BU0A 1JZ3A 3AKRA 4JQRA 2EIDA 4PIZA 5GM0A 4WVMA 5FRAA 3W9AA 2W1WA 1Y9GA 2VR4A 4W6XA 1BVVA 1W9YA 1ZBE2 1SPPA 2R043 3NAPA 1GOHA 4HXCA 3SXWA 2DVDA 3JB8A 3IIIA 3WF4A 3KCXA 3WUDA 4FAGA 1JU4A 3C7HA 2C24A 2BNNA 1RUG2 2XJSA 1IS4A 3HWJA 5KC6A 1ZZ8A 4XFHA 4AVBA 2C6SA 4RR3A 1XC6A 4XBLA 3ZX7A 2MEV3 1OHFA 3D6EA 1L7LA 2XLGA 5HBAA 5HXMA 2WO7A 3ILRA 3T1LA 2BERA 1S2EA 3JD71 3LKJA 4CUAA 2VCCA 3H8UA 2PHLA 5FZOB 3NKTA 1WCKA 1OSGA 1WWYA 4K40A 2QTWB 1OLRA 2J1SA 5DXDA 4QMAA 2ZAHA 2FBEA 4NIGA 4QX0A 3H3UA 2RDRA 1NCRC 3AKTA 1KS4A 1F5FA 5CIRA 2R32A 3BODA 3VHRA 2VL4A 5LY1A 1VRH1 1BHGA 2XGXA 4GKXA 4ZS3A 3OYWB 4XUPA 5LWBA 2A7AA 2NMNA 1JBCA 3RZGA 2FDHA 4Z82A 3P5BA 1ND2C 5GLUA 2ZEZA 1VB2A 2UY8A 3LWCA 4PIYA 3TB0A 3N9QA 2V5YA 5FOBB 2EIEA 2BPA2 3MICA 3WDVA 5GZDA 2G9FA 1ALYA 4QHBA 5I0TA 3I2GA 5FYVA 3H3ZA 4CCDA 1AR62 3W59A 4QPGA 3FBYA 3JD73 3MV11 2QQPA 3LEKA 3ROUA 1JHJA 3OTFA 1RL3A 3GHNA 4PJYA 1FX5A 4EYUA 2GU9A 1LODA 2ATFA 2WABA 5IUQA 1ODNA 5L7OA 2LM3A 4JHTA 4GKYA 4WM7A 2ES3A 2WNVC 1JYTA 3AZZA 4OUEA 3GCXA 2BVBA 1US2A 3N4MA 1UY1A 1GNYA 3CJIC 4B4RA 4GA9A 5F3GA 2LUWA 3WF2A 2EA7A 1ZYBA 2WO1A 4IE4A 2QQMA 3TYJA 1ULFA 2QQLA 3SCGA 1NX9A 1WA6X 2E53A 4FFFA 5CKMA 5EWSA 2H0VA 4GMP1 5C4WA 3I2JA 4XE9A 5GJ6A 5AC92 5LRSA 2ET1A 4PIXA 3DL3A 3B5LB 4XPVA 5LK7B 1UOGA 1M06G 1RMU2 2C4XA 2Z4FA 1RXGA 3AC0A 3NJYA 5IATA 2BUKA 4ARXA 5JMOA 4LKSA 2ARCA 2DDUA 4NR1A 3WINE 5EJ1B 5C9AB 3OY8A 5A6QA 1QJEA 2QE3A 4Q4X1 1S4CA 1AYN1 3EXUA 2AR6A 4QPIB 3IIAA 4BB3A 4D69A 3POWA 2ZMKA 2X5IC 3H7YA 4FO9A 2ZEWA 3R6SA 4AGGA 3R4UA 2BYVE 4FPFA 2W91A 4D0QA 1SMVA 4BISA 1MACA 5FYUA 4Q0SA 3H9AA 2A70A 3SITA 3MIHA 5A7PA 3VBUB 3CLPA 1LHNA 1OH4A 3T2PA 5BNQA 3RSJA 4UT5A 1QQP1 1UY3A 2W39A 3G6JB 2Z2SB 4ISRA 2DCKA 4CXXA 4QU1A 4RSUA 4BQ1A 1JYWA 2R30A 5ACA1 4KG0A 1QHDA 1HQLA 1CESA 3I54A 1YNAA 2ZABA 3KGLA 4XW3A 1BEV3 5LRRA 5ABJA 2RM22 3ORJA 3LEMA 4B7EA 3U75A 2ZHMA 1CONA 4K6BA 2B9VA 2KXLA 5C5TA 1S1AA 1I9RA 1LRHA 3F2ZA 1CAVA 3OD0A 4LPLA 5JLVA 1DP0A 3NAPC 2WR9A 1SDWA 3H7JA 5I93A 5LA1A 1EV11 1COV2 1H2MA 3AKSA 4LKFA 2Y34A 3M3QA 1X8EA 4XF3A 1OT5A 3NQHA 4MOAA 4RR3C 2B8MA 4QX8A 4ORFA 3BKZA 4QB1A 2YFUA 4Z2AA 3MIDA 5FYBA 1QJU3 3ZDVA 3J8F2 4GALA 3A22A 3EYPA 2D7FA 5ACA3 5F9TA 3H1MA 3FLTA 5FYMA 1HRI1 1LHOA 4DRVA 2ZX3A 5EZWA 4AEJA 1LOEA 3LEIA 4OZOA 3MPPG 1X8MA 2LTNA 4LHSA 1RUE2 1OQ1A 4NUBA 5KHGA 1N3QA 2X53S 3BPSA 3EO6A 4Y20B 2GN7A 2D44A 1YQ2A 2J1UA 3U07A 1S0BA 1I1EA 5ISLA 2J1AA 5JXIA 1R081 3NSTA 4L9BA 5EPAA 4MSVA 4A45A 4Q8LA 1UIJA 1JZ6A 2C9KA 2V4VA 3ZYHA 4RFT0 4URAA 1JOJA 3WNPA 3J26N 3J4UH 1WMXA 1FMD2 1JS9A 2A71A 4RA0A 4YM1A 3VZNA 2R042 3RZMA 2CNAA 4AVTA 2WQ8A 3WW2A 5A1LA 1V9U3 1QDCA 3BI3A 2BJSA 3N9OA 4NWWA 1W2NA 3BYWA 2A3WA 1EPWA 4CCKA 4Z2WA 1W06A 1CPNA 1HRI3 4QPGC 5FPUA 2BV4A 2PTMA 3ST7A 1V6OA 4PHZA 2UWCA 4BK5A 3DV8A 4KQ7A 1AXYA 3TRSB 4EJRA 2YC4A 2VW0A 4JKLA 1LU2A 1PMIA 3FFZA 3AKPA 3VBOA 1GMMA 2KM2A 2Q30A 2Z42A 3KV6A 4IE0A 5L7OC 3OGJA 4KBBA 3POSA 1QU0A 4COYA 1IKQA 4H7MA 1CAUA 2WZEA 2XLFA 4ONUA 1H4GA 2IXIA 1WMDA 1UQXA 2GNBA 2VOVA 4QX3A 5LY2A 3SCHA 1W39A 2BFUS 2EIGA 3OEAA 3HEIA 1PVC1 3ZLIA 2R16A 3VZKA 3J7HA 4AI3A 4XFGA 4KMQA 4W50A 4PF1A 1E5IA 1N1TA 1A34A 3WNMA 3ZKUA 3ZN6B 5T5OA 5C4WC 3LOBA 1YQCA 4BQWA 2RS31 3IAQA 4R9AA 4B3NA 2VW1A 2A1XA 2DV9A 1TME2 2CAUA 2WKKA 5IVFA 1O8PA 3KQRA 4KU7A 4QXHA 4I01A 2QQJA 2OUHA 4CCNA 4XBQA 3AYEA 2ZGOA 3VB9A 4KNCA 1AF9A 1SZBA 3LF7A 5KR7A 1ULCA 3IDAA 2A6WA 2BRTA 2YBKA 1Z0HA 5E6HA 4MHRA 3AMMA 1PVC3 3B3QE 2ADDA 2W46A 2PLV1 2WWJA 4AFMA 1VRH2 2E9QA 5A3MA 5IVEA 4YM2A 1WW6A 1O4YA 5KXEA 3DPRA 3O0VA 1X7NA 5A6XA 4LITA 2VZVA 4QD2A 3WY6A 3I59A 3ITQA 4Y1VA 2E26A 1K42A 3PNAA 2RS33 3VUOA 2GMMA 5FO8B 4E9KA 4HMZA 4OUMA 5FMBA 3QCWA 2TEPA 3SEEA 1GLHA 2H6CA 4XAAA 5ABJC 2X09A 3ALQA 4L8QA 3OB8A 3KV4A 3AVSA 1H8TB 4DMIA 5EP9A 1MS1A 3I8TA 1GU3A 1XNBA 3MUY1 4LO8A 2PHXA 2ZGTA 1H6XA 3T2TA 5FQ0B 5FFOC 2VUDA 4TXWA 3VBFA 2P1BA 3JQWA 5FZKA 2JE7A 3IN9A 2PLV3 3O7OA 4XOGA 4CP9B 2N7GA 3ZXJA 3UJOA 3SCFA 3M2MA 2AC1A 3QLQA 5F7UA 1LB2A 1OBNA 1GKBA 2WINB 4LLOA 1WBFA 2ZX0A 3IPVB 3PURA 4QQPA 5DDJ3 4OQ9A 2IXLA 2VUAA 3D8CA 4BQXA 2CGNA 5BNPC 4AF9A 2YC2A 4FCAA 4RN5A 3SHRA 3SQOA 2WL1A 1J84A 4JDNA 4RYDA 3SKVA 5C71A 3AFGA 2XDVA 4QX2A 2O1QA 2JD4A 4MGZE 1N3OA 1C57A 1PO11 1TNRA 3FLPA 3FUOA 3WQ1A 1HB3A 4BJ0A 1RC6A 1CGPA 1V6IA 2VVDA 1H1AA 2XWJB 4RS5B 4WM8B 2FCUA 1SACA 4FPOB 3JXSA 2O8QA 5DN2A 1SFYA 2VVFA 3KD4A 3K4ZA 4I0BA 5F6KA 3V56A 1AL21 3U0ZA 3V0BB 1DGLA 4FBFA 4Q4X2 2WIIB 1AYN2 5LASA 4CEWA 2WRAA 4UFIA 2VCMA 4COZA 2Q8OA 1AVBA 4XUQA 4C8DA 1OPOA 3A4UA 1UO9A 2G19A 3RJRA 5A1FA 1G7YA 1K5MB 1MS3A 3D0JA 5IK8A 1NCQB 1XU1A 1D0HA 5FPVA 1Y3TA 3IWZA 4S2FA 4AXOA 5A33B 1NLSA 4LTAA 1QQP2 1YHFA 3L2YA 4DIQA 4B29A 2VBBA 2JJ6A 4ISQA 1PO13 5ACA2 2W94A 4IUGA 5C3OA 2PHRA 2BP6A 2PELA 1Q3EA 5FP4A 1MVQA 3VBOC 4YW4A 2HWB3 1QEXA 1HRV3 1S0EA 5FDBA 1NCRB 1OMIA 2XPJA 1IZ3A 1O3RA 4BQ3A 1ODMA 2JIGA 3HD8B 5JCTA 1DBNA 2E33A 1BLZA 1JUIA 1WLDA 2R6QA 4ZZ8A 5C7GA 3ZFEC 3NJVA 1UZ0A 1EV12 1D4VB 1OQEA 3CMGA 5EXOA 2ZHLA 1ND2B 1UIKA 1YFXA 3QH6A 1SLIA 4LO6B 5DAPA 4BOWA 4XZPA 2GP5A 3LDBA 3SNMA 4K20A 5F37A 1ZRCA 3HMYA 4DO0A 4FXKB 4HN0A 4L97A 4XEZA 5IJRA 1JZ2A 2RS51 2DVGA 1UZZA 1RUOA 2PHFA 2E63A 3WR0A 5FZAA 1HRI2 3MZHA 1VBA1 3WVJA 4G9SB 2D5FA 3VBHA 2OXBA 4O61A 2Y0IA 1UZVA 3FLRA 4RGGA 4NHXA 5FV3A 4LO4B 3THCA 4YG0A 1E57A 5FYTA 1R082 5G05L 1DYPA 4Y1XA 1WCQA 4XILA 4CEYA 2VOKA 5DUWA 2VZOA 3VL8A 4BIFA 1IS3A 3HAGA 4XJZA 2OT7A 2IUWA 3LPGA 5FKBA 4YZ5A 1BK1A 2JB4A 2Q5TA 2ZPXA 3GHMA 4XTMA 2WN3A 3RZZA 1W6PB 3DPRC 1GP4A 1A78A 4B4PA 5DAQA 1TVGA 4CU6A 2ARBA 4Q2FA 2BOJA 2IC1A 2RS53 4MZUA 1RUJ3 4Q1PA 1KFXL 4AHWA 4ATFA 5JWPA 1G9BA 2LRPA 3H42B 2VZ3A 1RUC3 2GZWA 1OLME 1W0PA 2GH2A 4AI8A 1ST8A 2JE9A 4MV2A 3HNBM 4HKOA 3ILFA 4Q0QA 2BW8A 1BVP1 4FVVA 4LK7A 1CZSA 4SLIA 1GSLA 3MW4A 5AFBA 2YGMA 4COVA 4AI1A 1VBB3 4L99A 4XBNA 1T6BX 3N9NA 5DZFA 2WQZC 5A7WB 5FP3A 3WEZA 2LW8A 4P00B 3ZDSA 4CDUC 2FMDA 1J83A 5D2AA 3RWNA 3EBRA 3VBFC 3BOWA 4JAAA 5CNAA 2VJXA 4NIIA 2X5IB 3IB3A 2GDFA 1H9PA 2Y8KA 5A3LA 3DEMA 1PVC2 3AMNA 1W9WA 3CU7A 4M3CB 2W47A 3NL1A 3SEPA 4AI2A 4CDQA 4D8MA 2XBO3 3WW4A 1LHWA 2J7MA 3PTYA 1WBLA 5BNNA 1MQTA 5EQUA 5JI7A 5FY7A 3DGTA 4M3CE 2RMU1 2GNDA 3K3NA 5EJZB 1NYWA 2LROA 1VLNA 4IV1A 3BCWA 3HIFA 4CCCA 3RI9A 1LEMA 1RUG1 2ZGNA 2BOIA 2F17A 5A7QA 3ZMNA 4AEDA 1OD3A 3HQXA 3ZSMA 1XXNA 3LSDA 4QX5A 3WCSA 4YW1A 1FNZA 2ARXA 1CWPA 1MZFA 4C91A 2QQUA 4CEWC 1HW5A 4XMIA 2WWSA 1O91A 5KHIA 5C8CA 2HLEA 4LHLA 4ARYA 1WUVA 3RQ0A 1OXCA 4BHPA 1RUI3 4XDPA 3WUCA 4BQ5A 5GZGA 1H30A 1VAMA 4LORA 3S0MA 4HONA 2V5DA 1G9FA 1QMJA 1ZBE3 3ZXAC 1F2NA 3UL2A 4LULA 1C4RA 1H1MA 2A5ZA 5JVVA 5JZGA 4XVHA 2TNFA 4XJ9A 1RUG3 2XOMA 1LENA 2WLPA 5H9QA 2ZEYA 2JDHA 1PGL2 5CAZA 1FV3A 4DY3A 2OZJA 1HN0A 3M3EA 3T4VA 1MS0A 5F5QA 5FLHA 5FZIA 3RVHA 2XMLA 1W0NA 5GZCA 5IVJA 4IEUA 5KHKA 2XHNA 4JGYA 3INAA 5L73A 4CCMA 5C3RA 2WS91 1W8OA 5EFUA 4EWAA 1U5IA 2JB8A 4FPGA 2QVSB 1L7QA 4AOCA 1CPMA 1W6NA 5LZ6A 1WW7A 3T1MA 5H9SA 5FYYA 2B5HA 2HBTA 4IE7A 3H8XA 3B9IA 3OCPA 5CG9A 1W8FA 2SLIA 3TWIA 1AJOA 5FZ9A 3I2FA 1HQWA 1LEDA 3NNMA 1CJPA 2ZX4A 1REDA 3SH5A 2VY0A 1AUYA 4E2SA 3POGA 3O1MA 3KCYA 5CFCA 2ZTNA 3CHXA 5FZ8A 4R9DA 1PO12 3CQOA 1RUH2 2B45X 3VBHC 4F8AA 3BIWE 5F2SA 4M00A 3PU3A 5LK5A 3LA3A 5L19A 4C1WA 2IZWA 5TSWA 4KWUA 4CPBA 5JSOA 1AL22 1AR63 4CEYC 3S57A 2JDYA 3A0KA 4B1LA 5AC91 4MGIE 2W9XA 1IHMA 1G9DA 1LAJA 2VBPA 4UFLA 3QH7A 2OZ6A 1J3RA 1RMU1 2PMWB 4NVPA 4IEVA 1UU4A 4XAEA 4OHYA 2WZPP 1DQ5A 1CAXA 1RTVA 2D6MA 1JN2P 2HYXA 2R061 3QOPA 4NAOA 2WSUA 3ZOIA 5IVBA 4K7JA 3LDKA 2W52A 5DZEA 4BMEA 1PGW1 3FN9A 3RDIA 2RVAA 3WG1A 4FTSA 1RUD1 1FXZA 1AR81 1K5MA 1ND3B 2B7YA 1DQ4A 4N53A 3J7MA 5L9RA 1S0CA 4CDXA 1CX1A 1OOPC 2I2SA 3KHBA 3VL9A 4IEZA 1NOVA 3HQUA 4UI9L 3ATGA 2NN8A 5D8AA 2UURA 1KRIA 4BXSV 1W6QB 1DDLA 5AC93 2UYBA 5L9BA 4CA9A 4MO3M 4TN7A 4LK6A 3AZYA 2WDBA 1RMU3 4AAXA 3LOIA 2D6NA 1NZIA 5E8AA 1K12A 1HIXA 3LFIA 1JH5A 1UU5A 2C0ZA 2R063 3H1WA 3GGLA 4AQTA 1MPXA 1J1LA 1SDDB 4CDQC 1FYUA 4PI0A 4FAHA 3WSOA 3W5NA 1UNBA 1SLCA 1GR3A 2QCSB 4ZXKA 1SCSA 5D21A 2W68A 5LA2A 4HPKB 3LE0A 4X8NA 4PLOA 2WSVA 2VOWA 2RS52 5BNNC 1MQTC 2J22A 4B1MA 2YUEA 1UY0A 1DGWA 1XNCA 2RDQA 3FFQA 1VBA2 4QHOA 3K2OA 2XUEA 2RR11 3ZYFA 2ZCWA 3VDCA 4AEDC 5C3QA 4YW3A 3Q8EA 3VD9A 1XRUA 5I8YA 3D5OA 1NT0A 3TEZA 4IESA 1ASJ1 4NHLA 4OVEA 5C8CC 3J7LA 2NQYA 5ERLA 2ZMLA 1N1VA 1RIRA 1XBFA 1YUDA 2HJIA 4RFRB 2RM23 3ACLA 3N9PA 2QQIA 5LB6A 1J3PA 4H7LA 3SH3A 1CD3G 2JDNA 4V1PA 5A3TA 5BNPB 3KT7A 1XJAA 2Q0AA 3D3AA 2RJ2A 1UL9A 2F4PA 3HBZA 4FPHA 1P8JA 1R1ZA 1LGNA 2VMIA 1DU3D 1OLMA 4Q27A 3ZR5A 4XCBA 1XSRA 3KCCA 2W1UA 2NPIA 5JZGC 1COV3 1XYPA 3JZVA 1W9FA 5FP9A 1QXPA 2RR13 4QX1A 1XYOA 4OHXA 3K48A 4Q4V1 2YY1A 4QDRA 5KBFA 3UGGA 1S0JA 4EN6B 4DUVA 2B4KA 1FPN1 3PUAA 3M4FA 1YIFA 2Q8DA 1G8WA 3DKQA 2MPFA 1NA1A 3NO8A 3BTZA 4KGQA 3J8F3 4JGYC 3GALA 2ZEXA 1ZZ7A 2AENA 4GXLA 4NHKA 5FMDA 5JR2A 1B35C 1YXWA 1J3QA 3CF6E 1MR5A 4YVSA 3NMBA 4BQ4A 2NLRA 4HSLA 2EF6A 3E5QA 4D6SA 1Z78A 4UFHA 3T0BA 1ZRIA 1V70A 5DUVA 4CUGA 3FE5A 1VJ2A 2GC1A 5CFDA 4D94A 2W87A 4P14A 5FK8A 3ZSJA 5CFCC 1FMD3 4YGCA 5HPOA 2RMU2 4ZU5A 2P6HA 3WNNA 2OPKA 1D2SA 4RHV1 3LCPA 4C0BA 5CISA 1FPN3 3USUB 1JMUB 3K75B 4ZONA 4A41A 1IOAA 1GANA 3O1VA 2JICA 4HVRA 4H3WA 3THPA 2AEYA 2E31A 3RS6A 3N7LA 3NV4A 4AVAA 4YVWA 2PHDA 1DZQA 1TNFA 2VZTA 3AFKA 1TME1 2HEVF 5DUXA 3VKOA 1YQ8A 4GWMA 5T55A 2VH9A 1WZXA 2L9LA 3B01A 5K0UB 2RS11 3OUIA 5T54A 4Y1UA 3QD6A 3RYRA 4OQ8A 5GZFA 3KS7A 2YXSA 3O1RA 4CDXC 1LOGA 4JRLA 1UMZA 4ZU7A 2DVAA 5BYNA 3KHCA 3DN7A 3T0AA 3NNFA 3ZM8A 2EXKA 1BJQA 3MBWA 5D8AC 4GH4B 4RQPB 1EP0A 1O3SA 4AVSA 1Y9QA 5FY4A 1DYOA 4KG8A 4OYUA 5FZ1A 1QF3A 3H50A 1X9PA 4GWIA 4AQSA 2WYSA 3PVOA 1UZWA 5I8SA 1GP5A 2WS92 1DGRA 2QBXA 4LBNA 3KM5A 5LEKA 1QNYA 1TME3 2CV6A 5AVAA 3U4SA 1I6XA 5LA9A 1PK6B 4FOQA 1CVNA 1N1YA 2VCAA 4MXVA 4LUKA 4XUNA 4LOTA 1PMHX 4DUXA 4XFAA 2AYHA 5J1XA 1PX3A 1Q8VA 1Q43A 2UYAA 3VHOA 4ZXEA 5C6CA 1G9AA 3AXEA 1H1IA 1KITA 2QKDA 3FWEA 2A6VA 1W6MA 4BCUA 4AHXA 3ZR6A 4MXWB 2W95A 2XKPA 1VRH3 4W6WA 1TMF1 2DCJA 4P9IA 5KWRA 1AR91 4SBVA 3MW3A 3LPFA
chains in the Genus database with same CATH topology
3HN3A 1O8PA 3PUHA 2QQJA 3T2QA 4P02B 4QPWA 1GOFA 2W3JA 3IDAA 3WF1A 4QB6A 4DXSA 2VMFA 2V72A 2W46A 4GWJA 3C7OA 3P1IA 3PUIA 2VZVA 3GM8A 2E26A 4A44A 1K42A 3HOBA 3I97A 3K77A 3SEEA 5IFPA 3NRUA 4AG4A 2JDAA 2X09A 2J1TA 4DUWA 3OB8A 5B4XA 2J1VA 2YG0A 1F4HA 1GU3A 1K3IA 5IFTA 3MUY1 1JYXA 1H6XA 3C8XA 1EUTA 3WNLA 4TXWA 2WBKA 3UESA 1ULPA 3CIHA 3DECA 3T09A 3DYOA 1NKGA 1NAEA 1KEXA 1W9SA 5F7UA 4A42A 2WUHA 1GQPA 1K45A 1SHWB 2JKXA 2YC2A 4RN5A 1J84A 4RYDA 3SKVA 5C71A 3LEGA 4QX2A 4CU9A 3EB7A 4BJ0A 1T2XA 3ACIA 5DQ0A 3OGRA 5DN2A 3JXSA 3K4ZA 2LS6A 2VZ1A 4XUQA 5EIYB 2CDOA 3FL7A 2Y6JA 3K4DA 3K4AA 3U37A 1US3A 3GDBA 2E32A 3I2IA 1W9TA 2WO3A 1F4AA 2W94A 4IUGA 3UNPA 2W92A 4CUBA 2VMCA 3I2KA 3WQBA 4KI5M 3SKJE 4QDQA 1UYXA 2JD9A 4TTGA 2E33A 5C7GA 4ZZ8A 2YB7A 3NJVA 1UZ0A 3ACGA 3CMGA 3MV01 1JU3A 2WAOA 2Y64A 3W5MA 4QDSA 5B4NA 1JZ2A 5IJRA 2KD7A 1UX7A 4A3ZA 4UAPA 3ETPA 2EIBA 4P08A 2WN2A 3OGVA 1R64A 1DLCA 3THCA 1SG3A 3A7QA 1UXZA 5G05L 3BN6A 4JHZA 4XURA 1WCQA 1XNAA 2ID4A 2VZUA 2VZOA 3VDAA 3LPGA 4DEVA 3WNKA 2WN3A 2QQNA 4CU7A 4CU6A 1TVGA 1XNTA 3DYPA 3HNMA 5FUIA 4OMCA 4UOJA 3UETA 2VZ3A 4JKMA 1JZ5A 2Y6KA 3K46A 4MGQA 5IHRA 3HNBM 2VM9A 4YPJA 1CZSA 3ABZA 3A23A 4D8MA 2BGPA 3WEZA 2VQTA 2YFZA 2LW8A 4P00B 1J83A 4PQQA 2VZQA 2VJXA 4ZZ5A 2VCBA 3IB3A 2W5FA 1WKYA 4M4PA 2Y8KA 1W9WA 4PT6A 2W47A 3SEPA 2BBAA 2J7MA 4W8JA 4DEQA 1I5PA 4XUOA 1GUIA 5DMYA 1NUKA 1KGYA 1UXXX 5EJZB 3GXUA 4QB2A 1OD3A 5IYYA 1UYZA 5LCWL 3WNOA 1UWWA 1CZTA 5A1AA 2QQOA 4XZUG 1OF4A 3CDZB 2HLEA 4ARYA 2BZDA 5C70A 2X10A 2R7EB 4L0PA 1O8SA 2VMEA 1TG7A 1IQDC 2V5DA 1HN1A 3BGAA 3CZJA 3NJXA 5JUVA 4XVHA 3LQCA 2XOMA 2ZEYA 2X05A 4OMDA 1D7PM 5JXGA 2Y6LA 1RYYA 1JZ4A 1W0NA 3OGSA 1JZ3A 2XHNA 2EIDA 4JKKA 4DXTA 1W8OA 4P5YA 1GOGA 2W1WA 2CDPA 1L7QA 2VR4A 3I2HA 3CZUA 5JXHA 1UMHA 2VTFA 1GOHA 3IIIA 3WF4A 1JU4A 3C7HA 3I2FA 3ECQA 5CYYA 2VZPA 2OKXA 1XC6A 1L7RA 5HXMA 3FHAA 3CQOA 2BERA 4CUAA 3I3BA 3NNGA 2VCCA 2W1QA 4CU8A 1O59A 2C26A 4KWUA 2J1SA 2VQUA 4BDVB 2JE8A 2W9XA 4QX0A 2ORXA 4M4RA 2HYXA 2VL4A 2W1SA 3WF0A 1BHGA 1JZ7A 4XUPA 4E8CA 2ZEZA 3FN9A 4HG6B 2EIEA 3VD7A 2RVAA 2WZ8A 1JYNA 3I2GA 2VZSA 4QAWA 3MV11 1CX1A 4ZY9A 3LEKA 1JHJA 2PQSA 2VOTA 4UI9L 4W4ZA 5JXJA 2WABA 4BXSV 4A6OA 4GZ9A 4FI9A 2XQXA 4MO3M 4OUEA 1US2A 2WDBA 3FHQA 1UY1A 1GNYA 4XUTA 4AAXA 3C7EA 4E8DA 1K12A 4JX0A 3VD5A 3GGLA 3WF2A 1MPXA 1SDDB 2WO1A 3W5NA 3WSOA 2QQMA 5DPNA 5LA2A 2QQLA 3LE0A 1NX9A 1UYYA 2QQKA 2J22A 3HNYM 3I2JA 3OG2A 1UY0A 3P6BA 2C4XA 2Z4FA 3AC0A 3IAPA 3VDCA 3T08A 3HPNA 4ARXA 3C7FA 5JMOA 1W99A 4LKSA 3VD9A 2DDUA 1H6YA 3ACHA 5EJ1B 1JYVA 3I3DA 5I0DA 2WAAA 2QQIA 2ZEWA 4DXRA 2W91A 4D0QA 3D3AA 2RJ2A 4A4AA 1P8JA 3ACFA 1OH4A 3T2PA 4ET7A 1UY3A 2W1UA 5CZKA 2DCKA 3CKHA 1JYWA 4QX1A 4QDRA 2VMDA 4CUCA 5G04L 4DUVA 2B4KA 2BGOA 3E1F1 2B9VA 2EICA 3THDA 2ZEXA 5JR2A 2VC9A 3VD3A 1UMIA 4MADA 3F2ZA 1UY2A 4LPLA 5LA1A 1DP0A 3C7GA 1JZ8A 4BK4A 3T0BA 1OT5A 3NQHA 4MOAA 4QB1A 2YFUA 1CZVA 2W87A 4Z2AA 5HPOA 3A22A 1EUUA 3EYPA 3WNNA 1UY4A 4MGSA 1CIYA 3LEIA 4OZOA 4LHSA 3K75B 3WF3A 4A41A 2J1UA 1YQ2A 2J1AA 5JXIA 2E31A 4A45A 1JZ6A 2C9KA 2V4VA 3HJRA 1W8NA 2VZTA 3WNPA 2Y6GA 2WQ8A 2L9LA 3MO4A 2ZXQA 1ULOA 1JI6A 2XONA 2J1RA 1PMJX 3OBAA 3T0AA 3ZM8A 3MUZ1 4BK5A 3MBWA 2YC4A 4JKLA 3I3EA 3A21A 1GMMA 3VD4A 1DYOA 4OYUA 4LQRA 4GWIA 2WYSA 1OF3A 3T0DA 2WZEA 2QBXA 3DYMA 1LNSA 2WO2A 4QX3A 4CVUA 3VDBA 3OEAA 3HEIA 3J7HA 2VCAA 4XUNA 1XPWA 2RV9A 1PMHX 4DUXA 5J1XA 1PX3A 4KMQA 2Y6HA 4W50A 2ORZA 4PF1A 4ZXEA 3WNMA 2VO5A 2W95A 3T2OA 2DCJA 2VZRA 3IAQA 2J1EA 1PX4A 5LA0A 3LPFA 3OEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HN3 A;  1O8P A;  3PUH A;  2QQJ A;  3T2Q A;  4P02 B;  4QPW A;  1GOF A;  2W3J A;  3IDA A;  3WF1 A;  4QB6 A;  4DXS A;  2VMF A;  2V72 A;  2W46 A;  4GWJ A;  3C7O A;  3P1I A;  3PUI A;  2VZV A;  3GM8 A;  2E26 A;  4A44 A;  1K42 A;  3HOB A;  3I97 A;  3K77 A;  3SEE A;  5IFP A;  3NRU A;  4AG4 A;  2JDA A;  2X09 A;  2J1T A;  4DUW A;  3OB8 A;  5B4X A;  2J1V A;  2YG0 A;  1F4H A;  1GU3 A;  1K3I A;  5IFT A;  3MUY 1;  1JYX A;  1H6X A;  3C8X A;  1EUT A;  3WNL A;  4TXW A;  2WBK A;  3UES A;  1ULP A;  3CIH A;  3DEC A;  3T09 A;  3DYO A;  1NKG A;  1NAE A;  1KEX A;  1W9S A;  5F7U A;  4A42 A;  2WUH A;  1GQP A;  1K45 A;  1SHW B;  2JKX A;  2YC2 A;  4RN5 A;  1J84 A;  4RYD A;  3SKV A;  5C71 A;  3LEG A;  4QX2 A;  4CU9 A;  3EB7 A;  4BJ0 A;  1T2X A;  3ACI A;  5DQ0 A;  3OGR A;  5DN2 A;  3JXS A;  3K4Z A;  2LS6 A;  2VZ1 A;  4XUQ A;  5EIY B;  2CDO A;  3FL7 A;  2Y6J A;  3K4D A;  3K4A A;  3U37 A;  1US3 A;  3GDB A;  2E32 A;  3I2I A;  1W9T A;  2WO3 A;  1F4A A;  2W94 A;  4IUG A;  3UNP A;  2W92 A;  4CUB A;  2VMC A;  3I2K A;  3WQB A;  4KI5 M;  3SKJ E;  4QDQ A;  1UYX A;  2JD9 A;  4TTG A;  2E33 A;  5C7G A;  4ZZ8 A;  2YB7 A;  3NJV A;  1UZ0 A;  3ACG A;  3CMG A;  3MV0 1;  1JU3 A;  2WAO A;  2Y64 A;  3W5M A;  4QDS A;  5B4N A;  1JZ2 A;  5IJR A;  2KD7 A;  1UX7 A;  4A3Z A;  4UAP A;  3ETP A;  2EIB A;  4P08 A;  2WN2 A;  3OGV A;  1R64 A;  1DLC A;  3THC A;  1SG3 A;  3A7Q A;  1UXZ A;  5G05 L;  3BN6 A;  4JHZ A;  4XUR A;  1WCQ A;  1XNA A;  2ID4 A;  2VZU A;  2VZO A;  3VDA A;  3LPG A;  4DEV A;  3WNK A;  2WN3 A;  2QQN A;  4CU7 A;  4CU6 A;  1TVG A;  1XNT A;  3DYP A;  3HNM A;  5FUI A;  4OMC A;  4UOJ A;  3UET A;  2VZ3 A;  4JKM A;  1JZ5 A;  2Y6K A;  3K46 A;  4MGQ A;  5IHR A;  3HNB M;  2VM9 A;  4YPJ A;  1CZS A;  3ABZ A;  3A23 A;  4D8M A;  2BGP A;  3WEZ A;  2VQT A;  2YFZ A;  2LW8 A;  4P00 B;  1J83 A;  4PQQ A;  2VZQ A;  2VJX A;  4ZZ5 A;  2VCB A;  3IB3 A;  2W5F A;  1WKY A;  4M4P A;  2Y8K A;  1W9W A;  4PT6 A;  2W47 A;  3SEP A;  2BBA A;  2J7M A;  4W8J A;  4DEQ A;  1I5P A;  4XUO A;  1GUI A;  5DMY A;  1NUK A;  1KGY A;  1UXX X;  5EJZ B;  3GXU A;  4QB2 A;  1OD3 A;  5IYY A;  1UYZ A;  5LCW L;  3WNO A;  1UWW A;  1CZT A;  5A1A A;  2QQO A;  4XZU G;  1OF4 A;  3CDZ B;  2HLE A;  4ARY A;  2BZD A;  5C70 A;  2X10 A;  2R7E B;  4L0P A;  1O8S A;  2VME A;  1TG7 A;  1IQD C;  2V5D A;  1HN1 A;  3BGA A;  3CZJ A;  3NJX A;  5JUV A;  4XVH A;  3LQC A;  2XOM A;  2ZEY A;  2X05 A;  4OMD A;  1D7P M;  5JXG A;  2Y6L A;  1RYY A;  1JZ4 A;  1W0N A;  3OGS A;  1JZ3 A;  2XHN A;  2EID A;  4JKK A;  4DXT A;  1W8O A;  4P5Y A;  1GOG A;  2W1W A;  2CDP A;  1L7Q A;  2VR4 A;  3I2H A;  3CZU A;  5JXH A;  1UMH A;  2VTF A;  1GOH A;  3III A;  3WF4 A;  1JU4 A;  3C7H A;  3I2F A;  3ECQ A;  5CYY A;  2VZP A;  2OKX A;  1XC6 A;  1L7R A;  5HXM A;  3FHA A;  3CQO A;  2BER A;  4CUA A;  3I3B A;  3NNG A;  2VCC A;  2W1Q A;  4CU8 A;  1O59 A;  2C26 A;  4KWU A;  2J1S A;  2VQU A;  4BDV B;  2JE8 A;  2W9X A;  4QX0 A;  2ORX A;  4M4R A;  2HYX A;  2VL4 A;  2W1S A;  3WF0 A;  1BHG A;  1JZ7 A;  4XUP A;  4E8C A;  2ZEZ A;  3FN9 A;  4HG6 B;  2EIE A;  3VD7 A;  2RVA A;  2WZ8 A;  1JYN A;  3I2G A;  2VZS A;  4QAW A;  3MV1 1;  1CX1 A;  4ZY9 A;  3LEK A;  1JHJ A;  2PQS A;  2VOT A;  4UI9 L;  4W4Z A;  5JXJ A;  2WAB A;  4BXS V;  4A6O A;  4GZ9 A;  4FI9 A;  2XQX A;  4MO3 M;  4OUE A;  1US2 A;  2WDB A;  3FHQ A;  1UY1 A;  1GNY A;  4XUT A;  4AAX A;  3C7E A;  4E8D A;  1K12 A;  4JX0 A;  3VD5 A;  3GGL A;  3WF2 A;  1MPX A;  1SDD B;  2WO1 A;  3W5N A;  3WSO A;  2QQM A;  5DPN A;  5LA2 A;  2QQL A;  3LE0 A;  1NX9 A;  1UYY A;  2QQK A;  2J22 A;  3HNY M;  3I2J A;  3OG2 A;  1UY0 A;  3P6B A;  2C4X A;  2Z4F A;  3AC0 A;  3IAP A;  3VDC A;  3T08 A;  3HPN A;  4ARX A;  3C7F A;  5JMO A;  1W99 A;  4LKS A;  3VD9 A;  2DDU A;  1H6Y A;  3ACH A;  5EJ1 B;  1JYV A;  3I3D A;  5I0D A;  2WAA A;  2QQI A;  2ZEW A;  4DXR A;  2W91 A;  4D0Q A;  3D3A A;  2RJ2 A;  4A4A A;  1P8J A;  3ACF A;  1OH4 A;  3T2P A;  4ET7 A;  1UY3 A;  2W1U A;  5CZK A;  2DCK A;  3CKH A;  1JYW A;  4QX1 A;  4QDR A;  2VMD A;  4CUC A;  5G04 L;  4DUV A;  2B4K A;  2BGO A;  3E1F 1;  2B9V A;  2EIC A;  3THD A;  2ZEX A;  5JR2 A;  2VC9 A;  3VD3 A;  1UMI A;  4MAD A;  3F2Z A;  1UY2 A;  4LPL A;  5LA1 A;  1DP0 A;  3C7G A;  1JZ8 A;  4BK4 A;  3T0B A;  1OT5 A;  3NQH A;  4MOA A;  4QB1 A;  2YFU A;  1CZV A;  2W87 A;  4Z2A A;  5HPO A;  3A22 A;  1EUU A;  3EYP A;  3WNN A;  1UY4 A;  4MGS A;  1CIY A;  3LEI A;  4OZO A;  4LHS A;  3K75 B;  3WF3 A;  4A41 A;  2J1U A;  1YQ2 A;  2J1A A;  5JXI A;  2E31 A;  4A45 A;  1JZ6 A;  2C9K A;  2V4V A;  3HJR A;  1W8N A;  2VZT A;  3WNP A;  2Y6G A;  2WQ8 A;  2L9L A;  3MO4 A;  2ZXQ A;  1ULO A;  1JI6 A;  2XON A;  2J1R A;  1PMJ X;  3OBA A;  3T0A A;  3ZM8 A;  3MUZ 1;  4BK5 A;  3MBW A;  2YC4 A;  4JKL A;  3I3E A;  3A21 A;  1GMM A;  3VD4 A;  1DYO A;  4OYU A;  4LQR A;  4GWI A;  2WYS A;  1OF3 A;  3T0D A;  2WZE A;  2QBX A;  3DYM A;  1LNS A;  2WO2 A;  4QX3 A;  4CVU A;  3VDB A;  3OEA A;  3HEI A;  3J7H A;  2VCA A;  4XUN A;  1XPW A;  2RV9 A;  1PMH X;  4DUX A;  5J1X A;  1PX3 A;  4KMQ A;  2Y6H A;  4W50 A;  2ORZ A;  4PF1 A;  4ZXE A;  3WNM A;  2VO5 A;  2W95 A;  3T2O A;  2DCJ A;  2VZR A;  3IAQ A;  2J1E A;  1PX4 A;  5LA0 A;  3LPF A;  3OEB A; 
#chains in the Genus database with same CATH topology
 1L3J A;  2NYY A;  3HN3 A;  5A32 B;  3T2Q A;  2QDR A;  4CDU B;  1LCL A;  4TLG A;  4YRD A;  4QPW A;  2X8K A;  1V6L A;  4OI2 A;  4ITC A;  1GOF A;  2GC0 A;  2W3J A;  2W2I A;  4AQ2 A;  1OUR A;  3WF1 A;  2VMF A;  4K9S A;  1FNY A;  3VDD B;  1EPZ A;  1KDM A;  2DVB A;  1Z7S 1;  3PLQ A;  1REE A;  1W6O A;  4IXL A;  3KZ4 C;  1RHI 1;  2R06 2;  4UFM A;  2P3K A;  3Q8C A;  4AGV A;  1MEC 1;  1GWL A;  5CU1 A;  2YU2 A;  1H9W A;  4XIO A;  5FXZ A;  5GAL A;  3E5X A;  1PGW 2;  4OI4 A;  1PNG A;  2HH9 A;  3U4X A;  1RUD 2;  4A44 A;  3NWK A;  4IND A;  5F3E A;  1AR8 2;  1VE0 A;  1AX2 A;  3PL0 A;  5FXW A;  2F4L A;  3T30 A;  3ZFF B;  4Y24 A;  5IFP A;  2E6V A;  2JDA A;  3U14 A;  2O8O A;  2J1T A;  4JVA A;  2CGO A;  2J1V A;  4FT8 A;  1GFF 2;  4GMP 3;  1NA1 C;  4HSJ A;  2UWA A;  4Q4W 1;  1JYX A;  5BV6 A;  4EN8 B;  2H6B A;  2YV8 A;  3SLI A;  3KT1 A;  5J09 A;  1EUT A;  3I3Q A;  1PZ8 A;  4HZF A;  1Z7S 3;  4N9I A;  4YWA A;  1ULP A;  3WNL A;  2EXH A;  4GWN A;  4YVS C;  2ZGK A;  1WMF A;  3T09 A;  2VUC A;  2DUP A;  1MEC 3;  4CP0 A;  5FO7 B;  5K8S A;  4KBZ A;  4QHZ A;  4D7T A;  5FOJ B;  2DWR A;  1UPS A;  4HK8 A;  2CHH A;  3RRD A;  4UW6 A;  1YQ5 A;  4PDW A;  2GAL A;  2HWC 2;  4Q4X 3;  1AYN 3;  5CFD C;  1VBC 1;  4IL7 A;  1UZY A;  3OF1 A;  4OCT A;  1NE6 A;  1S2B A;  3POI A;  1LOC A;  3ZPO A;  3MPB A;  3FZ3 A;  4IEX A;  4N43 A;  4NRM A;  3AZW A;  4QWN A;  3VBR A;  3IKW A;  4CU9 A;  2GME A;  2RR1 2;  2JDZ A;  4JGZ B;  4P9J A;  5FY8 A;  5F8P A;  5DQ0 A;  4Q4W 3;  4LIV A;  2WNO A;  1QQP 3;  1ZA7 A;  4PF5 A;  5BNO A;  1JOP A;  1OVS A;  5FY1 A;  1SCR A;  1ASJ 2;  1AYM 1;  1IS6 A;  3R4S A;  4G3Y C;  4YVW C;  2LS6 A;  5J96 B;  1QGL A;  4Q5O A;  4LBO A;  5KHJ A;  2CDO A;  3K4D A;  3WZ1 A;  4AL9 A;  3UGH A;  1RXF A;  2VTX J;  5J7M A;  4NMI A;  1POV 0;  5HCB A;  3A0N A;  2YDE A;  2WNU A;  4FTB A;  3P3N A;  4R9C A;  2PHW A;  4N7U A;  3WNX A;  5IK5 A;  5EHD A;  3I2I A;  2RDS A;  3POJ A;  1OQD A;  3I7D A;  1EV1 3;  4XYX A;  4QU2 A;  1FOD 1;  2Q1M A;  4BH9 A;  1PIV 1;  4WZF A;  3E6C C;  1F4A A;  1GNZ A;  2JG8 B;  1F35 A;  4O7X A;  2JEN A;  4Q4V 2;  4N8M A;  1B09 A;  4R8H A;  3I2D A;  4CUB A;  1FPN 2;  2D3P A;  4H55 A;  5F3C A;  2EXI A;  4YZ4 A;  4CTE A;  2DUQ A;  1PO2 1;  1KJR A;  2WT1 A;  1BMV 2;  3MFA A;  4XAB A;  3B69 A;  3SKJ E;  4ES9 A;  4OHV A;  5HXV A;  1HKD A;  1VMF A;  2J42 A;  2PN5 A;  3NV3 A;  3BIE A;  3LAG A;  2WAO A;  1UN1 A;  4AAP A;  2I45 A;  2Y64 A;  2CTV A;  1UD1 A;  3W5M A;  1R08 3;  4WM7 C;  4AW7 A;  3R05 A;  1DQ1 A;  5JPM B;  4E4H A;  2DUO A;  3R0R A;  4B8E A;  5B4N A;  4CDW B;  3ZXL A;  4FOV A;  2YZ4 A;  1Q8Q A;  3ENR A;  2KD7 A;  4NOT A;  4K3U A;  3GCW A;  2K9Z A;  1OOP B;  5F3I A;  5E1R A;  4AEM A;  1F5J A;  3GJA A;  4UAP A;  4RHV 2;  3RZJ A;  3ETP A;  4JQT A;  4BWO A;  4CZS A;  4IV3 B;  1AHS A;  4D7S A;  2WN2 A;  3IDB B;  4HK9 A;  3SH4 A;  1DLC A;  4R4Z A;  5FYZ A;  1FV2 A;  4EWD A;  2YRO A;  1DQ0 A;  4JHZ A;  3KMH A;  3JCI A;  2BEO A;  2HWF 1;  1A8D A;  4LA2 A;  4LBM A;  4JCK A;  4QGM A;  4B4Q A;  3SMH A;  1IPK A;  3OBR A;  1Q5O A;  2RJL A;  2SBA A;  2VQ0 A;  2XWB B;  3K51 A;  2QQN A;  2HWD 1;  2GC3 A;  4AFD A;  3C2U A;  5D1I A;  2RS1 2;  5AVP A;  2WWU A;  2OUJ A;  3MYX A;  4UW3 A;  5DAV A;  3DYP A;  3HNM A;  1E5H A;  2WT0 A;  1SBE A;  4AHY A;  5FZO A;  1TZO A;  5GLZ A;  5F5I A;  1LOA A;  1ZZC A;  5FWJ A;  2Y6K A;  3K46 A;  4FPY A;  4UW4 A;  1MS4 A;  1AL0 G;  1W28 A;  2VM9 A;  1C5H A;  2QZ3 A;  1S0G A;  1OH3 A;  4XXP A;  4NPM A;  1U12 A;  2JG9 B;  3BVC A;  5FP8 A;  2DFC A;  1FAY A;  3AVR A;  4CCE A;  3G7D A;  3ZFG B;  2VBD A;  1R1A 2;  1W8H A;  2HWF 3;  2FCT A;  3OYW A;  2VZQ A;  1GYK A;  4H14 A;  2Y26 A;  5M0T A;  4XDQ A;  2W5F A;  2GH8 A;  3WHT A;  5FUP A;  1PGL 1;  4N7I A;  1W0O A;  3AJZ A;  1AJK A;  1H8V A;  4PDW C;  3VBS B;  1FT9 A;  4P9L A;  3AKQ A;  3AYC A;  2D6P A;  3C3V A;  1I5P A;  4GUL A;  3CO2 A;  4XUO A;  2D3R A;  5FZH A;  5K4L A;  3VBR C;  3W21 A;  1TMF 2;  3ETQ A;  3LZZ A;  4OI1 A;  1AR9 2;  3GBW A;  4CYD A;  3WXP A;  2ZA9 A;  4IGP A;  5J36 A;  5JOY A;  4LEJ A;  2ZKL A;  1VAK A;  1J59 A;  1W8U A;  3KF3 A;  5IYY A;  5SV8 A;  3O1S A;  1QWR A;  1OA4 A;  4YNI A;  5BNO C;  5K7P A;  2TBV A;  3V64 A;  4S2G A;  1B35 B;  5I91 A;  3V0A B;  4UF0 B;  1CZT A;  2OS2 A;  4KWL A;  2O14 A;  3GZU C;  1Z7S 2;  4LBQ B;  1CAW B;  1ULE A;  2A6Y A;  3CDZ B;  3RPQ A;  2FQP A;  1RUH 1;  5JOZ A;  4FTE A;  3WDW A;  5C70 A;  1RHI 2;  1DLL A;  4LLF A;  1MEC 2;  2Q8E A;  4YW6 A;  1OI6 A;  2D93 A;  4LBL A;  2WNU C;  2DUR A;  3J9S A;  5J48 A;  3PJQ A;  1HX6 A;  1LGB A;  2XVG A;  3VHN A;  2FCV A;  2PFW A;  5CAD A;  1HN1 A;  1OKO A;  3AP7 A;  3RNS A;  3H8O A;  1PVX A;  5FZ7 A;  2R07 1;  2VMH A;  1UX6 A;  4NN0 A;  3AK0 A;  4N9H A;  4Q26 A;  1IS5 A;  5C9A A;  4LA3 A;  1JXN A;  2JDM A;  4DS0 A;  1STM A;  1NY7 1;  2V4A A;  4FPC A;  4QPI A;  5FLJ A;  1S0D A;  4Q4W 2;  4BLJ A;  1YJL A;  4BYY A;  3OGS A;  1DZR A;  1R09 2;  2D43 A;  4JKK A;  4DXT A;  1IKP A;  4P5Y A;  4Y1Y A;  2XB6 C;  2UU8 A;  1RUH 3;  2CDP A;  4GIQ A;  3I2H A;  3CZU A;  4J25 A;  3RJ2 X;  1JYC A;  2B42 B;  3USS A;  3VBU A;  4AR2 A;  2R0H A;  3VKF C;  2CY6 A;  1RUN A;  1AL2 3;  2VD7 A;  4JDO A;  1VBC 2;  5CYY A;  2VZP A;  2XJU A;  2XVK A;  5FPB A;  3ZSE A;  2E7Q A;  2LAL A;  4IGQ A;  4Y1Z A;  1SLA A;  2ZS6 B;  3M1H A;  3MLL A;  3M8L A;  1NG0 A;  1L7R A;  4ASK A;  5FZD A;  5LAT A;  2DVF A;  2HWE 1;  1XNK A;  1DZT A;  2WLQ A;  4M0H A;  2YPJ A;  1O59 A;  1XQN A;  3MLJ A;  1BK0 A;  1BXH A;  1AR7 1;  2ZAA A;  3KWV A;  3POF A;  4PLM A;  5GZE A;  1WW5 A;  3N9M A;  4KGG A;  4PCR A;  3AXD A;  1YI7 A;  4K1Z A;  1AYM 2;  3F95 A;  5F6L B;  3WDT A;  1KJL A;  4BDV B;  5A6Z A;  4A6S A;  2BVV A;  3K3O A;  4Y4R A;  5APA A;  1C28 A;  2W1S A;  1JZ7 A;  1N1S A;  2WNV B;  4DRR A;  4OZX A;  3CJI B;  1X36 A;  4HG6 B;  2D98 A;  3FBM A;  1RGS A;  2WZ8 A;  1JYN A;  4QX7 A;  3B93 A;  4U36 A;  4QPY A;  4DFS A;  3MF6 A;  1FOD 2;  2VZS A;  1PIV 2;  4Y20 A;  5LBB A;  4E2G A;  2W0X A;  2XJR A;  3B94 A;  4NRO A;  4QAW A;  5DZG A;  3VHP A;  4NHM A;  1Q8P A;  1ULG A;  4N90 A;  1HB4 A;  4XFF A;  2PQS A;  2VOT A;  3V65 A;  3BB6 A;  4Y5T A;  4IEW A;  1AR7 3;  4TWT A;  1QJY 1;  1UOF A;  4YGB A;  1IQA A;  3UV9 A;  3WDX A;  2W08 A;  1W2O A;  1PO2 2;  5IAV A;  4GZ9 A;  4XET A;  5BPX A;  4A6O A;  4NPL A;  4EN7 B;  1VBA 3;  3FHQ A;  1GZW B;  1W8T A;  5T52 A;  3N35 A;  1D2Q A;  3VD5 A;  1QDO A;  5IK4 A;  1OUX A;  3CJX A;  4YZ1 A;  5EJ3 A;  4TZD A;  3PME A;  1UYY A;  3PVE A;  3VKL A;  1OC1 A;  5KC5 A;  3ZXK A;  3BTX A;  1HJF A;  1WGP A;  4K1Y A;  4UBG A;  4AEK A;  1H2N A;  3HNY M;  3OG2 A;  3S7I A;  1ENS A;  1VMJ A;  1YYN A;  5GLW A;  2XL9 A;  2DFB A;  5CVR A;  5IT6 A;  3FUQ A;  5CKQ A;  4HET A;  4KWJ A;  3C7F A;  4IDZ A;  1W99 A;  2P17 A;  2IXK A;  5FZL A;  2BFU L;  4I3G A;  1DFQ A;  1HQN A;  5F2W A;  2HWF 2;  3O0W A;  3I3D A;  4Y22 B;  2A6Z A;  4WVV A;  3ZN6 A;  5KXD A;  5CA6 A;  2ZAC A;  3T4H B;  2HWD 2;  4NAM A;  1DF0 A;  5FY9 A;  1POV 1;  4WVM B;  4DXR A;  2PAE A;  1V00 A;  2DCY A;  2B46 X;  2DTY A;  2VW2 A;  2WJS A;  1Y9M A;  3D82 A;  4I30 A;  2H0B A;  3ACF A;  1NQD A;  1RVF 1;  1SPP B;  5FXX A;  3NAP B;  4FPL A;  3WP3 A;  4YM3 A;  4I3P A;  1V6K A;  4ET7 A;  3JBG 1;  4I0A A;  4LUM A;  2BU9 A;  5JMC A;  4WBB A;  1CIW A;  3HT1 A;  4OUL A;  4QQ2 A;  4Z07 A;  5DG2 A;  5C9A C;  2VMD A;  3JU9 A;  4HT1 T;  3AP5 A;  5G04 L;  4RR3 B;  4CP1 A;  3PMS A;  2FZ2 A;  4QPI C;  1PNF A;  2KR2 A;  1OA3 A;  3O1U A;  3GYD A;  3RI8 A;  5HCA A;  3FHI B;  3LIG A;  1G9C A;  4AQ6 A;  2CAV A;  1SLB A;  2EIC A;  2MNG A;  2RMU 3;  3PU8 A;  1C3H A;  2ARA A;  3LFM A;  2WNE A;  3VD3 A;  1UMI A;  4YM0 A;  4AFC A;  1XOY A;  1YFW A;  5B2G B;  1UY2 A;  3VBU C;  4YYO A;  3POY A;  4YFW A;  4F3J A;  1UAI A;  4O9G A;  1W05 A;  4BK4 A;  1POV 3;  5I8T A;  5A6Y A;  3QAC A;  4HKW A;  4LOS A;  2Z69 A;  1RVF 3;  3I3M A;  3JUU A;  3GZA A;  1JUH A;  1C5I A;  3JBG 3;  4MUV A;  3KLS A;  4EZH A;  1H8T A;  1DYK A;  1EUU A;  1GZT A;  2ERF A;  3RG0 A;  2R1D A;  1SBD A;  4AVC A;  1CIY A;  2CYF A;  4QXC A;  1PGS A;  4OHW A;  5FQ0 A;  2Y0O A;  3N36 A;  2ZGL A;  3ON7 A;  4FPJ A;  2P2K A;  3ILN A;  3KQ4 B;  4LBQ D;  4Q0P A;  3ZN5 A;  2VUL A;  4XF4 A;  2EAL A;  4CP9 A;  5F5A A;  1LOF A;  4QPG B;  2YHJ A;  4EN0 A;  3U10 A;  1W04 A;  3O1P A;  3IPV A;  1GV9 A;  4RD7 A;  5E89 A;  3HJR A;  1W8N A;  1ULD A;  1F15 A;  2XQR A;  1O3T A;  1APN A;  4GD4 A;  5EYY A;  5L7O B;  4WVW A;  4WM7 B;  3ES1 A;  3UJQ A;  2BQP A;  5C8W A;  4NJ4 A;  1OFN A;  2P34 A;  3OPW A;  2I07 B;  2WS9 3;  2Z5W A;  4IGO A;  4NRP A;  5T5L A;  2WFF 1;  1POQ A;  4LBK A;  2XON A;  4X6R B;  1PMJ X;  2OVU A;  4RS5 A;  4WM8 A;  5GLV A;  1WLC A;  4HN1 A;  2R07 2;  4ZKT B;  3OBA A;  5FMO S;  3V0B A;  4AZZ A;  3PJY A;  3IDE A;  1NY7 2;  3OPT A;  5C4W B;  3I3E A;  4MGY E;  2JEC A;  1VPH A;  3A21 A;  4QQH A;  3ZYB A;  3VD4 A;  4LQR A;  1DG6 A;  3T0D A;  1QKQ A;  3VKM A;  1GBG A;  4BM8 A;  4COU A;  1NCQ A;  1VBD 1;  3NV2 A;  5A7O A;  3DYM A;  4KU8 A;  2WO2 A;  5A33 A;  3THT A;  2PHU A;  3PTR B;  2FD8 A;  2IFW A;  3OY8 B;  4GB3 1;  4A7Z A;  3W20 A;  1XPW A;  2RV9 A;  1HXS 1;  4C1X A;  3URF A;  2Y6H A;  2XL7 A;  1OA2 A;  2VXJ A;  4QM8 A;  1A6C A;  4LR4 A;  1W8Z A;  4QQL A;  2ZGU A;  5HCF A;  1QJX 2;  5BXX A;  4XF9 A;  4CSW A;  1VB4 A;  2WT2 A;  4MGT A;  1NCR A;  2PAK A;  1Y43 B;  2HWE 2;  4XMA A;  1PX4 A;  4UW5 A;  3OEB A;  5FPZ A;  4FPK A;  1O5U A;  2ENR A;  3HN1 A;  3KGZ A;  3PUH A;  4S2H A;  4XDO A;  5ANN A;  2HWC 1;  1RUD 3;  2DCT A;  1AR7 2;  4RGA A;  5FZC A;  1QXR A;  4IE5 A;  5KXC A;  1AR8 3;  5LEJ A;  3BPZ A;  3VN4 A;  4M01 A;  1ND2 A;  4QB6 A;  4DXS A;  2ETE A;  4HL0 A;  5ABJ B;  4IV1 C;  3HQR A;  1ZNP A;  1TQ5 A;  1GQG A;  2ZBJ A;  5C3P A;  3ASI A;  1YIP A;  4GWJ A;  3GF6 A;  4YG6 A;  5FRE A;  3ME2 A;  1W8W A;  3P1I A;  3PUI A;  1QXJ A;  1C1L A;  1CAV B;  4AVV A;  4L2N A;  5FJH A;  5DAX A;  2QNK A;  2PA7 A;  1D4M 1;  4EE2 A;  4TSV A;  3HOB A;  3AP6 A;  3K77 A;  2GC2 A;  3WG4 A;  3ZXE A;  2NMO A;  4AG4 A;  3O1T A;  4Q4Y 1;  1RIT A;  1TEI A;  3IT8 A;  2HWC 3;  2OPW A;  4ZS2 A;  5B4X A;  1QJY 2;  2YG0 A;  4URT A;  1JOD A;  1F4H A;  1K3I A;  1DIW A;  3LDR A;  4ZHN A;  5F39 A;  2PYT A;  1OUS A;  1W6P A;  1G86 A;  2CU5 A;  4A3X A;  3C8X A;  4QM9 A;  2WBK A;  1F31 A;  3N3H A;  3ZN4 A;  5H9R A;  1U0A A;  3WDY A;  3DYO A;  1IGO A;  3E5U A;  1NKG A;  1NAE A;  4XJW A;  2OYZ A;  1QOS A;  4MH0 E;  5IWF A;  1WD3 A;  3H1Y A;  4V2W A;  1ASJ 3;  1GQP A;  1BMV 1;  1SHW B;  3M3I A;  1BBT 1;  1S0I A;  1GWM A;  2XJQ A;  5BUV A;  2P3I A;  2ZGQ A;  1QH6 A;  1H8T C;  3TNQ A;  2A75 A;  3GZT B;  5A7W A;  3TEY A;  5A3P A;  2ZZJ A;  5F5C A;  1KXG A;  3EB7 A;  4EV0 A;  3M70 A;  4LIU A;  1HDK A;  1QJZ A;  3IBM A;  5FTT C;  3ACI A;  4IE6 A;  1PZ7 A;  1Y4W A;  2XHK A;  2X5I A;  3AYA A;  1LOF C;  3KF5 A;  4HOO A;  3HR9 A;  5FAX A;  2YGL A;  5T5J A;  4XXA A;  1OVP A;  4AYU A;  4M3C A;  5JOW A;  5FYC A;  5LBF A;  3Q8B A;  3NW4 A;  4Y3O A;  4Q4V 3;  2XR4 A;  2GMP A;  4COW A;  2ZGP A;  5FZ0 A;  3AX4 A;  3VBO B;  5EIY B;  5FCC A;  2MEV 1;  2PXJ A;  5T5P A;  4NWV A;  1LTE A;  3PVN A;  3K4A A;  1ZA4 A;  3BU7 A;  1CAU B;  3DUI A;  4MHU A;  1BBT 3;  1US3 A;  1YO8 A;  2VNR A;  3Q9O A;  3U37 A;  1DQ2 A;  1MZ6 A;  1Q8O A;  1RVF 2;  1YC6 1;  3ZFE B;  1LUL A;  2AH2 A;  2WC2 A;  4RS5 C;  4WM8 C;  2ARE A;  3JBG 2;  3WDU A;  4Z1V A;  5A3O A;  1CR7 A;  5EV7 A;  1G6N A;  2D5H A;  1C8N A;  4K8F A;  5DAW A;  4HBN A;  3L9J T;  3BAL A;  1ZRR A;  3UNP A;  4J1W A;  2W92 A;  3WG2 A;  1S55 A;  3I2K A;  1RUF 1;  3FX3 A;  3QBQ A;  4YAR A;  5L9V A;  3WQB A;  1K5M C;  3CNA A;  4IEP A;  4AHZ A;  4N53 C;  1NCQ C;  3WQ7 A;  4QDQ A;  4RHV 3;  4TTG A;  2AAC A;  5GKA C;  1JOB A;  1MZE A;  2YB7 A;  4NO4 A;  2DBI A;  2ILM A;  5FO9 B;  3ACG A;  3J7N A;  4JTN A;  5DG1 A;  3MV0 1;  2D3S A;  1JU3 A;  1V0A A;  1GWK A;  3EJK A;  1YFY A;  3PIG A;  3EQE A;  1R1A 1;  4PBP A;  4QDS A;  2QFE A;  2VPV A;  1U5Z A;  2DF7 A;  2JWP A;  3O5S A;  3WP5 A;  5A3U A;  4XF1 A;  4CXW A;  3AZV A;  3E97 A;  1I5Z A;  4A3Z A;  2VQA A;  3AM2 A;  4PBO A;  3DPR B;  1HV0 A;  1EY2 A;  5IK7 A;  3HBK A;  2BTV C;  3I59 B;  2I74 A;  2EIB A;  5ANQ A;  3ZYP A;  1MVE A;  1W3V A;  2RS1 3;  4XHX A;  1RUF 3;  3EMR A;  4LNV A;  1GP6 A;  2KA3 A;  1SG3 A;  5A7N A;  3NNL A;  3OBT A;  5C3S A;  4LBJ A;  1UXZ A;  5FR3 A;  4YGE A;  1RJ7 A;  1UCX A;  1XNA A;  4ZPI A;  2ID4 A;  4KWK A;  5FBZ A;  2VU9 A;  2HYK A;  4YZ2 A;  5FLI A;  2Q8C A;  1S2K A;  2Q4S A;  3DXU A;  2ZJC A;  4FP2 A;  3BTY A;  3ZKY A;  2D6K A;  4NIA A;  1K5J A;  4LE4 A;  2ZX1 A;  4M0N A;  3MF9 A;  4DEV A;  2FDF A;  1LU1 A;  5JI9 A;  1R1A 3;  3VBF B;  1XNT A;  1O5L A;  4K21 A;  4R52 A;  4M3C F;  4MLO A;  3D0S A;  2WFF 2;  1OPM A;  5FUI A;  3T3Y A;  5FPL A;  2R0F A;  2UY9 A;  1JZ5 A;  1UW8 A;  3ZXD A;  4MGQ A;  1WLT A;  4JV4 A;  2WFP A;  2XKO A;  1YQ6 A;  1JTZ X;  4RL7 A;  1VAL A;  4YPJ A;  3ABZ A;  3IDC B;  4ZU4 A;  5A7S A;  2XLA A;  2BNO A;  4KL1 A;  1A8M A;  3AP9 A;  2GNT A;  5J98 B;  2VQT A;  2G9Z A;  2YFZ A;  5FIX A;  4PLN A;  1TMF 3;  5FMO L;  4I02 A;  4CRQ A;  3DF0 A;  1AR9 3;  4ATE A;  1KFU L;  1VBD 2;  5FYI A;  4E4Z A;  4ZZ5 A;  1ZZB A;  3WD5 A;  2VCB A;  3MDP A;  4DIN B;  3AMQ A;  4M4P A;  1ZBA 1;  3UKV A;  1PM4 A;  3RWK X;  4A2U A;  4PT6 A;  4GB3 2;  2R1B A;  4Y4Y A;  3U1X A;  1N3P A;  1ND3 A;  1HXS 2;  4CEW B;  1BZW A;  4LJH A;  4LHK A;  4BZ4 A;  2BBA A;  3GBG A;  3UKT A;  1R09 1;  1V6M A;  4NID A;  1BEV 1;  1ONA A;  2ZKN A;  4W8J A;  2JXA A;  4UFJ A;  4YW5 A;  1XE8 A;  2VE1 A;  3VZO A;  4DEQ A;  5DMY A;  5K9Y A;  3B00 A;  1NUK A;  1RHI 3;  2OX0 A;  4MET A;  4BQ2 A;  1W6Q A;  1DGW X;  1DQ6 A;  3GXU A;  4U2A A;  3ZXG A;  2WA3 A;  5IAX A;  4QB2 A;  1OD5 A;  2G9G A;  1H4H A;  5KHH A;  2B9U A;  1W03 A;  1UYZ A;  4HLT A;  5FZM A;  3WW1 A;  5CBL A;  3TNP B;  2VGD A;  2WYF A;  4FPE A;  2Y6F A;  5I0S A;  1UF2 C;  1YCI A;  3EHK A;  4I0W B;  4P5H A;  1UOJ A;  5A70 A;  1D0G A;  4DPN A;  2QQO A;  3AMH A;  4B7K A;  2RE9 A;  4HPK A;  4XZU G;  1ZBA 3;  4XQD A;  1BCX A;  1OF4 A;  2E51 A;  2VXR A;  4QGN A;  1QJU 1;  2P3J A;  2X10 A;  1QIQ A;  2BNM A;  5F1R A;  3ZIX A;  3ZMO A;  2FDJ A;  2VME A;  1TG7 A;  4UBH A;  1UPI A;  1NE4 A;  1R09 3;  1VRB A;  1IQD C;  4XQ4 A;  3UK9 A;  3VZL A;  3WV6 A;  5J37 A;  1YEW A;  4XFC A;  1D4M 2;  5FZ6 A;  5SV5 A;  1F9K A;  3L2H A;  5C33 A;  3CZJ A;  3NJX A;  3H3L A;  1YRZ A;  5E88 A;  4L11 A;  4Z92 B;  5HI0 A;  4GJZ A;  4Q4Y 2;  2GP3 A;  1H2L A;  4FSJ A;  2PHT A;  4R4X A;  2QQW A;  1VBC 3;  2IXC A;  4ERO A;  2WZR 1;  1D7P M;  4AFB A;  3AB0 A;  4XAC A;  2Y6L A;  4X6Q B;  1JZ4 A;  1J1T A;  1J58 A;  2VMG A;  1V9U 1;  3RFR A;  3RYK A;  4CCL A;  5BNP A;  4HFS A;  4NPR A;  3VBH B;  1GOG A;  1WCU A;  2D6L X;  5JXH A;  3X29 B;  1UMH A;  3KSC A;  2VTF A;  3N9L A;  4CCO A;  3OBZ A;  2YU1 A;  2OII A;  4CEY B;  2VG9 A;  2QJV A;  3NNJ A;  1AYM 3;  3ECQ A;  3M7A A;  1BBT 2;  3AZX A;  1VBE 2;  2OKX A;  3WW3 A;  3MHZ A;  2FDG A;  3UT0 A;  2FZ1 A;  3FHA A;  2B39 A;  3I3B A;  3NNG A;  4LMF A;  4YGD A;  2WZR 3;  2W1Q A;  2WQ4 A;  4CU8 A;  3WP6 A;  1URX A;  5HCH A;  3POB A;  2C26 A;  4JDM A;  4O65 A;  2JX9 A;  1WCD J;  1W2A X;  2VQU A;  1FOD 3;  1Q8S A;  4Y26 A;  1PIV 3;  1LGC A;  4WZC A;  2JE8 A;  5GLT A;  5CB7 A;  3RZL A;  3KT4 A;  2ORX A;  4M4R A;  4FFG A;  4FFH A;  1V6J A;  2MEV 2;  5FUN A;  1UKG A;  5FWE A;  3WF0 A;  1ENR A;  2Y38 A;  4E8C A;  1PO2 3;  1LHU A;  5T3N A;  3VV1 A;  1QY4 A;  3N7K A;  2V09 A;  3VD7 A;  4ASL A;  3B7M A;  4ASM B;  1OLQ A;  1JYI A;  3USU A;  4Q29 A;  5C5U A;  4CDQ B;  5CG8 A;  1Q56 A;  5JSP A;  1X82 A;  2YYO A;  4AI0 A;  2P3Y A;  4LT5 A;  3RZH A;  4ZY9 A;  1SLT A;  1LR5 A;  5CEH A;  4QGL A;  4J1X A;  3M3C A;  1SBF A;  4A7Y A;  3ZFE A;  1PM7 A;  2BWA A;  5I0R A;  1S0F A;  5BNN B;  1MQT B;  1QNW A;  1RUF 2;  2P37 A;  4W4Z A;  3RYP A;  5JXJ A;  3P3P A;  3CBN A;  1WME A;  3NJZ A;  4FI9 A;  3N7M A;  2XQX A;  4D6R A;  4FOW A;  4IV1 B;  1BQP A;  3MIB A;  3Q8F A;  4AE2 A;  1O7F A;  4E8D A;  1X9T A;  4XUT A;  5K0U A;  3C7E A;  4AED B;  1H0B A;  2EVX A;  2VTX A;  3KV9 A;  4JX0 A;  4XFI A;  4CXY A;  2DBN A;  3LSE A;  4Y5S A;  1ND3 C;  1T6G C;  3KVA A;  3JD7 2;  4XTP A;  5DPN A;  3AYD A;  1VMH A;  3GBF A;  1X33 A;  1YFU A;  5C8C B;  5EYX A;  3WT3 A;  5IW0 A;  1SFP A;  1AZD A;  4P9Y A;  3PVB B;  2QQK A;  4GH4 A;  1AXK A;  4RQP A;  1NXM A;  3UYJ A;  2ZGS A;  3P6B A;  3PUQ A;  2HWD 3;  2R49 A;  4GAZ A;  5FYS A;  5FZ4 A;  4Q0V A;  3IAP A;  3FJS A;  3T08 A;  1MZ5 A;  2XJT A;  4OLL A;  3HPN A;  1PHM A;  5JZG B;  1H6Y A;  3ACH A;  4BE3 A;  1XB9 A;  4N43 C;  5DDJ 1;  1JYV A;  1PK6 A;  2K46 A;  2IVI B;  2ZOE B;  3VZM A;  4DQA A;  5I0D A;  2WAA A;  2IVJ A;  3KVB A;  4WVZ A;  4AK3 A;  5LBE A;  3GNE A;  2DCZ A;  4UXA A;  1N47 A;  4JGY B;  4MXW A;  4W65 A;  2OQ7 A;  2VNV A;  3RMX A;  1C1F A;  1W90 A;  3B9C A;  4A4A A;  4D7Y A;  2NP0 A;  1W6N B;  1AX0 A;  4JTO A;  5A32 A;  4CDU A;  5JIU A;  4IEY A;  5CZK A;  3CKH A;  1MS9 A;  3S7E A;  1YJK A;  1WD4 A;  3TEX A;  4CUC A;  4BA6 A;  3VDD A;  4C0H A;  2BGO A;  1SLL A;  3E1F 1;  1W3X A;  2A3Y A;  4FQ4 A;  5CFC B;  4RGK A;  4UWD A;  1EAH 1;  4MG2 A;  3THD A;  4JC1 A;  2XXZ A;  2G1M A;  2VC9 A;  4D6Q A;  3PUS A;  4MAD A;  3B02 A;  2DU1 A;  2RG4 A;  2YBS A;  1NXD 1;  2JDK A;  3DXT A;  4OFG A;  1ZBA 2;  3C7G A;  3IMM A;  3WG3 A;  4YFZ A;  1JZ8 A;  1I3H A;  2JIJ A;  4CP2 A;  3M3O A;  3IMN A;  3ZFF A;  3OUH A;  5FYH A;  2IWG B;  3HT2 A;  1XND A;  1BEV 2;  5JSR A;  5BY5 A;  2D97 A;  1CAX B;  5HV0 A;  2V73 A;  1CZV A;  2HWB 1;  4AGR A;  3WQ0 A;  5CKN A;  1HRV 1;  1XSQ A;  4WV8 A;  5IVY A;  4S2D A;  1LKN A;  5FY5 A;  3ZSK A;  1UY4 A;  4MGS A;  3W58 A;  2AGS A;  2A3X A;  4XJ8 A;  3ZPY A;  3WF3 A;  2VVE A;  1JHN A;  1HB2 A;  1EAH 3;  4N53 B;  3ZYG A;  4CDX B;  4Z8B A;  1F8V A;  2R07 3;  1QJX 1;  2ZGM A;  4XJU A;  1UU6 A;  2A6X A;  3MW2 A;  5JAX A;  5D8A B;  2C5D A;  1QJU 2;  4UFK A;  5IVC A;  4LE3 A;  1XU2 A;  2Y6G A;  4XFB A;  2QZ2 A;  2BWC A;  2IXH A;  5JIA A;  2CWS A;  3MO4 A;  4QT6 A;  4F83 A;  3ELN A;  2A73 B;  2ZXQ A;  4EZ4 A;  3BTA A;  1YLL A;  2CGP A;  4JGZ A;  1ULO A;  3OD4 A;  3ZSL A;  1JI6 A;  3MLK A;  4TYS A;  2J1R A;  4JZR A;  4YW2 A;  3NVC A;  4GQ7 A;  4NE9 A;  4CE8 A;  4XC9 A;  3SIS A;  1O6U A;  1HJG A;  4MVT A;  4X8P A;  1ZZ6 A;  4EN9 B;  3MI8 A;  3MUZ 1;  1ZVF A;  4XHB A;  2JKB A;  3VKN A;  2WZR 2;  2VUJ A;  1ZRF A;  2WA4 A;  1U5Y A;  4LO5 B;  3O14 A;  2MHF A;  1QJX 3;  1V9U 2;  3H0O A;  4FP3 A;  1OF3 A;  1LJ7 A;  5K0U C;  1Y7B A;  2CSG A;  4MYE A;  2HWE 3;  1LNS A;  1RUJ 1;  4XJA A;  1LES A;  4G4F A;  4CVU A;  1RUC 1;  3VDB A;  3CL1 A;  2K2S A;  1VAV A;  3OPZ A;  2JG8 A;  5FJK A;  4L92 A;  2ORZ A;  2ZX2 A;  1VBB 1;  3O0X A;  2VO5 A;  4GH4 C;  4RQP C;  4AFA A;  3JQX A;  4ES8 A;  1ZZ9 A;  4IEO A;  4PQ9 A;  4LXL A;  5JPN B;  2XUM A;  1BKZ A;  1VR3 A;  3T2O A;  1TE1 B;  2VZR A;  2XVL A;  4NRQ A;  2J1E A;  2JDU A;  2F6B A;  4NHY A;  3WP4 A;  4F7Z A;  3PHM A;  4A7K A;  5AFE A;  5LA0 A;  1UYP A;  1E5S A;  1NLR A;  3ES4 A;  4P02 B;  2TUN A;  1CJD A;  2CWM A;  3S5Q A;  3BUC A;  1UOB A;  1PK6 C;  2GNM A;  4J6G A;  2XBO 1;  2ZHK A;  2V72 A;  2Q1Z B;  4H2A A;  1ZX5 A;  4UYB A;  3TN9 1;  4XCA A;  5F32 A;  2Y60 A;  3OOX A;  4CDW A;  1NA1 B;  1QJY 3;  1ZRD A;  1BYH A;  2ZMN A;  4I09 A;  1OOP A;  5I0U A;  3C7O A;  2E7A A;  3JB4 C;  5JR7 B;  4DZG A;  5JOX A;  2NZ9 A;  3GM8 A;  4YVS B;  2Y33 A;  2VNG A;  4IV3 A;  2RJK A;  3E6D A;  3LB9 A;  2FMY A;  1NQJ A;  1WW4 A;  3I97 A;  4FOY A;  4HVQ A;  1CQ9 A;  3NRU A;  1E5R A;  5E16 A;  3AJY A;  3VDD C;  1DCS A;  3U78 A;  5CFD B;  3WCR A;  2OA2 A;  2HEW F;  4DUW A;  1W2T A;  5FZG A;  3S30 A;  3IM0 A;  3ZYJ B;  5FK7 A;  1C8M 1;  1RUI 1;  1MS8 A;  5IFT A;  4DOU A;  1OKQ A;  2OW4 A;  1GZ9 A;  3TN9 3;  3UES A;  4QKF A;  2C1F A;  2PQQ A;  2HEY F;  3CIH A;  3DEC A;  4JRA A;  2HKX A;  2GN3 A;  2RS3 2;  3MEP A;  1ZBE 1;  2RHP A;  1W9S A;  1GQH A;  1KEX A;  2YPD A;  4A42 A;  4XQW A;  1VP6 A;  4R9B A;  2WUH A;  3ZFF C;  5J3U A;  3KV5 A;  4YVW B;  2O0O A;  3WOG A;  1K45 A;  1ACC A;  2JKX A;  4HAN A;  4CCJ A;  3LIH A;  3O1O A;  2JG9 A;  3LA7 A;  4GMP 0;  5FMC A;  4IQP A;  1ZRE A;  1M4W A;  3LEG A;  5JDB A;  3ZFG A;  2DTW A;  4AWD A;  4IET A;  4XIK A;  1EYB A;  4YLZ A;  3OJB A;  4OUS A;  2PLV 2;  3ZYI B;  4AI9 A;  1T2X A;  4BPZ A;  5FPX A;  3DKW A;  1C8M 3;  3OGR A;  3FMG A;  3TBD A;  2EXJ A;  3AP4 A;  2Z79 A;  5DDJ 2;  4BMB A;  3ZO0 B;  1QOT A;  3DCQ A;  3UKN A;  3LA2 A;  3VBS A;  4IW3 A;  1KS5 A;  4E27 A;  2BBV A;  1FAT A;  2VZ1 A;  3POE A;  4E2Q A;  1HB1 A;  3MIE A;  3PIJ A;  3FL7 A;  2Y6J A;  4Q0U A;  2BDR A;  5A80 A;  4C90 A;  3MGU A;  4JGZ C;  5KXB A;  2IXJ A;  1KD7 A;  2E32 A;  2QDN A;  3GDB A;  4FQZ A;  3WX5 A;  5A3W A;  5DAB A;  1W9T A;  1AR6 1;  3ZVX A;  4DNY A;  2P4E A;  2WO3 A;  3LGR A;  1SFN A;  3IZO A;  4XF0 A;  1B35 A;  3V0A A;  3KB5 A;  4UF0 A;  3VZJ A;  1HLC A;  2P6C A;  2RDN A;  5H9P A;  3TOJ A;  2VMC A;  4Q8K A;  1W6M B;  1GNH A;  1CAW A;  2CL2 A;  3N7J A;  4LBQ A;  5FZF A;  3I2O A;  4CPB D;  4FXG B;  1EAH 2;  1AXZ A;  4KI5 M;  1CN1 A;  3Q8A A;  1UYX A;  2JD9 A;  2YC0 A;  1ENX A;  3TEW A;  1LOB A;  3APB A;  3I4I A;  1VIW B;  3NKG A;  4YW7 A;  3D4K A;  3S5A A;  2BGC A;  2JG8 C;  3OSD A;  4BQY A;  3LD8 A;  3E6B A;  2QUO A;  1W6O B;  2XJV A;  2ZGR A;  3S6P A;  2HWB 2;  4D3W A;  1QH7 A;  1XE7 A;  1HRV 2;  2FHR A;  1UX7 A;  4KH9 A;  1V6N A;  4HKL A;  5FZ3 A;  2Q1F A;  2D6O X;  4P08 A;  2GAU A;  2P5B A;  4LKE A;  3VLB B;  3ZYR A;  1LEC A;  2WFF 3;  3GZE A;  3AL5 A;  1R64 A;  2ZZQ A;  1WLW A;  3OGV A;  3PDQ A;  4E4D X;  3A7Q A;  3BN6 A;  4QQO A;  4XUR A;  5LBC A;  2G4I A;  2DYC A;  4O9E A;  5FKC A;  5FZE A;  2VZU A;  1O3Q A;  4QKD A;  2D40 A;  2ET7 A;  4CDW C;  3VDA A;  3H8R A;  2YMZ A;  1RB8 G;  3WNK A;  2FDK A;  4I2O A;  1SQ4 A;  2EAA A;  1KQR A;  4CU7 A;  4BXF A;  4YG3 A;  1HV1 A;  2K0G A;  2X29 A;  3CEW A;  3OUJ A;  1OFS A;  1NZC A;  1VBD 3;  4IV3 C;  4PI2 A;  4OMC A;  4UOJ A;  2XH6 A;  3BOP A;  3RMY A;  3UET A;  5L36 A;  3MFC A;  4JKM A;  1GIC A;  5IHR A;  4GB3 3;  3UGF A;  4PDW B;  1HXS 3;  2C9A A;  3A23 A;  1WCS A;  2AZ5 A;  3OGG A;  1JW6 A;  4MX3 A;  5A3N A;  4LHN A;  3VGI A;  2RM2 1;  2BGP A;  1CX4 A;  1MS5 A;  4N43 B;  1IPJ A;  4V2V A;  1X50 A;  2YBP A;  3VBR B;  3WHU A;  4EWE A;  4OI0 A;  1XE0 A;  1WA4 A;  4PQQ A;  3TAY A;  2WNV A;  1ENQ A;  4NIH A;  3AL6 A;  1PZ9 A;  2VNO A;  1RUJ 2;  4Q1R A;  4QXB A;  2ZHN A;  3CJI A;  1NLQ A;  2JEM A;  2VAU A;  2NM1 A;  1RUC 2;  1WKY A;  2AUY A;  4QKB A;  3AMP A;  4Y33 A;  1COV 1;  5BNO B;  4Y5Z 0;  1RIN A;  2PAM A;  4QKN A;  1ZM1 A;  1SEF A;  4HVO A;  5FY0 A;  5T50 A;  1REF A;  2QQV A;  2EAK A;  2XG3 A;  4BIO A;  1YWK A;  4IER A;  1VBB 2;  2JG9 C;  1U5X A;  1O4Z A;  4FFI A;  1GUI A;  3MIG A;  3HVD A;  2IFR A;  4EQV A;  1KGY A;  3J8F 1;  1H2K A;  3ZFG C;  1KDK A;  3R4D B;  1A3K A;  1UXX X;  1AX1 A;  4DXZ A;  1GZC A;  3FC0 A;  2WNU B;  4QXK A;  4LO7 A;  1GZW A;  4YSF A;  1RUE 1;  1UKR A;  1XYN A;  2VEC A;  4E4S A;  1D4M 3;  1VBE 1;  3SC7 X;  4BU2 A;  3I49 A;  5LCW L;  3WNO A;  1O4T A;  4GJY A;  2XBO 2;  2VOX A;  1LHV A;  4W6Y A;  5FXV A;  1UWW A;  3VBS C;  2GSY A;  2OQ6 A;  5A1A A;  1DHK B;  4Q4Y 3;  2DU0 A;  5LW9 A;  3TN9 2;  2XJP A;  2UWB A;  2BZD A;  3U11 A;  1FMD 1;  4MGK E;  2ADE A;  2R04 1;  2R7E B;  4L0P A;  4P9G A;  1IPS A;  1O8S A;  1W2U A;  4BLI A;  5IVV A;  2AEZ A;  5FP7 A;  3WLU A;  1DGR N;  1FI2 A;  3GJB A;  4IEQ A;  3NV1 A;  4YZ3 A;  1IG0 A;  4DY5 A;  4OHZ A;  4P9X A;  4TLF A;  3BGA A;  5DUU A;  5JUV A;  3O12 A;  4P9W A;  3LQC A;  1IG3 A;  3MIF A;  3RGB A;  3RZK A;  1RUE 3;  5FPA A;  5HV4 A;  2HBU A;  2JDP A;  4LKD A;  5FZB A;  2X05 A;  1RJ8 A;  1VBE 3;  4OMD A;  3ZIW A;  2FDI A;  5JXG A;  1YI9 A;  4K8R B;  4Y22 A;  1RYY A;  1C8M 2;  1RUI 2;  5FBJ A;  1QOO A;  1QJF A;  3ZXF A;  4DB5 A;  2E7T A;  3BU0 A;  1JZ3 A;  3AKR A;  4JQR A;  2EID A;  4PIZ A;  5GM0 A;  4WVM A;  5FRA A;  3W9A A;  2W1W A;  1Y9G A;  2VR4 A;  4W6X A;  1BVV A;  1W9Y A;  1ZBE 2;  1SPP A;  2R04 3;  3NAP A;  1GOH A;  4HXC A;  3SXW A;  2DVD A;  3JB8 A;  3III A;  3WF4 A;  3KCX A;  3WUD A;  4FAG A;  1JU4 A;  3C7H A;  2C24 A;  2BNN A;  1RUG 2;  2XJS A;  1IS4 A;  3HWJ A;  5KC6 A;  1ZZ8 A;  4XFH A;  4AVB A;  2C6S A;  4RR3 A;  1XC6 A;  4XBL A;  3ZX7 A;  2MEV 3;  1OHF A;  3D6E A;  1L7L A;  2XLG A;  5HBA A;  5HXM A;  2WO7 A;  3ILR A;  3T1L A;  2BER A;  1S2E A;  3JD7 1;  3LKJ A;  4CUA A;  2VCC A;  3H8U A;  2PHL A;  5FZO B;  3NKT A;  1WCK A;  1OSG A;  1WWY A;  4K40 A;  2QTW B;  1OLR A;  2J1S A;  5DXD A;  4QMA A;  2ZAH A;  2FBE A;  4NIG A;  4QX0 A;  3H3U A;  2RDR A;  1NCR C;  3AKT A;  1KS4 A;  1F5F A;  5CIR A;  2R32 A;  3BOD A;  3VHR A;  2VL4 A;  5LY1 A;  1VRH 1;  1BHG A;  2XGX A;  4GKX A;  4ZS3 A;  3OYW B;  4XUP A;  5LWB A;  2A7A A;  2NMN A;  1JBC A;  3RZG A;  2FDH A;  4Z82 A;  3P5B A;  1ND2 C;  5GLU A;  2ZEZ A;  1VB2 A;  2UY8 A;  3LWC A;  4PIY A;  3TB0 A;  3N9Q A;  2V5Y A;  5FOB B;  2EIE A;  2BPA 2;  3MIC A;  3WDV A;  5GZD A;  2G9F A;  1ALY A;  4QHB A;  5I0T A;  3I2G A;  5FYV A;  3H3Z A;  4CCD A;  1AR6 2;  3W59 A;  4QPG A;  3FBY A;  3JD7 3;  3MV1 1;  2QQP A;  3LEK A;  3ROU A;  1JHJ A;  3OTF A;  1RL3 A;  3GHN A;  4PJY A;  1FX5 A;  4EYU A;  2GU9 A;  1LOD A;  2ATF A;  2WAB A;  5IUQ A;  1ODN A;  5L7O A;  2LM3 A;  4JHT A;  4GKY A;  4WM7 A;  2ES3 A;  2WNV C;  1JYT A;  3AZZ A;  4OUE A;  3GCX A;  2BVB A;  1US2 A;  3N4M A;  1UY1 A;  1GNY A;  3CJI C;  4B4R A;  4GA9 A;  5F3G A;  2LUW A;  3WF2 A;  2EA7 A;  1ZYB A;  2WO1 A;  4IE4 A;  2QQM A;  3TYJ A;  1ULF A;  2QQL A;  3SCG A;  1NX9 A;  1WA6 X;  2E53 A;  4FFF A;  5CKM A;  5EWS A;  2H0V A;  4GMP 1;  5C4W A;  3I2J A;  4XE9 A;  5GJ6 A;  5AC9 2;  5LRS A;  2ET1 A;  4PIX A;  3DL3 A;  3B5L B;  4XPV A;  5LK7 B;  1UOG A;  1M06 G;  1RMU 2;  2C4X A;  2Z4F A;  1RXG A;  3AC0 A;  3NJY A;  5IAT A;  2BUK A;  4ARX A;  5JMO A;  4LKS A;  2ARC A;  2DDU A;  4NR1 A;  3WIN E;  5EJ1 B;  5C9A B;  3OY8 A;  5A6Q A;  1QJE A;  2QE3 A;  4Q4X 1;  1S4C A;  1AYN 1;  3EXU A;  2AR6 A;  4QPI B;  3IIA A;  4BB3 A;  4D69 A;  3POW A;  2ZMK A;  2X5I C;  3H7Y A;  4FO9 A;  2ZEW A;  3R6S A;  4AGG A;  3R4U A;  2BYV E;  4FPF A;  2W91 A;  4D0Q A;  1SMV A;  4BIS A;  1MAC A;  5FYU A;  4Q0S A;  3H9A A;  2A70 A;  3SIT A;  3MIH A;  5A7P A;  3VBU B;  3CLP A;  1LHN A;  1OH4 A;  3T2P A;  5BNQ A;  3RSJ A;  4UT5 A;  1QQP 1;  1UY3 A;  2W39 A;  3G6J B;  2Z2S B;  4ISR A;  2DCK A;  4CXX A;  4QU1 A;  4RSU A;  4BQ1 A;  1JYW A;  2R30 A;  5ACA 1;  4KG0 A;  1QHD A;  1HQL A;  1CES A;  3I54 A;  1YNA A;  2ZAB A;  3KGL A;  4XW3 A;  1BEV 3;  5LRR A;  5ABJ A;  2RM2 2;  3ORJ A;  3LEM A;  4B7E A;  3U75 A;  2ZHM A;  1CON A;  4K6B A;  2B9V A;  2KXL A;  5C5T A;  1S1A A;  1I9R A;  1LRH A;  3F2Z A;  1CAV A;  3OD0 A;  4LPL A;  5JLV A;  1DP0 A;  3NAP C;  2WR9 A;  1SDW A;  3H7J A;  5I93 A;  5LA1 A;  1EV1 1;  1COV 2;  1H2M A;  3AKS A;  4LKF A;  2Y34 A;  3M3Q A;  1X8E A;  4XF3 A;  1OT5 A;  3NQH A;  4MOA A;  4RR3 C;  2B8M A;  4QX8 A;  4ORF A;  3BKZ A;  4QB1 A;  2YFU A;  4Z2A A;  3MID A;  5FYB A;  1QJU 3;  3ZDV A;  3J8F 2;  4GAL A;  3A22 A;  3EYP A;  2D7F A;  5ACA 3;  5F9T A;  3H1M A;  3FLT A;  5FYM A;  1HRI 1;  1LHO A;  4DRV A;  2ZX3 A;  5EZW A;  4AEJ A;  1LOE A;  3LEI A;  4OZO A;  3MPP G;  1X8M A;  2LTN A;  4LHS A;  1RUE 2;  1OQ1 A;  4NUB A;  5KHG A;  1N3Q A;  2X53 S;  3BPS A;  3EO6 A;  4Y20 B;  2GN7 A;  2D44 A;  1YQ2 A;  2J1U A;  3U07 A;  1S0B A;  1I1E A;  5ISL A;  2J1A A;  5JXI A;  1R08 1;  3NST A;  4L9B A;  5EPA A;  4MSV A;  4A45 A;  4Q8L A;  1UIJ A;  1JZ6 A;  2C9K A;  2V4V A;  3ZYH A;  4RFT 0;  4URA A;  1JOJ A;  3WNP A;  3J26 N;  3J4U H;  1WMX A;  1FMD 2;  1JS9 A;  2A71 A;  4RA0 A;  4YM1 A;  3VZN A;  2R04 2;  3RZM A;  2CNA A;  4AVT A;  2WQ8 A;  3WW2 A;  5A1L A;  1V9U 3;  1QDC A;  3BI3 A;  2BJS A;  3N9O A;  4NWW A;  1W2N A;  3BYW A;  2A3W A;  1EPW A;  4CCK A;  4Z2W A;  1W06 A;  1CPN A;  1HRI 3;  4QPG C;  5FPU A;  2BV4 A;  2PTM A;  3ST7 A;  1V6O A;  4PHZ A;  2UWC A;  4BK5 A;  3DV8 A;  4KQ7 A;  1AXY A;  3TRS B;  4EJR A;  2YC4 A;  2VW0 A;  4JKL A;  1LU2 A;  1PMI A;  3FFZ A;  3AKP A;  3VBO A;  1GMM A;  2KM2 A;  2Q30 A;  2Z42 A;  3KV6 A;  4IE0 A;  5L7O C;  3OGJ A;  4KBB A;  3POS A;  1QU0 A;  4COY A;  1IKQ A;  4H7M A;  1CAU A;  2WZE A;  2XLF A;  4ONU A;  1H4G A;  2IXI A;  1WMD A;  1UQX A;  2GNB A;  2VOV A;  4QX3 A;  5LY2 A;  3SCH A;  1W39 A;  2BFU S;  2EIG A;  3OEA A;  3HEI A;  1PVC 1;  3ZLI A;  2R16 A;  3VZK A;  3J7H A;  4AI3 A;  4XFG A;  4KMQ A;  4W50 A;  4PF1 A;  1E5I A;  1N1T A;  1A34 A;  3WNM A;  3ZKU A;  3ZN6 B;  5T5O A;  5C4W C;  3LOB A;  1YQC A;  4BQW A;  2RS3 1;  3IAQ A;  4R9A A;  4B3N A;  2VW1 A;  2A1X A;  2DV9 A;  1TME 2;  2CAU A;  2WKK A;  5IVF A;  1O8P A;  3KQR A;  4KU7 A;  4QXH A;  4I01 A;  2QQJ A;  2OUH A;  4CCN A;  4XBQ A;  3AYE A;  2ZGO A;  3VB9 A;  4KNC A;  1AF9 A;  1SZB A;  3LF7 A;  5KR7 A;  1ULC A;  3IDA A;  2A6W A;  2BRT A;  2YBK A;  1Z0H A;  5E6H A;  4MHR A;  3AMM A;  1PVC 3;  3B3Q E;  2ADD A;  2W46 A;  2PLV 1;  2WWJ A;  4AFM A;  1VRH 2;  2E9Q A;  5A3M A;  5IVE A;  4YM2 A;  1WW6 A;  1O4Y A;  5KXE A;  3DPR A;  3O0V A;  1X7N A;  5A6X A;  4LIT A;  2VZV A;  4QD2 A;  3WY6 A;  3I59 A;  3ITQ A;  4Y1V A;  2E26 A;  1K42 A;  3PNA A;  2RS3 3;  3VUO A;  2GMM A;  5FO8 B;  4E9K A;  4HMZ A;  4OUM A;  5FMB A;  3QCW A;  2TEP A;  3SEE A;  1GLH A;  2H6C A;  4XAA A;  5ABJ C;  2X09 A;  3ALQ A;  4L8Q A;  3OB8 A;  3KV4 A;  3AVS A;  1H8T B;  4DMI A;  5EP9 A;  1MS1 A;  3I8T A;  1GU3 A;  1XNB A;  3MUY 1;  4LO8 A;  2PHX A;  2ZGT A;  1H6X A;  3T2T A;  5FQ0 B;  5FFO C;  2VUD A;  4TXW A;  3VBF A;  2P1B A;  3JQW A;  5FZK A;  2JE7 A;  3IN9 A;  2PLV 3;  3O7O A;  4XOG A;  4CP9 B;  2N7G A;  3ZXJ A;  3UJO A;  3SCF A;  3M2M A;  2AC1 A;  3QLQ A;  5F7U A;  1LB2 A;  1OBN A;  1GKB A;  2WIN B;  4LLO A;  1WBF A;  2ZX0 A;  3IPV B;  3PUR A;  4QQP A;  5DDJ 3;  4OQ9 A;  2IXL A;  2VUA A;  3D8C A;  4BQX A;  2CGN A;  5BNP C;  4AF9 A;  2YC2 A;  4FCA A;  4RN5 A;  3SHR A;  3SQO A;  2WL1 A;  1J84 A;  4JDN A;  4RYD A;  3SKV A;  5C71 A;  3AFG A;  2XDV A;  4QX2 A;  2O1Q A;  2JD4 A;  4MGZ E;  1N3O A;  1C57 A;  1PO1 1;  1TNR A;  3FLP A;  3FUO A;  3WQ1 A;  1HB3 A;  4BJ0 A;  1RC6 A;  1CGP A;  1V6I A;  2VVD A;  1H1A A;  2XWJ B;  4RS5 B;  4WM8 B;  2FCU A;  1SAC A;  4FPO B;  3JXS A;  2O8Q A;  5DN2 A;  1SFY A;  2VVF A;  3KD4 A;  3K4Z A;  4I0B A;  5F6K A;  3V56 A;  1AL2 1;  3U0Z A;  3V0B B;  1DGL A;  4FBF A;  4Q4X 2;  2WII B;  1AYN 2;  5LAS A;  4CEW A;  2WRA A;  4UFI A;  2VCM A;  4COZ A;  2Q8O A;  1AVB A;  4XUQ A;  4C8D A;  1OPO A;  3A4U A;  1UO9 A;  2G19 A;  3RJR A;  5A1F A;  1G7Y A;  1K5M B;  1MS3 A;  3D0J A;  5IK8 A;  1NCQ B;  1XU1 A;  1D0H A;  5FPV A;  1Y3T A;  3IWZ A;  4S2F A;  4AXO A;  5A33 B;  1NLS A;  4LTA A;  1QQP 2;  1YHF A;  3L2Y A;  4DIQ A;  4B29 A;  2VBB A;  2JJ6 A;  4ISQ A;  1PO1 3;  5ACA 2;  2W94 A;  4IUG A;  5C3O A;  2PHR A;  2BP6 A;  2PEL A;  1Q3E A;  5FP4 A;  1MVQ A;  3VBO C;  4YW4 A;  2HWB 3;  1QEX A;  1HRV 3;  1S0E A;  5FDB A;  1NCR B;  1OMI A;  2XPJ A;  1IZ3 A;  1O3R A;  4BQ3 A;  1ODM A;  2JIG A;  3HD8 B;  5JCT A;  1DBN A;  2E33 A;  1BLZ A;  1JUI A;  1WLD A;  2R6Q A;  4ZZ8 A;  5C7G A;  3ZFE C;  3NJV A;  1UZ0 A;  1EV1 2;  1D4V B;  1OQE A;  3CMG A;  5EXO A;  2ZHL A;  1ND2 B;  1UIK A;  1YFX A;  3QH6 A;  1SLI A;  4LO6 B;  5DAP A;  4BOW A;  4XZP A;  2GP5 A;  3LDB A;  3SNM A;  4K20 A;  5F37 A;  1ZRC A;  3HMY A;  4DO0 A;  4FXK B;  4HN0 A;  4L97 A;  4XEZ A;  5IJR A;  1JZ2 A;  2RS5 1;  2DVG A;  1UZZ A;  1RUO A;  2PHF A;  2E63 A;  3WR0 A;  5FZA A;  1HRI 2;  3MZH A;  1VBA 1;  3WVJ A;  4G9S B;  2D5F A;  3VBH A;  2OXB A;  4O61 A;  2Y0I A;  1UZV A;  3FLR A;  4RGG A;  4NHX A;  5FV3 A;  4LO4 B;  3THC A;  4YG0 A;  1E57 A;  5FYT A;  1R08 2;  5G05 L;  1DYP A;  4Y1X A;  1WCQ A;  4XIL A;  4CEY A;  2VOK A;  5DUW A;  2VZO A;  3VL8 A;  4BIF A;  1IS3 A;  3HAG A;  4XJZ A;  2OT7 A;  2IUW A;  3LPG A;  5FKB A;  4YZ5 A;  1BK1 A;  2JB4 A;  2Q5T A;  2ZPX A;  3GHM A;  4XTM A;  2WN3 A;  3RZZ A;  1W6P B;  3DPR C;  1GP4 A;  1A78 A;  4B4P A;  5DAQ A;  1TVG A;  4CU6 A;  2ARB A;  4Q2F A;  2BOJ A;  2IC1 A;  2RS5 3;  4MZU A;  1RUJ 3;  4Q1P A;  1KFX L;  4AHW A;  4ATF A;  5JWP A;  1G9B A;  2LRP A;  3H42 B;  2VZ3 A;  1RUC 3;  2GZW A;  1OLM E;  1W0P A;  2GH2 A;  4AI8 A;  1ST8 A;  2JE9 A;  4MV2 A;  3HNB M;  4HKO A;  3ILF A;  4Q0Q A;  2BW8 A;  1BVP 1;  4FVV A;  4LK7 A;  1CZS A;  4SLI A;  1GSL A;  3MW4 A;  5AFB A;  2YGM A;  4COV A;  4AI1 A;  1VBB 3;  4L99 A;  4XBN A;  1T6B X;  3N9N A;  5DZF A;  2WQZ C;  5A7W B;  5FP3 A;  3WEZ A;  2LW8 A;  4P00 B;  3ZDS A;  4CDU C;  2FMD A;  1J83 A;  5D2A A;  3RWN A;  3EBR A;  3VBF C;  3BOW A;  4JAA A;  5CNA A;  2VJX A;  4NII A;  2X5I B;  3IB3 A;  2GDF A;  1H9P A;  2Y8K A;  5A3L A;  3DEM A;  1PVC 2;  3AMN A;  1W9W A;  3CU7 A;  4M3C B;  2W47 A;  3NL1 A;  3SEP A;  4AI2 A;  4CDQ A;  4D8M A;  2XBO 3;  3WW4 A;  1LHW A;  2J7M A;  3PTY A;  1WBL A;  5BNN A;  1MQT A;  5EQU A;  5JI7 A;  5FY7 A;  3DGT A;  4M3C E;  2RMU 1;  2GND A;  3K3N A;  5EJZ B;  1NYW A;  2LRO A;  1VLN A;  4IV1 A;  3BCW A;  3HIF A;  4CCC A;  3RI9 A;  1LEM A;  1RUG 1;  2ZGN A;  2BOI A;  2F17 A;  5A7Q A;  3ZMN A;  4AED A;  1OD3 A;  3HQX A;  3ZSM A;  1XXN A;  3LSD A;  4QX5 A;  3WCS A;  4YW1 A;  1FNZ A;  2ARX A;  1CWP A;  1MZF A;  4C91 A;  2QQU A;  4CEW C;  1HW5 A;  4XMI A;  2WWS A;  1O91 A;  5KHI A;  5C8C A;  2HLE A;  4LHL A;  4ARY A;  1WUV A;  3RQ0 A;  1OXC A;  4BHP A;  1RUI 3;  4XDP A;  3WUC A;  4BQ5 A;  5GZG A;  1H30 A;  1VAM A;  4LOR A;  3S0M A;  4HON A;  2V5D A;  1G9F A;  1QMJ A;  1ZBE 3;  3ZXA C;  1F2N A;  3UL2 A;  4LUL A;  1C4R A;  1H1M A;  2A5Z A;  5JVV A;  5JZG A;  4XVH A;  2TNF A;  4XJ9 A;  1RUG 3;  2XOM A;  1LEN A;  2WLP A;  5H9Q A;  2ZEY A;  2JDH A;  1PGL 2;  5CAZ A;  1FV3 A;  4DY3 A;  2OZJ A;  1HN0 A;  3M3E A;  3T4V A;  1MS0 A;  5F5Q A;  5FLH A;  5FZI A;  3RVH A;  2XML A;  1W0N A;  5GZC A;  5IVJ A;  4IEU A;  5KHK A;  2XHN A;  4JGY A;  3INA A;  5L73 A;  4CCM A;  5C3R A;  2WS9 1;  1W8O A;  5EFU A;  4EWA A;  1U5I A;  2JB8 A;  4FPG A;  2QVS B;  1L7Q A;  4AOC A;  1CPM A;  1W6N A;  5LZ6 A;  1WW7 A;  3T1M A;  5H9S A;  5FYY A;  2B5H A;  2HBT A;  4IE7 A;  3H8X A;  3B9I A;  3OCP A;  5CG9 A;  1W8F A;  2SLI A;  3TWI A;  1AJO A;  5FZ9 A;  3I2F A;  1HQW A;  1LED A;  3NNM A;  1CJP A;  2ZX4 A;  1RED A;  3SH5 A;  2VY0 A;  1AUY A;  4E2S A;  3POG A;  3O1M A;  3KCY A;  5CFC A;  2ZTN A;  3CHX A;  5FZ8 A;  4R9D A;  1PO1 2;  3CQO A;  1RUH 2;  2B45 X;  3VBH C;  4F8A A;  3BIW E;  5F2S A;  4M00 A;  3PU3 A;  5LK5 A;  3LA3 A;  5L19 A;  4C1W A;  2IZW A;  5TSW A;  4KWU A;  4CPB A;  5JSO A;  1AL2 2;  1AR6 3;  4CEY C;  3S57 A;  2JDY A;  3A0K A;  4B1L A;  5AC9 1;  4MGI E;  2W9X A;  1IHM A;  1G9D A;  1LAJ A;  2VBP A;  4UFL A;  3QH7 A;  2OZ6 A;  1J3R A;  1RMU 1;  2PMW B;  4NVP A;  4IEV A;  1UU4 A;  4XAE A;  4OHY A;  2WZP P;  1DQ5 A;  1CAX A;  1RTV A;  2D6M A;  1JN2 P;  2HYX A;  2R06 1;  3QOP A;  4NAO A;  2WSU A;  3ZOI A;  5IVB A;  4K7J A;  3LDK A;  2W52 A;  5DZE A;  4BME A;  1PGW 1;  3FN9 A;  3RDI A;  2RVA A;  3WG1 A;  4FTS A;  1RUD 1;  1FXZ A;  1AR8 1;  1K5M A;  1ND3 B;  2B7Y A;  1DQ4 A;  4N53 A;  3J7M A;  5L9R A;  1S0C A;  4CDX A;  1CX1 A;  1OOP C;  2I2S A;  3KHB A;  3VL9 A;  4IEZ A;  1NOV A;  3HQU A;  4UI9 L;  3ATG A;  2NN8 A;  5D8A A;  2UUR A;  1KRI A;  4BXS V;  1W6Q B;  1DDL A;  5AC9 3;  2UYB A;  5L9B A;  4CA9 A;  4MO3 M;  4TN7 A;  4LK6 A;  3AZY A;  2WDB A;  1RMU 3;  4AAX A;  3LOI A;  2D6N A;  1NZI A;  5E8A A;  1K12 A;  1HIX A;  3LFI A;  1JH5 A;  1UU5 A;  2C0Z A;  2R06 3;  3H1W A;  3GGL A;  4AQT A;  1MPX A;  1J1L A;  1SDD B;  4CDQ C;  1FYU A;  4PI0 A;  4FAH A;  3WSO A;  3W5N A;  1UNB A;  1SLC A;  1GR3 A;  2QCS B;  4ZXK A;  1SCS A;  5D21 A;  2W68 A;  5LA2 A;  4HPK B;  3LE0 A;  4X8N A;  4PLO A;  2WSV A;  2VOW A;  2RS5 2;  5BNN C;  1MQT C;  2J22 A;  4B1M A;  2YUE A;  1UY0 A;  1DGW A;  1XNC A;  2RDQ A;  3FFQ A;  1VBA 2;  4QHO A;  3K2O A;  2XUE A;  2RR1 1;  3ZYF A;  2ZCW A;  3VDC A;  4AED C;  5C3Q A;  4YW3 A;  3Q8E A;  3VD9 A;  1XRU A;  5I8Y A;  3D5O A;  1NT0 A;  3TEZ A;  4IES A;  1ASJ 1;  4NHL A;  4OVE A;  5C8C C;  3J7L A;  2NQY A;  5ERL A;  2ZML A;  1N1V A;  1RIR A;  1XBF A;  1YUD A;  2HJI A;  4RFR B;  2RM2 3;  3ACL A;  3N9P A;  2QQI A;  5LB6 A;  1J3P A;  4H7L A;  3SH3 A;  1CD3 G;  2JDN A;  4V1P A;  5A3T A;  5BNP B;  3KT7 A;  1XJA A;  2Q0A A;  3D3A A;  2RJ2 A;  1UL9 A;  2F4P A;  3HBZ A;  4FPH A;  1P8J A;  1R1Z A;  1LGN A;  2VMI A;  1DU3 D;  1OLM A;  4Q27 A;  3ZR5 A;  4XCB A;  1XSR A;  3KCC A;  2W1U A;  2NPI A;  5JZG C;  1COV 3;  1XYP A;  3JZV A;  1W9F A;  5FP9 A;  1QXP A;  2RR1 3;  4QX1 A;  1XYO A;  4OHX A;  3K48 A;  4Q4V 1;  2YY1 A;  4QDR A;  5KBF A;  3UGG A;  1S0J A;  4EN6 B;  4DUV A;  2B4K A;  1FPN 1;  3PUA A;  3M4F A;  1YIF A;  2Q8D A;  1G8W A;  3DKQ A;  2MPF A;  1NA1 A;  3NO8 A;  3BTZ A;  4KGQ A;  3J8F 3;  4JGY C;  3GAL A;  2ZEX A;  1ZZ7 A;  2AEN A;  4GXL A;  4NHK A;  5FMD A;  5JR2 A;  1B35 C;  1YXW A;  1J3Q A;  3CF6 E;  1MR5 A;  4YVS A;  3NMB A;  4BQ4 A;  2NLR A;  4HSL A;  2EF6 A;  3E5Q A;  4D6S A;  1Z78 A;  4UFH A;  3T0B A;  1ZRI A;  1V70 A;  5DUV A;  4CUG A;  3FE5 A;  1VJ2 A;  2GC1 A;  5CFD A;  4D94 A;  2W87 A;  4P14 A;  5FK8 A;  3ZSJ A;  5CFC C;  1FMD 3;  4YGC A;  5HPO A;  2RMU 2;  4ZU5 A;  2P6H A;  3WNN A;  2OPK A;  1D2S A;  4RHV 1;  3LCP A;  4C0B A;  5CIS A;  1FPN 3;  3USU B;  1JMU B;  3K75 B;  4ZON A;  4A41 A;  1IOA A;  1GAN A;  3O1V A;  2JIC A;  4HVR A;  4H3W A;  3THP A;  2AEY A;  2E31 A;  3RS6 A;  3N7L A;  3NV4 A;  4AVA A;  4YVW A;  2PHD A;  1DZQ A;  1TNF A;  2VZT A;  3AFK A;  1TME 1;  2HEV F;  5DUX A;  3VKO A;  1YQ8 A;  4GWM A;  5T55 A;  2VH9 A;  1WZX A;  2L9L A;  3B01 A;  5K0U B;  2RS1 1;  3OUI A;  5T54 A;  4Y1U A;  3QD6 A;  3RYR A;  4OQ8 A;  5GZF A;  3KS7 A;  2YXS A;  3O1R A;  4CDX C;  1LOG A;  4JRL A;  1UMZ A;  4ZU7 A;  2DVA A;  5BYN A;  3KHC A;  3DN7 A;  3T0A A;  3NNF A;  3ZM8 A;  2EXK A;  1BJQ A;  3MBW A;  5D8A C;  4GH4 B;  4RQP B;  1EP0 A;  1O3S A;  4AVS A;  1Y9Q A;  5FY4 A;  1DYO A;  4KG8 A;  4OYU A;  5FZ1 A;  1QF3 A;  3H50 A;  1X9P A;  4GWI A;  4AQS A;  2WYS A;  3PVO A;  1UZW A;  5I8S A;  1GP5 A;  2WS9 2;  1DGR A;  2QBX A;  4LBN A;  3KM5 A;  5LEK A;  1QNY A;  1TME 3;  2CV6 A;  5AVA A;  3U4S A;  1I6X A;  5LA9 A;  1PK6 B;  4FOQ A;  1CVN A;  1N1Y A;  2VCA A;  4MXV A;  4LUK A;  4XUN A;  4LOT A;  1PMH X;  4DUX A;  4XFA A;  2AYH A;  5J1X A;  1PX3 A;  1Q8V A;  1Q43 A;  2UYA A;  3VHO A;  4ZXE A;  5C6C A;  1G9A A;  3AXE A;  1H1I A;  1KIT A;  2QKD A;  3FWE A;  2A6V A;  1W6M A;  4BCU A;  4AHX A;  3ZR6 A;  4MXW B;  2W95 A;  2XKP A;  1VRH 3;  4W6W A;  1TMF 1;  2DCJ A;  4P9I A;  5KWR A;  1AR9 1;  4SBV A;  3MW3 A;  3LPF A; 
#chains in the Genus database with same CATH homology
 3HN3 A;  1O8P A;  3PUH A;  2QQJ A;  3T2Q A;  4P02 B;  4QPW A;  1GOF A;  2W3J A;  3IDA A;  3WF1 A;  4QB6 A;  4DXS A;  2VMF A;  2V72 A;  2W46 A;  4GWJ A;  3C7O A;  3P1I A;  3PUI A;  2VZV A;  3GM8 A;  2E26 A;  4A44 A;  1K42 A;  3HOB A;  3I97 A;  3K77 A;  3SEE A;  5IFP A;  3NRU A;  4AG4 A;  2JDA A;  2X09 A;  2J1T A;  4DUW A;  3OB8 A;  5B4X A;  2J1V A;  2YG0 A;  1F4H A;  1GU3 A;  1K3I A;  5IFT A;  3MUY 1;  1JYX A;  1H6X A;  3C8X A;  1EUT A;  3WNL A;  4TXW A;  2WBK A;  3UES A;  1ULP A;  3CIH A;  3DEC A;  3T09 A;  3DYO A;  1NKG A;  1NAE A;  1KEX A;  1W9S A;  5F7U A;  4A42 A;  2WUH A;  1GQP A;  1K45 A;  1SHW B;  2JKX A;  2YC2 A;  4RN5 A;  1J84 A;  4RYD A;  3SKV A;  5C71 A;  3LEG A;  4QX2 A;  4CU9 A;  3EB7 A;  4BJ0 A;  1T2X A;  3ACI A;  5DQ0 A;  3OGR A;  5DN2 A;  3JXS A;  3K4Z A;  2LS6 A;  2VZ1 A;  4XUQ A;  5EIY B;  2CDO A;  3FL7 A;  2Y6J A;  3K4D A;  3K4A A;  3U37 A;  1US3 A;  3GDB A;  2E32 A;  3I2I A;  1W9T A;  2WO3 A;  1F4A A;  2W94 A;  4IUG A;  3UNP A;  2W92 A;  4CUB A;  2VMC A;  3I2K A;  3WQB A;  4KI5 M;  3SKJ E;  4QDQ A;  1UYX A;  2JD9 A;  4TTG A;  2E33 A;  5C7G A;  4ZZ8 A;  2YB7 A;  3NJV A;  1UZ0 A;  3ACG A;  3CMG A;  3MV0 1;  1JU3 A;  2WAO A;  2Y64 A;  3W5M A;  4QDS A;  5B4N A;  1JZ2 A;  5IJR A;  2KD7 A;  1UX7 A;  4A3Z A;  4UAP A;  3ETP A;  2EIB A;  4P08 A;  2WN2 A;  3OGV A;  1R64 A;  1DLC A;  3THC A;  1SG3 A;  3A7Q A;  1UXZ A;  5G05 L;  3BN6 A;  4JHZ A;  4XUR A;  1WCQ A;  1XNA A;  2ID4 A;  2VZU A;  2VZO A;  3VDA A;  3LPG A;  4DEV A;  3WNK A;  2WN3 A;  2QQN A;  4CU7 A;  4CU6 A;  1TVG A;  1XNT A;  3DYP A;  3HNM A;  5FUI A;  4OMC A;  4UOJ A;  3UET A;  2VZ3 A;  4JKM A;  1JZ5 A;  2Y6K A;  3K46 A;  4MGQ A;  5IHR A;  3HNB M;  2VM9 A;  4YPJ A;  1CZS A;  3ABZ A;  3A23 A;  4D8M A;  2BGP A;  3WEZ A;  2VQT A;  2YFZ A;  2LW8 A;  4P00 B;  1J83 A;  4PQQ A;  2VZQ A;  2VJX A;  4ZZ5 A;  2VCB A;  3IB3 A;  2W5F A;  1WKY A;  4M4P A;  2Y8K A;  1W9W A;  4PT6 A;  2W47 A;  3SEP A;  2BBA A;  2J7M A;  4W8J A;  4DEQ A;  1I5P A;  4XUO A;  1GUI A;  5DMY A;  1NUK A;  1KGY A;  1UXX X;  5EJZ B;  3GXU A;  4QB2 A;  1OD3 A;  5IYY A;  1UYZ A;  5LCW L;  3WNO A;  1UWW A;  1CZT A;  5A1A A;  2QQO A;  4XZU G;  1OF4 A;  3CDZ B;  2HLE A;  4ARY A;  2BZD A;  5C70 A;  2X10 A;  2R7E B;  4L0P A;  1O8S A;  2VME A;  1TG7 A;  1IQD C;  2V5D A;  1HN1 A;  3BGA A;  3CZJ A;  3NJX A;  5JUV A;  4XVH A;  3LQC A;  2XOM A;  2ZEY A;  2X05 A;  4OMD A;  1D7P M;  5JXG A;  2Y6L A;  1RYY A;  1JZ4 A;  1W0N A;  3OGS A;  1JZ3 A;  2XHN A;  2EID A;  4JKK A;  4DXT A;  1W8O A;  4P5Y A;  1GOG A;  2W1W A;  2CDP A;  1L7Q A;  2VR4 A;  3I2H A;  3CZU A;  5JXH A;  1UMH A;  2VTF A;  1GOH A;  3III A;  3WF4 A;  1JU4 A;  3C7H A;  3I2F A;  3ECQ A;  5CYY A;  2VZP A;  2OKX A;  1XC6 A;  1L7R A;  5HXM A;  3FHA A;  3CQO A;  2BER A;  4CUA A;  3I3B A;  3NNG A;  2VCC A;  2W1Q A;  4CU8 A;  1O59 A;  2C26 A;  4KWU A;  2J1S A;  2VQU A;  4BDV B;  2JE8 A;  2W9X A;  4QX0 A;  2ORX A;  4M4R A;  2HYX A;  2VL4 A;  2W1S A;  3WF0 A;  1BHG A;  1JZ7 A;  4XUP A;  4E8C A;  2ZEZ A;  3FN9 A;  4HG6 B;  2EIE A;  3VD7 A;  2RVA A;  2WZ8 A;  1JYN A;  3I2G A;  2VZS A;  4QAW A;  3MV1 1;  1CX1 A;  4ZY9 A;  3LEK A;  1JHJ A;  2PQS A;  2VOT A;  4UI9 L;  4W4Z A;  5JXJ A;  2WAB A;  4BXS V;  4A6O A;  4GZ9 A;  4FI9 A;  2XQX A;  4MO3 M;  4OUE A;  1US2 A;  2WDB A;  3FHQ A;  1UY1 A;  1GNY A;  4XUT A;  4AAX A;  3C7E A;  4E8D A;  1K12 A;  4JX0 A;  3VD5 A;  3GGL A;  3WF2 A;  1MPX A;  1SDD B;  2WO1 A;  3W5N A;  3WSO A;  2QQM A;  5DPN A;  5LA2 A;  2QQL A;  3LE0 A;  1NX9 A;  1UYY A;  2QQK A;  2J22 A;  3HNY M;  3I2J A;  3OG2 A;  1UY0 A;  3P6B A;  2C4X A;  2Z4F A;  3AC0 A;  3IAP A;  3VDC A;  3T08 A;  3HPN A;  4ARX A;  3C7F A;  5JMO A;  1W99 A;  4LKS A;  3VD9 A;  2DDU A;  1H6Y A;  3ACH A;  5EJ1 B;  1JYV A;  3I3D A;  5I0D A;  2WAA A;  2QQI A;  2ZEW A;  4DXR A;  2W91 A;  4D0Q A;  3D3A A;  2RJ2 A;  4A4A A;  1P8J A;  3ACF A;  1OH4 A;  3T2P A;  4ET7 A;  1UY3 A;  2W1U A;  5CZK A;  2DCK A;  3CKH A;  1JYW A;  4QX1 A;  4QDR A;  2VMD A;  4CUC A;  5G04 L;  4DUV A;  2B4K A;  2BGO A;  3E1F 1;  2B9V A;  2EIC A;  3THD A;  2ZEX A;  5JR2 A;  2VC9 A;  3VD3 A;  1UMI A;  4MAD A;  3F2Z A;  1UY2 A;  4LPL A;  5LA1 A;  1DP0 A;  3C7G A;  1JZ8 A;  4BK4 A;  3T0B A;  1OT5 A;  3NQH A;  4MOA A;  4QB1 A;  2YFU A;  1CZV A;  2W87 A;  4Z2A A;  5HPO A;  3A22 A;  1EUU A;  3EYP A;  3WNN A;  1UY4 A;  4MGS A;  1CIY A;  3LEI A;  4OZO A;  4LHS A;  3K75 B;  3WF3 A;  4A41 A;  2J1U A;  1YQ2 A;  2J1A A;  5JXI A;  2E31 A;  4A45 A;  1JZ6 A;  2C9K A;  2V4V A;  3HJR A;  1W8N A;  2VZT A;  3WNP A;  2Y6G A;  2WQ8 A;  2L9L A;  3MO4 A;  2ZXQ A;  1ULO A;  1JI6 A;  2XON A;  2J1R A;  1PMJ X;  3OBA A;  3T0A A;  3ZM8 A;  3MUZ 1;  4BK5 A;  3MBW A;  2YC4 A;  4JKL A;  3I3E A;  3A21 A;  1GMM A;  3VD4 A;  1DYO A;  4OYU A;  4LQR A;  4GWI A;  2WYS A;  1OF3 A;  3T0D A;  2WZE A;  2QBX A;  3DYM A;  1LNS A;  2WO2 A;  4QX3 A;  4CVU A;  3VDB A;  3OEA A;  3HEI A;  3J7H A;  2VCA A;  4XUN A;  1XPW A;  2RV9 A;  1PMH X;  4DUX A;  5J1X A;  1PX3 A;  4KMQ A;  2Y6H A;  4W50 A;  2ORZ A;  4PF1 A;  4ZXE A;  3WNM A;  2VO5 A;  2W95 A;  3T2O A;  2DCJ A;  2VZR A;  3IAQ A;  2J1E A;  1PX4 A;  5LA0 A;  3LPF A;  3OEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...