4ZZ5A

X-ray crystal structure of chitosan-binding module 2 derived from chitosanase/glucanase from paenibacillus sp. ik-5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
HNLALNKATATSSIETAGHEGDKAVDGNAATRWASAYGASPQWIYINLGSTQSISRVKLNWEDAYATAYSIQVSNDSGSTPTNWTTVYSTTTGDGAIDDITFAATNAKFVRVYATTRATAYGYSLWEFEVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucanase/chitosanase
publication title Mechanism of chitosan recognition by CBM32 carbohydrate-binding modules from a Paenibacillus sp. IK-5 chitosanase/glucanase
pubmed doi rcsb
source organism Paenibacillus fukuinensis
molecule tags Hydrolase
total genus 32
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature ec 3.2.1.132: Chitosanase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4zz5A00
4GZ9A 1RYYA 2Y6GA 1DP0A 4JHZA 3CKHA 2CDPA 2C9KA 1J84A 1KGYA 4PF1A 1XPWA 2W46A 3IAPA 3I3BA 3CQOA 2J1AA 1L7RA 2V5DA 4QX3A 2E33A 5DPNA 4ZY9A 1UXXX 4P08A 1O59A 2VTFA 3WNNA 3FN9A 4BDVB 2C26A 1HN1A 2WDBA 2XHNA 3THCA 3OGRA 2VZVA 3UESA 3DYPA 3ACIA 1NUKA 2X09A 2W1WA 3ACFA 3C8XA 1UMIA 2BERA 3T0DA 2YFUA 3OGSA 3I2JA 2XONA 3GGLA 2YC2A 2YC4A 3LEIA 2W3JA 5HPOA 2JDAA 2VQUA 3DYMA 4QB6A 4QPWA 4KI5M 3FHQA 2WYSA 3HJRA 1JYVA 3I3EA 2ZEWA 2B9VA 2RVAA 4M4PA 3T09A 2ORZA 5LA1A 5A1AA 4XURA 2W91A 1US3A 4E8DA 4XZUG 1UY1A 3W5NA 5EJZB 4ARXA 2V4VA 4W4ZA 4MOAA 2VZQA 3A7QA 1US2A 5JR2A 5JXGA 3VDCA 3ACGA 1O8PA 3PUIA 3VD3A 2VZPA 4JKKA 1UZ0A 3P6BA 1OT5A 2VZ1A 5F7UA 5JXIA 1UY3A 1D7PM 5DN2A 4LKSA 3SKVA 3WNOA 5I0DA 3OGVA 2WQ8A 2QQNA 2W1QA 4M4RA 1XC6A 4BXSV 3NJVA 2ZEZA 5LA2A 4L0PA 4JKLA 4MADA 3WNMA 3C7HA 1JU3A 2W9XA 4QX2A 2WN3A 2WZEA 2EICA 3GXUA 1DYOA 4ZXEA 5LA0A 2RV9A 2Y6JA 2VZSA 3HOBA 1H6XA 2J1RA 3VD7A 2EIBA 4XVHA 5IHRA 3WF0A 1GNYA 1GOHA 3T2QA 1O8SA 2YB7A 5JXJA 3MO4A 4DXSA 2OKXA 4BK4A 2WO1A 2BBAA 1J83A 1JZ6A 1SHWB 5G04L 3T08A 4MGQA 2J7MA 3E1F1 5G05L 3GM8A 3WF2A 4QAWA 1JU4A 1UYXA 1GMMA 3OG2A 1ULPA 2VJXA 2Y6LA 4D8MA 2VM9A 5J1XA 1PX3A 4A42A 2VZTA 4HG6B 2VCCA 1K45A 4ZZ8A 3I97A 2QQJA 5IFTA 2WABA 3FHAA 2W1SA 1CX1A 3I2FA 4P5YA 1CZSA 1KEXA 2PQSA 3J7HA 4CUCA 4ARYA 3U37A 3WQBA 3WNKA 2LS6A 3WF4A 2VZOA 3ZM8A 3DECA 3HNBM 2VMCA 3SKJE 1JZ4A 4FI9A 2QQLA 3CMGA 1UX7A 1F4AA 1LNSA 2E26A 2Y6HA 1JYNA 4LPLA 4OMCA 2VCAA 3MBWA 5C7GA 5C70A 3DYOA 3THDA 1P8JA 1DLCA 3IIIA 1NAEA 1K3IA 2Y6KA 1OF4A 4QX0A 4AAXA 3K77A 1XNTA 2QQIA 2W5FA 2JKXA 4DEVA 3A21A 4Z2AA 3MV01 2ID4A 3BN6A 2WAOA 2VMDA 4A4AA 4UOJA 5JUVA 3NRUA 2B4KA 3SEEA 4ET7A 1OD3A 3OEBA 5HXMA 3W5MA 4MO3M 4OYUA 1PX4A 3UNPA 1UY0A 3NQHA 3NNGA 3IAQA 1GOFA 1L7QA 1UY2A 2J1SA 3P1IA 2L9LA 2WUHA 1W9WA 2X10A 3HNYM 4GWJA 3VD4A 3I2HA 3HN3A 5FUIA 2VCBA 1W9SA 4D0QA 3ETPA 2YG0A 1MPXA 3C7EA 4A41A 4OUEA 4A6OA 5IYYA 1W8NA 2VQTA 5JXHA 4LHSA 1JYXA 2VMFA 1I5PA 1JZ5A 1H6YA 1CZVA 1SDDB 1IQDC 2VOTA 4XUOA 1UWWA 3HEIA 5B4NA 3CZUA 2QQMA 3A22A 1TVGA 4LQRA 5EIYB 3LEGA 4XUPA 5C71A 1BHGA 4PT6A 2BZDA 4P00B 2HYXA 4KMQA 4IUGA 3NJXA 4XUTA 1GOGA 2Y8KA 2ORXA 3C7OA 1UYYA 2WZ8A 1F4HA 3K4AA 4W8JA 3C7FA 1UYZA 4AG4A 1JZ8A 1JHJA 3T0AA 4QDRA 4BK5A 2W47A 3I2IA 4A44A 2VMEA 3WNLA 4DUVA 1W99A 2JD9A 3BGAA 1UY4A 2R7EB 2XOMA 2W94A 4DEQA 1K42A 1W9TA 2VO5A 2XQXA 1EUUA 4CU8A 4P02B 1GQPA 3AC0A 3K4DA 3VDBA 3CIHA 1JZ7A 2LW8A 1JI6A 3MUZ1 3EYPA 2WO3A 3MV11 3HNMA 3C7GA 5EJ1B 1W8OA 3ABZA 3VDAA 3PUHA 1NKGA 1NX9A 2QQOA 3GDBA 3A23A 4CU6A 2YFZA 3WEZA 3T2PA 1YQ2A 3WNPA 4OMDA 3IDAA 3OEAA 4CUAA 2W92A 3CZJA 1PMHX 1GUIA 3F2ZA 3JXSA 1CIYA 3LPFA 1ULOA 2WBKA 5B4XA 2KD7A 3VD9A 2Z4FA 1UXZA 4DXTA 3EB7A 2DDUA 5LCWL 2J22A 4CU9A 4QDSA 4CVUA 3ACHA 2W1UA 4QB1A 3I2GA 2Y64A 4UI9L 2DCKA 2J1VA 4DUXA 2BGPA 2J1TA 4A3ZA 4CU7A 1UMHA 3HPNA 1JZ2A 5DQ0A 2ZXQA 4W50A 2QQKA 2W87A 1WKYA 4RYDA 5CZKA 1WCQA 2QBXA 2C4XA 2EIEA 3T2OA 1CZTA 4OZOA 1T2XA 1TG7A 4YPJA 3SEPA 2JE8A 3LPGA 4DUWA 1GU3A 4DXRA 3T0BA 3K4ZA 2BGOA 4TXWA 3LEKA 4TTGA 1K12A 2X05A 4QDQA 3LE0A 2RJ2A 4XUQA 5CYYA 1R64A 1OF3A 5IFPA 2VL4A 3WF3A 3K75B 2E32A 2VC9A 4RN5A 1XNAA 4MGSA 5IJRA 2VZ3A 4GWIA 3CDZB 1JYWA 3UETA 4KWUA 3K46A 2ZEYA 3WSOA 2ZEXA 1W0NA 2J1EA 5JMOA 3OB8A 4PQQA 3D3AA 3ECQA 1SG3A 4E8CA 4QX1A 2WO2A 2EIDA 5DMYA 2VZUA 2DCJA 3MUY1 3IB3A 3I2KA 3LQCA 4ZZ5A 2E31A 2CDOA 2HLEA 3VD5A 3FL7A 2W95A 4CUBA 1JZ3A 1PMJX 4XUNA 1EUTA 2V72A 2WAAA 2WN2A 3I3DA 4JKMA 3WF1A 4JX0A 2VZRA 1OH4A 4UAPA 2VR4A 2J1UA 3OBAA 4A45A 4QB2A 4BJ0A
chains in the Genus database with same CATH superfamily
1SMVA 1RUJ1 1NCQA 4COVA 3ZPYA 2ADEA 3ZMNA 5FPLA 2X5IB 2JDKA 1RYYA 4O65A 5FPUA 2WRAA 3ASIA 2Y38A 1UPIA 4OFGA 2B9UA 3D0SA 1EAH2 1POV3 3CKHA 1HQLA 3VKLA 2EA7A 3AXDA 1SEFA 4QX7A 2EXKA 3IAPA 3SLIA 2J1AA 1L7RA 2RS12 4K40A 2NQYA 4ASMB 3RZGA 5FXZA 1VBD1 4QX3A 1RUI2 1VBC3 5FO7B 1RXFA 2ET7A 1PGW2 1RUE2 3B00A 2ZTNA 2XJSA 2HKXA 4Q0SA 1RXGA 1YI9A 2PAKA 5JI7A 1EV11 4FQ4A 3BIWE 4PQ9A 3SH5A 3WNNA 4BDVB 3T1MA 4AFAA 1XYOA 1ZNPA 1HN1A 2XHNA 1WBLA 3WP5A 4XMIA 4URAA 4LBQA 4N43B 5K4LA 3IMNA 5HCBA 4Y22B 1AXKA 5E6HA 4Q4V3 1R1A1 3UESA 1XE8A 3ACIA 3BU7A 2EXIA 5JI9A 1GWMA 3OGJA 4C91A 5BNNB 5FP7A 1FI2A 1LR5A 1SFYA 1U5XA 1HJGA 3KZ4C 4AEKA 5A6YA 1V6KA 1PIV2 1D4M1 2XONA 3NO8A 2A3WA 3UKNA 1KJRA 1URXA 3LEIA 4CDUC 2CL2A 4K7JA 4OUMA 4ASKA 4RS5B 2VGDA 2MNGA 4LE4A 4QB6A 3B3QE 5FJHA 3IZOA 1AR91 1ULDA 3ZVXA 1YI7A 4D6RA 3B02A 3FHQA 2WYSA 2RDNA 3FLTA 4Q1RA 4CE8A 4OHXA 4QXCA 1CVNA 1M06G 3ST7A 2QZ3A 3T09A 5CB7A 1QJFA 2DCTA 1ENSA 5LA1A 3EMRA 2JICA 1RUC1 2W91A 4XURA 4E8DA 1BEV3 2P6HA 4K21A 3LIHA 4UWDA 3FWEA 1O4TA 2VNGA 3H0OA 4XZUG 5EJZB 1HRV3 3H7JA 1Y7BA 2V4VA 2ZOEB 2VZQA 3A7QA 2P5BA 3VDCA 1YIPA 5EP9A 1V6IA 1SCRA 1VBA3 4L2NA 5D2AA 1GR3A 3Q8CA 2W0XA 4HLTA 3VD3A 1IS6A 3BOWA 1LEMA 3MIBA 2VZPA 2QCSB 1FOD1 4ZU7A 1DDLA 4LBLA 1W03A 5JXIA 2DTWA 5DN2A 2WA4A 1O4YA 3AFKA 1AUYA 3TYJA 5F9TA 3MW4A 4OCTA 4Q5OA 1OFSA 2QQNA 2W1QA 1PO12 4YGEA 3APBA 1TZOA 3ON7A 4LMFA 4CDWC 5LRSA 3S0MA 3NL1A 4CCOA 3PMEA 2R073 4HN0A 3AKRA 1ALYA 4CEWC 5FO8B 4MADA 4DRRA 4QGLA 2CAUA 1LCLA 3SH3A 2N7GA 1YYNA 3POYA 3RMXA 5FPZA 5KBFA 4QX2A 2WN3A 2PHDA 2BRTA 1GP6A 2EICA 1NXD1 5M0TA 1MZFA 2DVAA 1O91A 1EY2A 3LD8A 4OQ9A 4CDQA 3D8CA 3RZMA 5FZFA 2UYAA 4JCKA 3SCFA 3V0BB 3HQXA 3ZIWA 3VD7A 3H3LA 1MZ6A 4E4HA 2XJQA 4QPIA 2QDRA 2FDKA 3NKGA 4XXAA 2ZAHA 4RQPC 3KGZA 3WF0A 3KCCA 3T2QA 3WVJA 2JE9A 3NV2A 2XJTA 3NAPC 3Q8AA 5T50A 2VNRA 5EJ3A 2BNOA 2OPWA 1LKNA 2P4EA 4YW1A 3WNXA 3OF1A 4KU8A 4YZ3A 4OHZA 5KXDA 1EPWA 1SHWB 2SBAA 3N9QA 4MGQA 1GSLA 3QOPA 2BJSA 3ZFEB 5C3OA 4WM7B 4BQ4A 2WWJA 5A6XA 3GM8A 4QM8A 5AFEA 4D69A 4RL7A 4RSUA 4AHYA 5FP8A 4COYA 1GMMA 2HEWF 3VN4A 1ULPA 1G9AA 1AXYA 1OQ1A 2VJXA 1ZZ8A 3WDUA 2Y6LA 1OOPA 2VW1A 3OTFA 2WS92 2BVVA 3UJQA 4K1ZA 1PX3A 5LEJA 3N7MA 4QQPA 4A42A 2XL9A 5FO9B 3SNMA 2YZ4A 3FJSA 3AYCA 3RS6A 2WFF1 2IXHA 3VBOA 3OYWB 3O5SA 1RUF3 1K45A 3IT8A 4UFMA 2RDSA 4YW2A 3N7LA 4PIYA 3SH4A 5IK4A 2G9ZA 5GZCA 5IFTA 1HIXA 1R083 1RVF3 2WABA 3KT4A 3DEMA 1UYPA 3WP4A 2JX9A 3UGHA 2W1SA 3V65A 4XJ8A 4NUBA 3GZTB 1H8TA 5AFBA 1CZSA 3LGRA 5BNOC 2NZ9A 4WM8B 2JDZA 4XF3A 4CP9B 5CFDA 4XF0A 3MICA 3WQBA 3POWA 2D6PA 4NIAA 3WF4A 1AR61 2G1MA 1H4GA 1NXMA 3ZM8A 3HNBM 2QZ2A 4QHZA 2ZGUA 3GHMA 4QGNA 3SKJE 5F1RA 5FWEA 1JZ4A 1HRI3 4B1MA 4UFHA 1RHI2 4BHPA 1YEWA 3VKFC 1QJX1 1WZXA 4S2GA 3ZYBA 1F4AA 5FMBA 2Y6HA 1BK0A 4LPLA 1RUG3 5FYVA 1WGPA 2WQ4A 4E4ZA 2VCAA 3VKOA 5CG8A 2CGNA 2TEPA 4YZ2A 3DYOA 1D2SA 4FBFA 1ZREA 4IGPA 4IEUA 4YG6A 5A7WA 1W6OB 3ME2A 1DGWX 3VBUA 1JMUB 2LALA 2VBDA 1AXZA 3BPSA 4YM3A 2D93A 4NHXA 4LBKA 2PHRA 4LOTA 4GKXA 4Q4Y1 2RM22 2WAOA 3KMHA 2NM1A 4MHRA 5F6LB 5FBZA 5KHGA 3GCWA 4OULA 4FAGA 4GQ7A 3NRUA 4IERA 1HXS3 2HBUA 4GKYA 2YYOA 4ET7A 1W6QB 5ABJA 2R041 5CIRA 3M1HA 5C3PA 1LU2A 3NQHA 3NNGA 3IAQA 3NSTA 3NNFA 5HCFA 1AR72 2WNVA 2GC0A 4AVBA 1UY2A 5JSRA 1JBCA 1AR83 1CJDA 4CTEA 5HCHA 1X82A 3BCWA 3I7DA 2IXKA 5BNPA 1UN1A 5LEKA 1AX2A 4ZHNA 2WUHA 3FUOA 2ZX4A 4HOOA 5EV7A 4HN1A 1SFPA 5CKQA 5FP4A 3VDDA 1UD1A 5HBAA 4P9GA 4L8QA 1YUDA 4CDUB 3WCRA 4GWJA 2BU9A 3R4DB 5LRRA 4A7YA 4LT5A 1BBT2 1SLIA 2LTNA 3UYJA 2F17A 3WQ0A 2VU9A 3KQ4B 5D21A 2YG0A 4Z2WA 3C7EA 5E16A 5EWSA 3V0AA 2JG8C 4P9JA 3SCGA 5IYYA 3O12A 4M3CA 5L9VA 1JW6A 4Y4YA 4AI3A 4YLZA 1VB2A 3PL0A 1X8EA 3ES4A 5F6KA 1MS3A 3T4HB 2RS53 1XU1A 2ZMNA 3VB9A 4DNYA 1JZ5A 3B93A 4XDPA 2P2KA 1IQDC 2VOTA 4XABA 1RITA 5TSWA 1B35A 4BA6A 3IKWA 3PUAA 2R1BA 4OI2A 3HEIA 2XUEA 5DDJ3 2HWC3 3WP6A 2AR6A 4QPGC 1OC1A 4Y5SA 5IVFA 1RGSA 2RJKA 5A7QA 4YZ5A 5C5TA 5C8CC 2E7AA 5I93A 4KU7A 5J98B 1FMD1 1A6CA 3HT1A 2IC1A 4RR3C 1PZ8A 2CTVA 2JXAA 3E5QA 2GNDA 1S0DA 3J7LA 5CFCA 1OPOA 4CP2A 1ZBE1 2A73B 3GF6A 2DUOA 4PDWA 2EAAA 3EHKA 2ORXA 3C7OA 1LAJA 2WZ8A 4LUKA 2PLV2 2V09A 4XE9A 5D8AC 3O1TA 3LAGA 2GP3A 2O1QA 4CDWB 4S2FA 4YFWA 4BOWA 5A7SA 5FYTA 1PO21 2IXJA 3J7MA 4CEWB 5H9SA 3LOBA 1DG6A 4JGZA 4JV4A 1W99A 3ACLA 3O1PA 4ASLA 1W2UA 2W94A 1FATA 2HWB2 2V4AA 4DEQA 3OBZA 4AGRA 1K42A 1JS9A 2RR11 4H3WA 3C3VA 5JAXA 4KG0A 1LRHA 1E5RA 2XQXA 5J37A 1PZ9A 4DXZA 4YFZA 2ZX1A 2YBSA 4J25A 3VBFA 3PNAA 3O0XA 2LW8A 4RQPB 1RUNA 2IFWA 5BNQA 3ZYJB 4Z82A 5C4WB 4YM0A 4YVWA 3EYPA 1FAYA 2DU1A 3NAPB 1SLCA 5FOJB 5L9BA 3KT7A 1AL22 4D6SA 1GNHA 1OPMA 2WR9A 3B94A 1A78A 2Q1ZB 1IQAA 3RJ2X 3ABZA 5JZGC 5K8SA 4FP2A 3VDAA 2ZGKA 1NX9A 1CAWA 1QJY2 2PHXA 5GLUA 3RZZA 3LZZA 3OY8B 2WIIB 2XR4A 2BEOA 2D98A 3WEZA 1Y3TA 5KR7A 2RS32 3AMMA 1JHNA 3JB4C 2FDJA 3VBHA 5KXCA 5HV4A 4GA9A 2MEV1 1Q8OA 3ZN6A 4CUAA 1KITA 1QNYA 2R49A 3T2TA 5DAPA 1LODA 2PYTA 2QUOA 3K3NA 1PMHX 1VIWB 4P9XA 2FMYA 2KR2A 4QX8A 2E51A 3QACA 3LPFA 2JD4A 1ULOA 1H4HA 2KD7A 1YQ8A 1UXZA 3GYDA 1G9FA 3UJOA 3VBSC 4AVAA 2JB4A 2P3IA 3JZVA 4IV1A 4XIKA 1S0IA 2CNAA 4YG3A 2QQPA 1XE7A 3ZFFA 4MGKE 1TMF3 1V0AA 3NMBA 2SLIA 1UL9A 3FBMA 5FZ9A 4E2GA 1NY71 1OA4A 4CVUA 3MYXA 2E6VA 3ACHA 5FYZA 4V2VA 5FCCA 2W1UA 1AJOA 3FBYA 5BNOB 5FMDA 5I8YA 1REFA 2DCKA 4OHVA 1W6PA 2PTMA 2F4PA 2XVLA 4HPKA 1DQ4A 1VRH3 5IT6A 1DYPA 4AEDC 3AJZA 1POV1 2RMU3 2HH9A 4A3ZA 4CU7A 1HKDA 2HBTA 1JZ2A 5FMOL 5KXEA 4XW3A 1TME3 2ZXQA 1VR3A 4W50A 1ZRCA 1UF2C 2D7FA 4N53C 5FZKA 1OLMA 3W20A 1VBC1 2QBXA 3U78A 2C4XA 5FY8A 1UO9A 5DG1A 3T3YA 3T2OA 4AZZA 4BQ3A 5J3UA 1CZTA 1QOSA 3KV9A 4YPJA 4YM1A 3WQ1A 4B4QA 3AMPA 2JE8A 3SEPA 5JOYA 3CJIB 3O1RA 2HWE2 5A7NA 4DUWA 3PTRB 2FZ1A 2HWF1 2P6CA 3LCPA 3POJA 3S30A 2Q4SA 1IS4A 4Y1ZA 4Q4V1 2VD7A 5FZOA 4IQPA 4E4SA 3IDBB 2X05A 4A2UA 4QDQA 3ZKUA 2YBKA 2RJ2A 4XQDA 2VMGA 1AYM2 4XUQA 2XJRA 2GSYA 4DMIA 5CAZA 4K1YA 1X50A 5DAXA 1LU1A 2DVDA 2A6WA 4KWKA 4NPMA 2OYZA 4GJZA 3WF3A 1ULCA 4BU2A 4E4DX 5L7OC 3HR9A 3HN1A 1SBEA 3I3QA 2VZ3A 3GNEA 1G9DA 4CYDA 1JYWA 1GZWB 4E9KA 4JGYA 4W65A 5JWPA 1RUJ2 1ZYBA 1BQPA 2ZEXA 1W8ZA 1GICA 3L2HA 3AP5A 3THTA 4HSJA 1UU4A 4Q29A 2TNFA 1PVC3 4YW5A 2HWD2 5FPAA 4DRVA 1T6GC 5EFUA 1ULGA 3LEMA 1NLQA 3ILRA 4XQWA 4FAHA 3EO6A 4QX1A 4YARA 1GBGA 2OT7A 2EIDA 2O0OA 1GFF2 1BEV1 2P34A 4XACA 5LY1A 2R6QA 2AEYA 1HRV1 4GAZA 2JG8B 1ENRA 1RJ8A 1H2KA 3E6CC 2OVUA 1OHFA 2BNMA 1LOCA 1VBA1 5FXVA 4BH9A 1JZ3A 1PMJX 5J96B 4XJUA 1BMV2 4PHZA 1UOGA 1OLRA 5FKCA 1COV3 4RHV2 5FZ3A 3D5OA 2V73A 2BFUL 2WYFA 1EUTA 1LHVA 1W28A 3J8F2 1C8M3 3E6BA 3WF1A 4JKMA 4O61A 5HI0A 5LWBA 4TLGA 4WVMB 2JDNA 1OH4A 4AK3A 4OLLA 4QPGB 1KDKA 2O14A 3OBAA 2YGLA 3DKQA 3WUDA 5CADA 4NIHA 4EV0A 1NQJA 1YLLA 2CSGA 2R071 1D4M2 4MYEA 4BJ0A 2QNKA 3H8UA 4Q0QA 4RR3B 2NPIA 4GZ9A 1Q43A 1QF3A 2Q8OA 1RL3A 4XTMA 5A33B 5C33A 5FZMA 3S7IA 1NA1A 5FZHA 3T1LA 1XNBA 3VBRA 4D6QA 4AI0A 1KGYA 2W39A 4P9WA 1DIWA 5D8AB 1IKQA 2RS13 3UGGA 4AVCA 5CKNA 4B7EA 1RUI3 4J1WA 4Y24A 5AC93 1R091 3SC7X 3VZKA 4ZY9A 2EF6A 4HK8A 4Q8LA 1RUC2 4GWMA 2UU8A 3RMYA 4GMP3 1O59A 2WZPP 3TEXA 3W5NA 1W0PA 4Y26A 3T4VA 2WA3A 2UWBA 3FN9A 4K3UA 2EVXA 3DCQA 3H50A 1VMFA 1XB9A 4LULA 4P9YA 5F2SA 2WNUA 1OXCA 2AYHA 3MFCA 1QH6A 3OGRA 3AKSA 3ZFGA 2VZVA 4KWJA 1EP0A 1NUKA 4QQHA 4JZRA 2GU9A 3ACFA 3M70A 1UNBA 1SLTA 3GBFA 3O1SA 1FOD2 1W9FA 1PIV3 2YFUA 4N8MA 1VMHA 4Q8KA 3OCPA 3I2JA 2QQWA 4FPYA 2YC2A 2YC4A 2YUEA 4BWOA 4F8AA 2W3JA 2JDAA 1V00A 1WWYA 4YNIA 4QKNA 3ZXEA 4XMAA 2E9QA 1OA3A 1KFXL 3VL9A 2GH8A 4AEMA 1YIFA 1HB4A 5DUVA 2R061 5FPVA 2OXBA 3HJRA 4IE5A 4NRMA 4QM9A 1RB8G 4QKFA 3NNLA 4JRAA 4MXVA 3TN92 4EWDA 1RUF1 1C57A 2RVAA 5FK8A 1QHDA 1XE0A 4M4PA 3BTXA 2ORZA 1NT0A 1I1EA 4Z8BA 2VQAA 1R081 1RVF1 3PIGA 3R0RA 5KHHA 5A1LA 1PVXA 1FNZA 4N7IA 3WY6A 5C9AA 5C8WA 2YBPA 2Q5TA 4W4ZA 4MOAA 3ZXAC 4JAAA 1PHMA 1DYKA 5EYXA 3WDVA 3S7EA 1JXNA 1UKGA 5A3PA 3AM2A 3VBSB 4AFMA 5CEHA 1F31A 2X5IA 4OHYA 1XJAA 2IXCA 4FXGB 1PGL1 1VJ2A 4C1XA 1HRI1 4W6XA 5F7UA 3P3NA 3WNOA 1GKBA 4FPFA 4H7MA 5FYCA 2NMOA 2WQ8A 1RUG1 2JDHA 5F2WA 3E5UA 3BU0A 1Y43B 3JBG2 1TEIA 2XMLA 3NJVA 5LY2A 4AVVA 1RUH3 1IPJA 2A3XA 4BQYA 4CP0A 1REEA 2VVDA 2ZPXA 2GDFA 5LA2A 3DPRC 3I2DA 4L0PA 3TAYA 4AEDB 2ZX2A 5CBLA 3ILFA 2Q1FA 2VPVA 3ZYGA 2PA7A 4LKDA 2OW4A 5DUUA 2FZ2A 4L11A 4FSJA 3MFAA 5KHJA 1N1YA 3ZYPA 1JU3A 1NQDA 4N53B 1UZVA 2W2IA 2WZEA 2VE1A 3J4UH 4N43A 4Y22A 2OUJA 5LA0A 4CSWA 4YVSB 3LDBA 4FFHA 2WZR2 3CBNA 2RV9A 4XETA 4K9SA 2ZGPA 5FY9A 2WFF2 5BNNA 4MGTA 4B3NA 2J1RA 1UZWA 1OBNA 3IPVB 1HXS1 2EIBA 4Q4W2 4ATEA 2KA3A 3NJZA 4Q4X2 2VH9A 2W08A 2ERFA 5FYSA 3S6PA 4UFJA 4AWDA 2B42B 4RS5A 4YYOA 2OKXA 1AR81 1NCRC 3IDCB 2XWJB 1VRBA 5IVVA 1JZ6A 5G04L 4A3XA 2PHWA 3T08A 1V6OA 3SITA 1HQWA 1AR62 1XNDA 4Y20B 3USUB 2WFPA 3AZXA 5FMCA 2VAUA 5G05L 1ZBA3 5GKAC 5L7OB 4EN7B 3AYEA 2RE9A 4XFGA 5FYYA 4XBNA 5LBEA 5FQ0B 3RWNA 2WWUA 5GZFA 4QAWA 5A7PA 1DGRN 2C0ZA 4QKBA 3RVHA 4W6YA 1QXJA 1V9U3 2WKKA 3LWCA 3KCXA 3RZLA 2PAMA 3RJRA 1ZM1A 1Z7S2 1BVVA 2BGCA 2PXJA 2WS93 2DUPA 2XHKA 1LESA 5I8SA 3VLBB 3WXPA 3ZDVA 2VM9A 5FMOS 4I09A 3JD73 3MDPA 2RS51 3AKPA 5JMCA 2H0BA 4AFCA 5IVJA 4HG6B 4SLIA 2VCCA 1QJEA 3ZSMA 3QH7A 5JPNB 5DDJ1 4AHZA 2HWC1 4FFIA 4P14A 4UXAA 3POEA 4B8EA 1YNAA 4QHOA 5I0RA 1JYIA 1W9YA 4BQXA 2FCVA 2GMEA 4HFSA 3PVNA 4CDXC 1O3QA 4XPVA 1H9PA 5CVRA 4YZ1A 4CUCA 4EE2A 4ARYA 2FCUA 3KB5A 3U37A 4AGGA 4WBBA 2LS6A 1F9KA 3WNKA 1YXWA 1X36A 5F8PA 1D0GA 1ZZBA 3R6SA 1RHI3 4N9IA 3QH6A 1SCSA 4B4PA 4D7YA 3GZEA 4I2OA 1SLLA 2QQLA 4FI9A 4HKLA 2JENA 2UWAA 2B5HA 4UF0B 5K0UC 4O7XA 3CMGA 1VAKA 1LNSA 3OOXA 3H42B 1JYNA 2VXRA 1DGWA 2RG4A 4OMCA 5F5QA 3ZYRA 4Q0PA 4XTPA 5LBCA 5C7GA 1CAXB 5DAVA 2ET1A 2JG9C 1STMA 2JIJA 1OF4A 2PHLA 4AAXA 3PU3A 4QXBA 4NIGA 1W2AX 1DZRA 2W5FA 3A21A 3I4IA 3W21A 3MI8A 2RM23 4GIQA 3BN6A 4MXWB 4A4AA 1AYN2 4INDA 5JUVA 4QWNA 3ZFEA 2Q8DA 4WM7A 2B4KA 4XBQA 4PBPA 1YCIA 3MF6A 1BXHA 5C3RA 1Y9MA 1OD3A 3KWVA 3O1MA 1QJU2 2W52A 2PAEA 3HBZA 1MQTC 4EQVA 4OYUA 5FZ7A 4JHTA 1AR73 1PX4A 4KBZA 5A32A 3UNPA 1A34A 4DINB 3G7DA 2E53A 1WMXA 3PDQA 3PJQA 2XGXA 3U75A 4ONUA 2GALA 1KS5A 1ZBE2 1J1TA 1GANA 1TE1B 1UKRA 2OQ6A 2WNOA 4U36A 3KHBA 3AP6A 5IW0A 3S5AA 1W9WA 3FMGA 4KBBA 1SACA 1BBT3 4N90A 4IEYA 2AZ5A 3ATGA 5FUIA 2YMZA 1M4WA 4MVTA 2A1XA 4M00A 1QWRA 4MGIE 2PQQA 4ZKTB 5EHDA 1GLHA 4R9BA 3OUJA 1PO22 3Q9OA 3ZKYA 1CWPA 1G6NA 5HCAA 3Q8BA 3WZ1A 1W2TA 3N9LA 2VQTA 1DZTA 3SXWA 1TNRA 1YQ6A 4WM8A 2FD8A 4LBJA 2FDIA 4CP9A 5T54A 4IEPA 2QTWB 3MLKA 1H2MA 1PK6C 3WV6A 2DF7A 2RR12 5HXVA 1H6YA 3DF0A 4BXFA 4FTEA 3VKNA 1TMF1 4RGGA 4JRLA 4CEYA 1DGLA 1VE0A 1S0EA 1WCDJ 4LK7A 4ISQA 4IETA 1HB3A 2QQMA 1ZZ6A 3A22A 3KF5A 4XILA 1TVGA 2ZHKA 5J48A 2VUJA 2BOIA 3N9OA 1V6LA 3AZWA 1KQRA 3QBQA 2D6KA 4LBQB 4LKEA 1VRH1 4PT6A 4AAPA 2ARAA 4CCMA 4D94A 4NROA 5C4WC 1QQP3 2HYXA 2WNVC 2D40A 2RMU1 3PUQA 3PVEA 2UWCA 3GZUC 1IKPA 1W6NA 5FY0A 2BQPA 1GOGA 4XJWA 4BQWA 2PLV3 4N9HA 3ZSKA 1TME1 2P3KA 1W6OA 4FFGA 3K4AA 3FX3A 3C7FA 1UYZA 5FR3A 5GLVA 1JHJA 3P5BA 4BK5A 4DIQA 1WA6X 2C24A 3H1MA 4BLJA 4HXCA 1I5ZA 3DPRB 1WCUA 2VECA 4CCEA 4Q26A 3LF7A 4C0BA 1ZZ7A 1C5HA 4BISA 1ND3C 2VTXA 3LKJA 3VHNA 1S2EA 3FFQA 2HWB3 4YW7A 1UZZA 1W6QA 3AKQA 2QVSB 1UY4A 3G6JB 4AR2A 2E7QA 4I30A 3WHTA 1APNA 2WWSA 3LDRA 2A75A 4X6QB 4IEQA 2FQPA 1S2KA 4CU8A 3POGA 4IEOA 3LA3A 4P02B 4MGZE 3RSJA 1GQPA 3AC0A 4GB32 1S4CA 2C9AA 3PVOA 1IOAA 2YPDA 4XXPA 1JI6A 3DL3A 1OVPA 3MUZ1 4AQTA 1N3QA 4CDUA 3AXEA 3HD8B 1AL23 4EWEA 4HONA 2Z42A 3MV11 1CPMA 3HNMA 4YW3A 1NCRB 3AMQA 1TNFA 4ZU5A 3C7GA 1W8UA 1PVC1 5C5UA 4H14A 1JOPA 3E6DA 3PUHA 3GZAA 3PU8A 4CU6A 4PI0A 5L73A 3BOPA 3KF3A 2Q8CA 2RS33 4PIZA 3WNPA 1UOJA 2GNMA 1NZCA 4NMIA 3D6EA 4NHMA 4CXYA 2VY0A 1LOBA 2JDMA 4HSLA 3CZJA 3JUUA 4IW3A 1AVBA 4M01A 2OZ6A 3JXSA 5ACA3 3CJIC 4EYUA 1COV1 2WBKA 4XIOA 5B4XA 2XKOA 1CAUB 3LOIA 1H1MA 2HWF2 4L99A 1HB2A 2O8QA 3VD9A 2Z4FA 4G3YC 2VMHA 4QU2A 1C8M1 2RDRA 4Q4V2 5JIUA 1YHFA 3AZVA 1WW5A 4LJHA 5GZGA 3B7MA 1NE6A 4JC1A 1UCXA 1QXRA 4R9DA 2GZWA 2Q0AA 3AFGA 4CDXB 3LA7A 4CDWA 1X9TA 3I2GA 2Y64A 4UI9L 5GZDA 1OQEA 1S0GA 2J1VA 4CCNA 1CAVB 3RFRA 4CEWA 1OSGA 4L92A 5FUNA 1RINA 5FZIA 2ZS6B 4DUXA 3WW3A 4KQ7A 3GALA 1G7YA 2ZAAA 3ZX7A 4X6RB 1WBFA 4GWNA 1VBB3 3FHIB 3IBMA 3UT0A 3GBWA 1VP6A 2RS11 1O7FA 4EN8B 5JCTA 1KFUL 4O9GA 5K0UB 1RUI1 3VKMA 1FPN3 1XNCA 4COZA 5AC91 1PGW1 5T5JA 5FP3A 1FXZA 1WLWA 4LE3A 4AQSA 2GNTA 4ITCA 4OZOA 5FKBA 4GMP1 2CWMA 2YHJA 1O5UA 2HWE3 3FLRA 1H0BA 2JDYA 1VLNA 2JG9B 3LPGA 5GM0A 4Y4RA 3BYWA 4AFBA 3NAPA 4NWWA 2BYVE 2A70A 3K4ZA 4Q1PA 1LHNA 4TXWA 5T55A 4AXOA 2P37A 2DCYA 4LO6B 1FV3A 1AYM3 1GYKA 1Y4WA 4TTGA 4GXLA 1HJFA 3BODA 3M3OA 4C8DA 5CYYA 1R64A 4XF4A 2DCZA 2CY6A 1C1FA 5IFPA 2CGOA 3HT2A 4IEZA 5FXWA 2Q1MA 4UT5A 4S2DA 3GCXA 4RN5A 3OY8A 4YGCA 2ZA9A 4L97A 5FDBA 1H8TB 1MQTB 4XAEA 4F3JA 2GC3A 3AX4A 4R9CA 4WVZA 1QIQA 2CYFA 2A6XA 3UETA 3X29B 2A6VA 4QXHA 4KGQA 2ZJCA 2HWD3 5JMOA 3OB8A 4BB3A 3I59B 1MZ5A 2D44A 3PVBB 3AYAA 1WLTA 3D4KA 1ONAA 2PN5A 2ES3A 1SG3A 1BYHA 1KXGA 1ULEA 4LHKA 4E8CA 5IWFA 4AQ2A 1XU2A 2Z79A 4FPJA 2VZUA 3IB3A 3URFA 3LQCA 1K5MC 4QPYA 2E31A 1LECA 5L19A 3H8RA 2CDOA 1R092 2HLEA 4ZU4A 3JU9A 1G9BA 4EN6B 4GALA 3Q8FA 4I0AA 4UFIA 1A8DA 1Q8PA 5LB6A 2Y33A 4RHV3 4XUNA 5BNOA 5FLIA 3ZSJA 4Y3OA 1PK6B 1RUD2 3W59A 1L7LA 1JN2P 1KD7A 1PMIA 1XSRA 3J8F3 4GH4C 4AHXA 3VUOA 5CG9A 5B2GB 3I49A 3BB6A 1ZA7A 3AMNA 3VZLA 4JX0A 1YRZA 5FBJA 4FTSA 1YQCA 5KC5A 5E89A 5FY1A 1YQ5A 5FLHA 3U07A 1HB1A 4A45A 1LGBA 1RUH1 4Y33A 1S1AA 4B4RA 3C2UA 3U11A 1LOAA 2WNVB 5FYHA 3LSEA 3CL1A 1RMU2 4C0HA 1E5IA 2Y6GA 1EPZA 5FYMA 4EROA 4Y1YA 1X9PA 2CDPA 2VOWA 2C9KA 3SQOA 2EAKA 1H9WA 2R062 4LORA 5BUVA 1XPWA 4RA0A 3CQOA 4GULA 4M3CF 4H55A 4BMEA 3FFZA 4MV2A 1AX0A 2V5DA 1S0BA 5DPNA 2WJSA 5KHKA 1NYWA 1ST8A 2YC0A 1ND3B 1VALA 2VMIA 1G86A 1R082 2F6BA 2R0HA 1OD5A 3POIA 2VTFA 2ZBJA 3OPWA 2GNBA 1XRUA 2C26A 2WDBA 3OJBA 5EZWA 2IFRA 1MEC2 3THCA 3WCSA 1GZWA 4LLFA 4HT1T 5FJKA 4R8HA 3ZPOA 3DYPA 4WVVA 2W1WA 3PMSA 3S57A 1FOD3 3H9AA 3C8XA 3N7JA 4NOTA 1PGL2 1ZZ9A 4ZONA 3INAA 4TSVA 3T0DA 1ASJ3 1ZBA1 3WG3A 1OFNA 1U5YA 1WW6A 3GGLA 2LROA 4I01A 3DGTA 3RI9A 4PBOA 4AFDA 4DY5A 2Y60A 4MH0E 1V9U1 2XKPA 5HPOA 2VQUA 3FC0A 3DYMA 5T5PA 2Z2SB 4QPWA 5CNAA 2I07B 2JG8A 4IE7A 4FOWA 2DBNA 2WS91 3K3OA 2AACA 4KI5M 4PDWB 1H8VA 3M3IA 4HVOA 3ZIXA 2RDQA 3ZR5A 3JD71 3TN93 3WDXA 3NVCA 5BXXA 3CU7A 2ZEWA 3LB9A 2B9VA 2VXJA 1XXNA 4NAOA 4EN0A 1VBE2 3KVAA 2GP5A 4UYBA 5FZLA 4NRPA 4HVRA 3WW2A 1DZQA 1PNGA 4NVPA 5A1AA 4FTBA 2IUWA 2ZGTA 4WVMA 4YVSC 1Q56A 1UY1A 2PMWB 2GN7A 2R0FA 3WOGA 4RFRB 4XCBA 4LBNA 2HEYF 4QPGA 1A3KA 4ARXA 5I8TA 1IG0A 1W05A 1W8TA 1HXS2 4QU1A 5C8CA 5F5IA 1US2A 5JR2A 5JXGA 1YFWA 3ACGA 1ODMA 4FPCA 2G9GA 1S2BA 4RR3A 1O8PA 5FYIA 1FYUA 3F95A 2B46X 3PUIA 4BQ1A 5FAXA 2XPJA 3NNJA 5H9RA 4F7ZA 5GLTA 2YROA 2ZACA 4JKKA 5F3GA 3PHMA 1UPSA 1UZ0A 1RHI1 3N4MA 1WUVA 3VBFB 2ZHNA 4BIFA 4IV3C 4LKSA 3KV4A 1JH5A 1Z78A 2ZKLA 3OGVA 5D8AA 3VL8A 4YVWB 3JBG3 4YZ4A 3IMMA 4M4RA 2XBO2 4AVTA 5FOBB 1XC6A 3PIJA 2ZGMA 4YG0A 3AK0A 1FV2A 4OHWA 4A6SA 3LA2A 5LBBA 2KXLA 2ZGSA 4EJRA 3WW4A 5A3LA 1CAWB 3C7HA 3I8TA 4NHLA 2NN8A 2TUNA 1SLBA 3I3MA 2D6LX 2LM3A 1H1AA 3AP4A 2RM21 4IESA 4JTNA 5DUXA 2WZR3 4U2AA 3GXUA 1DYOA 2WINB 4ZXEA 1JODA 3CJXA 1HDKA 1LOGA 1WD3A 3ZN6B 5FZ6A 2VZSA 3J9SA 3D82A 1H6XA 3MEPA 4Q4W3 4YM2A 2IVJA 2R32A 5IK8A 5DAWA 1ND2C 1VBD2 4Q4X3 3AP7A 3AYDA 3TEZA 4OI4A 5E88A 1AR71 1O8SA 1EV12 2A6YA 4AI1A 3EQEA 3PUSA 4CCDA 4IV1B 4XC9A 3OPTA 5JZGA 4BK4A 2BBAA 1J83A 2FCTA 3ZFFB 2B8MA 3AMHA 4YW6A 3DKWA 1HLCA 1BLZA 1R1A2 2QJVA 3KQRA 1LOFC 1POQA 2VW0A 2VG9A 1AZDA 1BBT1 5APAA 1QOOA 5LBFA 1W6PB 4AYUA 1N1SA 4R4ZA 3JB8A 5IAVA 1DQ1A 2A5ZA 1Z7S3 1ZRDA 1SBFA 2D43A 2CHHA 1EAH3 4Y1XA 1GV9A 1WD4A 1BJQA 3B01A 5FRAA 4LBOA 1AR92 1VAMA 2QQVA 3N9MA 2NYYA 5J1XA 1CQ9A 3VBSA 1CN1A 3N35A 2YDEA 3DN7A 5FZBA 3HBKA 1K5MB 3NNMA 4YGDA 3MHZA 3AVRA 4ZZ8A 1RUE3 3CHXA 4GD4A 1F8VA 4Q0UA 3EJKA 1J3PA 4HANA 1POV0 3O1VA 1XBFA 3I2FA 4KL1A 3B9CA 4P5YA 3ROUA 1QJZA 1QQP1 3J7HA 2BNNA 4LHNA 5FTTC 2BTVC 4XYXA 4GH4B 4AEDA 5J36A 2YGMA 1GP5A 3H1YA 4CP1A 1XOYA 3VHRA 2PLV1 1NE4A 3DECA 2VMCA 1GZ9A 1U5IA 4N53A 3POSA 4BPZA 2AC1A 3K51A 4LO7A 1UX7A 5A3NA 5FV3A 2E26A 3ZN4A 3H3UA 5I0SA 5JPMB 1J3QA 2ZHMA 2UY8A 3MBWA 1NCQC 5C70A 1Q3EA 4YWAA 2UYBA 3THDA 4CPBD 5ANQA 1GZCA 2HWB1 1NAEA 2C1FA 1LHOA 2Y6KA 5FZ8A 1MVEA 4QX0A 3TNPB 2G19A 4IE6A 5FK7A 1XNTA 3NJYA 4E27A 3AL6A 2ARBA 2JKXA 3WHUA 4JVAA 5D1IA 1JOBA 3MV01 2ID4A 2D3PA 1AYN3 2CU5A 4QQLA 1W3VA 3H3ZA 1DQ6A 1L3JA 2VMDA 3OBTA 1E5HA 2WQZC 4MLOA 3PLQA 2ATFA 4Y20A 2VVEA 3USUA 2B45X 2ARCA 1QJU3 3SEEA 5FPBA 5A3TA 5K7PA 5L7OA 1AL21 2XJPA 2IWGB 4Y5TA 5BYNA 1S0FA 4KNCA 5HXMA 2BDRA 5JSOA 3UV9A 5FQ0A 4MO3M 3ZSLA 1DU3D 1PZ7A 1UY0A 4NPRA 1DGRA 1BKZA 3ZXDA 2QDNA 3KGLA 3LFMA 4JDNA 1GOFA 1L7QA 1Q8SA 2VBPA 2RJLA 3TNQA 2PFWA 1DQ0A 2E7TA 2RMU2 3GBGA 4Y1UA 2L9LA 1UOBA 5KXBA 4TZDA 4JDOA 1A8MA 1LULA 1J58A 4JDMA 2RS31 5C3SA 2OA2A 3EBRA 1ACCA 1PO13 2P1BA 2ZZQA 3UL2A 4Z07A 3VD4A 1QU0A 3I2HA 3ZN5A 5E1RA 1KRIA 1KS4A 2VCBA 1VMJA 1W9SA 4D0QA 3ETPA 4NHKA 1NA1B 2K46A 4Q27A 5KHIA 5ACA1 1CIWA 1W8NA 1MS8A 4BE3A 2B39A 4WZFA 5JXHA 3WDYA 2ZGOA 1LGCA 4LHSA 3J26N 1JUHA 2QE3A 3ZSEA 3O0WA 2VMFA 4EZ4A 1I5PA 2QFEA 1O4ZA 1SDDB 3SMHA 1SPPB 1ZVFA 1QDCA 1OUXA 4XUOA 4LR4A 5B4NA 2F4LA 2HYKA 1SQ4A 2JEMA 1SFNA 3SHRA 1T6BX 4UF0A 1LJ7A 4LQRA 5EIYB 1W6MB 4LIUA 3LEGA 2K0GA 1XQNA 3P3PA 1BHGA 4I3PA 1G9CA 2BZDA 4P00B 2UURA 5J7MA 3NV4A 1OH3A 1YC61 1IPSA 2WSVA 1CAXA 3N7KA 3NJXA 4IUGA 4LNVA 2OX0A 1VBB1 4J1XA 4V1PA 1NLRA 5IK5A 1D4VB 2Y0OA 2AUYA 4IV3B 1PVC2 2XDVA 2QQUA 1DQ2A 1FPN1 2K9ZA 4W8JA 4I0BA 4XJZA 4AG4A 4MG2A 1JZ8A 5EQUA 2DFCA 3T0AA 3JQXA 1UAIA 1REDA 1AHSA 2W47A 3I2IA 4MXWA 2VMEA 5ISLA 4NWVA 1QJX2 4LEJA 4DUVA 2HWE1 4LLOA 1O3TA 1IGOA 2DTYA 2JD9A 4FOYA 3BGAA 3N9NA 1YFYA 3UK9A 3WW1A 1AYM1 1DF0A 3R05A 3KVBA 4ES8A 1J59A 2OPKA 3U0ZA 2OUHA 4FPGA 5FPXA 1EUUA 4FOVA 3ORJA 3FZ3A 3POFA 2ZGQA 1C8M2 3FUQA 4GB33 4CDQC 2ZCWA 1GP4A 1ND2B 1W06A 1S55A 1CGPA 3AL5A 4Q4Y2 3CIHA 1JZ7A 4QPIC 2DURA 3OGGA 4RD7A 4XDOA 1N1TA 4KH9A 1JUIA 1U5ZA 2XXZA 3TWIA 3HWJA 5DG2A 2R042 1J3RA 3AZZA 3RZKA 2GC1A 2HWD1 5EYYA 3MIGA 1W8OA 2I74A 5FY4A 4RGAA 2YPJA 2IZWA 4DQAA 4BM8A 4QQOA 5T5OA 2YFZA 4J6GA 1FNYA 3NV1A 3T2PA 1YQ2A 3ZXJA 1Q8VA 4OMDA 1I6XA 5AC92 1QH7A 3IDAA 3OEAA 4D3WA 3KV5A 2W92A 1CR7A 2VNVA 3IWZA 4QKDA 3V0BA 2VUDA 1BMV1 3V64A 1SLAA 2VUCA 4FPEA 3F2ZA 4RHV1 2LRPA 4RFT0 3L2YA 1CIYA 2HWF3 2X29A 1OOPC 4LBQD 2AH2A 2JKBA 2ZGLA 1CX4A 3J8F1 4HVQA 3RZJA 3VV1A 3ES1A 4DXTA 1GNZA 3L9JT 4R52A 3VBOC 2DDUA 1NG0A 2D3RA 3WUCA 1EYBA 5F5CA 1V6MA 2IVIB 4Q0VA 4AOCA 3HMYA 5F3EA 2J22A 2Z5WA 5L9RA 1LTEA 5FZAA 1VB4A 4CUGA 2JIGA 2ZKNA 2JDUA 1GQGA 3ETQA 1H8TC 2XLGA 3DPRA 5IUQA 5CFDC 4AQ6A 1DLLA 3GHNA 1S0CA 5JOXA 1FMD2 3M3QA 2BFUS 5C6CA 2BGPA 1F15A 1IZ3A 1LEDA 1WCKA 3MW2A 3B5LB 1UMHA 5DQ0A 3AZYA 1K5JA 4LIVA 4SBVA 4D7TA 4YSFA 5FWJA 2QQKA 2W87A 1WA4A 4K20A 1WKYA 4RYDA 1WCQA 1WW7A 2EIEA 4Y5Z0 1BVP1 1N3PA 3OYWA 5FZGA 1F2NA 1NCQB 5H9QA 1T2XA 1TG7A 1C28A 1NZIA 2DVFA 3IM0A 3AJYA 4EWAA 2NMNA 1GU3A 3VGIA 1HV1A 3T0BA 2D3SA 4BZ4A 2BGOA 1CESA 3VBUC 3ITQA 5FZ4A 5BV6A 3LEKA 1NCRA 1DHKB 4I3GA 1LB2A 3LE0A 2H0VA 4B1LA 3ZXGA 1ASJ1 1OF3A 4AE2A 4QHBA 4XFIA 2YV8A 4LA3A 3OD0A 5FREA 4MGSA 1V6NA 4FO9A 1H2NA 2R30A 4NO4A 4XEZA 5ABJC 3U4XA 4NIDA 4FFFA 2H6CA 4AF9A 3CDZB 1RUH2 5A3MA 4KWUA 1CONA 2ZEYA 3K46A 4M3CE 3WSOA 4E2SA 1OKQA 2X8KA 4JQRA 5JSPA 3TB0A 3TN91 2D5HA 5BNPC 3D3AA 4TYSA 1CAUA 1ZRIA 2FBEA 3MPBA 3MZHA 3MF9A 1AL0G 3VDDC 2GMPA 4ORFA 4LO4B 2WO2A 3MIEA 2P3JA 2QKDA 4IEVA 2DCJA 2XH6A 1R093 3I2KA 3MUY1 4LITA 4ZXKA 2C6SA 5JOZA 2XB6C 1O3RA 3H7YA 4DS0A 2V5YA 3VD5A 2MEV2 1XYNA 2W95A 4CDXA 1R1ZA 2J42A 5LASA 3W9AA 1RUD3 3H1WA 5GLZA 3HVDA 1CAVA 1HW5A 1X8MA 1F5FA 1XYPA 2V72A 2WAAA 2WN2A 1B35C 1HQNA 1MS1A 2EXJA 3WG4A 3JBG1 3K48A 4Z92B 2J1UA 1ZA4A 5K0UA 5FY7A 5A6ZA 1ZBA2 2A6ZA 2ZX3A 1NY72 5A32B 3D0JA 5FP9A 5IVBA 1ENQA 5FZ0A 1RMU3 3CO2A 5CKMA 1V9U2 1ZX5A 5CFCC 4G9SB 3VHOA 2JG9A 3O1UA 3OSDA 1DP0A 5A3UA 4YGBA 4JHZA 4KGGA 3BTZA 2R063 1ODNA 4PDWC 1IS5A 1QJY3 1J84A 2YXSA 4PF1A 3I54A 4UBGA 5H9PA 2WZR1 1WMDA 3JD72 2DWRA 4N7UA 2W46A 4Z1VA 2LUWA 3I3BA 5T52A 4LUMA 4Q4W1 2E33A 3PURA 5A70A 3U4SA 1CJPA 4Q4X1 1ENXA 1VBC2 4CCCA 4JGZC 1UXXX 4P08A 2DU0A 3TOJA 2CAVA 3DXUA 5ERLA 1MVQA 1W0OA 1MEC3 1MQTA 4RGKA 1UX6A 3JQWA 1JTZX 4NJ4A 4K8RB 2GAUA 3RQ0A 2ARXA 5A3OA 3QLQA 3V56A 3H8XA 3RYPA 4H2AA 1D0HA 1U12A 3NV3A 4P9IA 4ZS3A 4JQTA 4CEYB 2X09A 1WW4A 4CDQB 4PCRA 5A7OA 1UMIA 3B69A 1LGNA 2BVBA 2VUAA 3EXUA 2BERA 3I59A 2ZHLA 4QPIB 3OGSA 3MLJA 3VBFC 4I02A 3BVCA 4COWA 4KG8A 1V6JA 4YVWC 4UW5A 4AI9A 1XSQA 1Z7S1 2BWAA 3MGUA 3RRDA 2DYCA 1WCSA 1IG3A 1QXPA 1W6NB 2VBBA 1EAH1 5FY5A 3QCWA 2XLFA 5CA6A 3VZMA 2GH2A 3BALA 4PIXA 1W90A 5K9YA 2D5FA 3M3CA 1JYVA 4HKOA 3I3EA 1VBE3 1H1IA 3O0VA 1PK6A 5IVEA 1I9RA 1WMEA 5CU1A 3BUCA 1W39A 5LK5A 1RUE1 4NPLA 2ZABA 1US3A 5AVPA 3VBHC 5GJ6A 2ZZJA 4XHXA 5BY5A 1BEV2 4OUSA 2BV4A 4BYYA 1HRV2 4LO8A 4RQPA 1OOPB 3NWKA 3OUIA 3RYRA 5A6QA 5HV0A 2D6NA 5C4WA 1JYCA 1LOEA 4YW4A 3K2OA 1VBA2 2BP6A 4A7ZA 3VBOB 4IV1C 3P6BA 1DCSA 2TBVA 4NRQA 4LBMA 5E8AA 1AF9A 3ZFFC 4M0HA 1OT5A 2VZ1A 2XL7A 1OLME 1UY3A 1D7PM 1PIV1 2WL1A 3SKVA 3VHPA 5C3QA 3RGBA 5I0DA 2XBO3 3WG1A 3UGFA 1JYTA 3HQRA 3OUHA 4C1WA 3LSDA 3CF6E 4BXSV 1OA2A 2R1DA 4I0WB 4UW4A 4UBHA 1QMJA 3KM5A 3CNAA 3M4FA 2PELA 2ZEZA 4X8NA 4XF9A 4DFSA 5CFDB 1GWLA 1ND3A 1PM7A 2R072 1RUJ3 4JKLA 3WNMA 1RTVA 4QXKA 3RYKA 5LK7B 4Q2FA 4LTAA 1WLCA 2W9XA 1UU6A 2H6BA 5GALA 2AENA 1AYN1 3R4SA 1AJKA 4DY3A 1LENA 1WLDA 2Y6JA 3HOBA 2VOXA 3DXTA 4KWLA 1QKQA 1VBD3 5DAQA 2BBVA 1QJU1 4XVHA 1MR5A 1YFXA 4TLFA 4QX5A 5IHRA 1OVSA 5A7WB 1GNYA 1EV13 1GOHA 5GLWA 2EALA 3WT3A 4NN0A 4QGMA 3VBUB 2YB7A 3UKVA 5JXJA 3MO4A 1SBDA 4DXSA 4C90A 1QQP2 3PTYA 2WO1A 3LDKA 3ZYFA 3U10A 1R1A3 1BZWA 2CWSA 4ZPIA 3W58A 5LATA 2J7MA 4DB5A 2R16A 5GZEA 1PO11 3E1F1 4IE0A 1X7NA 1N47A 4A7KA 4UW3A 5DZGA 5ABJB 1YFUA 3O7OA 2IXLA 1D4M3 3WF2A 3J7NA 5AVAA 5DUWA 4UW6A 3CEWA 1DQ5A 2OQ7A 2XVGA 5T3NA 4HBNA 1JU4A 5F5AA 3ZLIA 1UYXA 2ZX0A 3OG2A 4IXLA 3WD5A 4JGYC 4PLNA 1GWKA 1AR93 1QEXA 2BWCA 2JE7A 3CJIA 5BNPB 5C71A 2CGPA 2JDPA 4D8MA 2WNEA 3VDDB 1CD3G 5JLVA 2VZTA 4FP3A 3M8LA 4PI2A 1PGSA 1F5JA 1RUF2 3I97A 2QQJA 3V0AB 3A0NA 1RUC3 2VTXJ 4FVVA 4CXWA 1E5SA 1OUSA 2PHTA 5DXDA 2WT1A 1RVF2 3FHAA 4M3CB 4CCLA 2BUKA 2DBIA 4UFKA 1CX1A 4JTOA 2OIIA 3ELNA 3BPZA 1KEXA 2PQSA 2P3YA 3R4UA 2WSUA 4QD2A 1YO8A 2Y26A 5FLJA 4PLOA 1DBNA 2VZOA 4XJAA 4HMZA 1W2OA 1LHWA 3OBRA 4OI1A 1B35B 2AEZA 5JR7B 1V70A 5IATA 4NHYA 3FE5A 2YY1A 3HQUA 3M3EA 1YWKA 2Q30A 4GMP0 2UY9A 4ISRA 1QY4A 5KC6A 1HRI2 2A3YA 2G4IA 3CLPA 3M2MA 3VZOA 1RIRA 1UOFA 3RWKX 3GJAA 3WX5A 2YU1A 4G4FA 1GQHA 1IS3A 4W6WA 1RUG2 2DVBA 2VOVA 2ZMKA 1OMIA 5CFCB 3HAGA 1UZYA 1DLCA 1P8JA 3U1XA 3IIIA 1IPKA 1C1LA 1D2QA 1K3IA 1NA1C 2I45A 3ZYHA 2OZJA 1MS0A 2W68A 3K77A 3MLLA 1X33A 4XF1A 3VBRC 2QQIA 5ACA2 2D97A 2P17A 3KS7A 4Y1VA 4DEVA 1Q5OA 4Z2AA 4FPKA 5I0TA 5IK7A 1O5LA 4GB31 4IGQA 3SISA 2VULA 2WC2A 2K2SA 5I91A 2WT2A 4BLIA 1B09A 4UOJA 4JGZB 3H8OA 3JCIA 1BCXA 5FYBA 4LK6A 3U14A 5LW9A 1F35A 3IIAA 3OEBA 2ILMA 1Y9QA 3W5MA 4PLMA 2WNUC 2DVGA 4MHUA 4AEJA 3P1IA 2J1SA 3ZFGC 1BK1A 4XFBA 5A33A 3USSA 2OS2A 1OI6A 1AR82 1VBB2 4P5HA 2XG3A 2X10A 2VQ0A 3HNYM 2DV9A 1FPN2 4CXXA 4AL9A 3OD4A 1MS9A 4BCUA 3HN3A 1K5MA 4HKWA 4ATFA 2WO7A 5F39A 5FFOC 1W8FA 4CZSA 1MPXA 3POBA 4S2HA 5FUPA 4A41A 3PJYA 2D6MA 4MSVA 2Z69A 4OUEA 5IVYA 4A6OA 4AGVA 1GZTA 2VCMA 4FCAA 5JOWA 3I2OA 4TWTA 3BI3A 2AREA 3AVSA 5I0UA 1E57A 1QOTA 1PNFA 2JWPA 4FXKB 1JYXA 1UIKA 4XZPA 4GH4A 2Y6FA 3E5XA 3RG0A 4DOUA 3ZMOA 1CZVA 2RS52 3VBHB 2WFF3 2C5DA 2FDFA 5DABA 2ETEA 1UWWA 3TRSB 5J09A 1IHMA 5FZDA 3CZUA 2FHRA 3LFIA 4HETA 4HZFA 4META 5DDJ2 3UKTA 2HWC2 1OURA 5C9AC 5JDBA 3MW3A 1MS5A 4BIOA 4TN7A 4XUPA 3AB0A 1NLSA 4GJYA 4KMQA 3WG2A 2G9FA 2IXIA 1Q8QA 2X5IC 4IDZA 4F83A 4XUTA 1AR63 4FPHA 4XBLA 2NLRA 2Y8KA 4H7LA 4IGOA 4UFLA 1UYYA 5A3WA 1F4HA 4OQ8A 2A7AA 1AX1A 3WDWA 2VW2A 5SV8A 2XJUA 1QJX3 4QDRA 2FDHA 3E97A 4COUA 4BQ5A 5L36A 4A44A 1NOVA 4WZCA 3WNLA 3WR0A 4HPKB 4IL7A 2DUQA 3RZHA 3TEYA 5A80A 4AI2A 1VPHA 2EXHA 5A1FA 3ZDSA 1J1LA 1YJLA 4XQ4A 1U0AA 3M7AA 2R7EB 2XOMA 5F3IA 3SCHA 1N3OA 3MIHA 5F32A 4X8PA 3B9IA 3WDTA 1W9TA 2VVFA 2GC2A 3ZR6A 3AP9A 1W2NA 4N43C 3ALQA 4XAAA 2VO5A 1ZRRA 1O6UA 1OKOA 3BTAA 3DV8A 4R4XA 3ZXKA 4AHWA 2X53S 4B29A 5BNNC 2B7YA 4Q4Y3 3WLUA 3K4DA 4K6BA 4DPNA 3VDBA 1HX6A 3VZNA 1OLQA 1WMFA 2VNOA 5C8CB 2WLQA 4XFCA 2XQRA 5IVCA 3O1OA 4IEXA 2WO3A 2EIGA 4QMAA 3ZXFA 2R043 1UIJA 2GMMA 4BMBA 2XVKA 4RS5C 3TBDA 5FZOB 4QT6A 3FLPA 1Z0HA 4LXLA 5EJ1B 2Q8EA 1QNWA 4CCJA 1LHUA 1PM4A 3O14A 1I3HA 3VZJA 3OPZA 1NKGA 2QQOA 3GDBA 4QQ2A 3A23A 3KD4A 4XHBA 1HN0A 3KLSA 3MIFA 1KDMA 4FOQA 2XLAA 2A71A 1SPPA 3N9PA 4YVSA 2XJVA 4LA2A 4PJYA 3NKTA 3RNSA 4JGYB 3KHCA 3IPVA 4EZHA 2Y0IA 1YJKA 1W3XA 1GUIA 4CPBA 4E2QA 5LZ6A 1W6MA 3N3HA 3MPPG 1RUD1 5FZ1A 5SV5A 1FT9A 4LKFA 3QD6A 1W04A 4P9LA 4EN9B 3EB7A 4AI8A 4XDQA 2ZGRA 3AKTA 4IE4A 3LIGA 2BW8A 4L9BA 5DZFA 4IV3A 5LCWL 1O3SA 5BPXA 4CU9A 1FX5A 1TMF2 1ASJ2 1RC6A 4QDSA 5JIAA 1VAVA 2WT0A 4QB1A 2NP0A 4XCAA 3TEWA 1RMU1 4D7SA 2FDGA 4ES9A 1Y9GA 4M0NA 5JZGB 4NAMA 1FMD3 5FXXA 4CA9A 1SDWA 1VRH2 1HV0A 4OI0A 2GN3A 2J1TA 1QJY1 1ZBE3 2BPA2 1XNKA 4XFAA 4FQZA 4YRDA 3MIDA 3HPNA 5FZCA 1UMZA 5CISA 4CRQA 3BKZA 3GJBA 1TME2 1ZRFA 5CZKA 5FZEA 4WV8A 4LOSA 2E63A 4CCKA 4AW7A 3HIFA 2XWBB 2AGSA 3THPA 5F3CA 1ND2A 1PO23 4LO5B 1QDOA 3WQ7A 2DFBA 1C5IA 1MS4A 1MEC1 1ULFA 3ILNA 2FMDA 4OZXA 4URTA 5IAXA 4DXRA 3VBRB 1MACA 3NW4A 4ZS2A 2PHUA 4FPLA 5FYUA 1C3HA 4XFHA 4MZUA 2I2SA 4AVSA 2RR13 2ENRA 3T30A 1KJLA 1K12A 1RJ7A 1JOJA 4R9AA 2BOJA 1W8HA 2ZMLA 1UQXA 4OVEA 2RHPA 1LOFA 2VL4A 3KV6A 3KT1A 3K75B 4MGYE 4DZGA 2E32A 2VC9A 3ZFEC 5F37A 4WM7C 5LA9A 1XNAA 1SZBA 2MPFA 5KWRA 3S5QA 2O8OA 1C4RA 5EPAA 5DZEA 5IJRA 2HEVF 4GWIA 2WNUB 4NIIA 1S0JA 4XJ9A 1CPNA 3RPQA 3RI8A 4B7KA 3BTYA 1H30A 3ZFGB 1OQDA 3KSCA 1W0NA 4LHLA 3IN9A 2J1EA 2Y34A 1RUOA 2JJ6A 4PQQA 4FT8A 3A0KA 1VBE1 3ECQA 4V2WA 1UW8A 5ANNA 2KM2A 4XFFA 4O9EA 5T5LA 3Q8EA 4XOGA 5FIXA 1UU5A 3ZOIA 5JVVA 5DMYA 3BIEA 1C8NA 3ENRA 4MX3A 4K8FA 1QGLA 1ZZCA 4ZZ5A 2ADDA 4FPOB 2MEV3 2ZGNA 4PF5A 3ZO0B 3ZYIB 2JECA 3N36A 3FL7A 4NE9A 2WLPA 3KCYA 4CUBA 4IEWA 2CV6A 2XUMA 4HK9A 1H2LA 4WM8C 4BQ2A 5EXOA 1COV2 1MZEA 1TQ5A 3A4UA 3WP3A 2PHFA 2YU2A 2JB8A 3RDIA 3I3DA 4CEYC 1DFQA 4WVWA 2HJIA 2VZRA 2XBO1 4UAPA 5C9AB 2VR4A 1W8WA 3DUIA 4MUVA 4HL0A 4NR1A 1G8WA 1N1VA 3IDEA 4QB2A 4DO0A 2MHFA 3WINE 2VOKA 3ZXLA 2D6OX
chains in the Genus database with same CATH topology
4GZ9A 1RYYA 2Y6GA 1DP0A 4JHZA 3CKHA 2CDPA 2C9KA 1J84A 1KGYA 4PF1A 1XPWA 2W46A 3IAPA 3I3BA 3CQOA 2J1AA 1L7RA 2V5DA 4QX3A 2E33A 5DPNA 4ZY9A 1UXXX 4P08A 1O59A 2VTFA 3WNNA 3FN9A 4BDVB 2C26A 1HN1A 2WDBA 2XHNA 3THCA 3OGRA 2VZVA 3UESA 3DYPA 3ACIA 1NUKA 2X09A 2W1WA 3ACFA 3C8XA 1UMIA 2BERA 3T0DA 2YFUA 3OGSA 3I2JA 2XONA 3GGLA 2YC2A 2YC4A 3LEIA 2W3JA 5HPOA 2JDAA 2VQUA 3DYMA 4QB6A 4QPWA 4KI5M 3FHQA 2WYSA 3HJRA 1JYVA 3I3EA 2ZEWA 2B9VA 2RVAA 4M4PA 3T09A 2ORZA 5LA1A 5A1AA 4XURA 2W91A 1US3A 4E8DA 4XZUG 1UY1A 3W5NA 5EJZB 4ARXA 2V4VA 4W4ZA 4MOAA 2VZQA 3A7QA 1US2A 5JR2A 5JXGA 3VDCA 3ACGA 1O8PA 3PUIA 3VD3A 2VZPA 4JKKA 1UZ0A 3P6BA 1OT5A 2VZ1A 5F7UA 5JXIA 1UY3A 1D7PM 5DN2A 4LKSA 3SKVA 3WNOA 5I0DA 3OGVA 2WQ8A 2QQNA 2W1QA 4M4RA 1XC6A 4BXSV 3NJVA 2ZEZA 5LA2A 4L0PA 4JKLA 4MADA 3WNMA 3C7HA 1JU3A 2W9XA 4QX2A 2WN3A 2WZEA 2EICA 3GXUA 1DYOA 4ZXEA 5LA0A 2RV9A 2Y6JA 2VZSA 3HOBA 1H6XA 2J1RA 3VD7A 2EIBA 4XVHA 5IHRA 3WF0A 1GNYA 1GOHA 3T2QA 1O8SA 2YB7A 5JXJA 3MO4A 4DXSA 2OKXA 4BK4A 2WO1A 2BBAA 1J83A 1JZ6A 1SHWB 5G04L 3T08A 4MGQA 2J7MA 3E1F1 5G05L 3GM8A 3WF2A 4QAWA 1JU4A 1UYXA 1GMMA 3OG2A 1ULPA 2VJXA 2Y6LA 4D8MA 2VM9A 5J1XA 1PX3A 4A42A 2VZTA 4HG6B 2VCCA 1K45A 4ZZ8A 3I97A 2QQJA 5IFTA 2WABA 3FHAA 2W1SA 1CX1A 3I2FA 4P5YA 1CZSA 1KEXA 2PQSA 3J7HA 4CUCA 4ARYA 3U37A 3WQBA 3WNKA 2LS6A 3WF4A 2VZOA 3ZM8A 3DECA 3HNBM 2VMCA 3SKJE 1JZ4A 4FI9A 2QQLA 3CMGA 1UX7A 1F4AA 1LNSA 2E26A 2Y6HA 1JYNA 4LPLA 4OMCA 2VCAA 3MBWA 5C7GA 5C70A 3DYOA 3THDA 1P8JA 1DLCA 3IIIA 1NAEA 1K3IA 2Y6KA 1OF4A 4QX0A 4AAXA 3K77A 1XNTA 2QQIA 2W5FA 2JKXA 4DEVA 3A21A 4Z2AA 3MV01 2ID4A 3BN6A 2WAOA 2VMDA 4A4AA 4UOJA 5JUVA 3NRUA 2B4KA 3SEEA 4ET7A 1OD3A 3OEBA 5HXMA 3W5MA 4MO3M 4OYUA 1PX4A 3UNPA 1UY0A 3NQHA 3NNGA 3IAQA 1GOFA 1L7QA 1UY2A 2J1SA 3P1IA 2L9LA 2WUHA 1W9WA 2X10A 3HNYM 4GWJA 3VD4A 3I2HA 3HN3A 5FUIA 2VCBA 1W9SA 4D0QA 3ETPA 2YG0A 1MPXA 3C7EA 4A41A 4OUEA 4A6OA 5IYYA 1W8NA 2VQTA 5JXHA 4LHSA 1JYXA 2VMFA 1I5PA 1JZ5A 1H6YA 1CZVA 1SDDB 1IQDC 2VOTA 4XUOA 1UWWA 3HEIA 5B4NA 3CZUA 2QQMA 3A22A 1TVGA 4LQRA 5EIYB 3LEGA 4XUPA 5C71A 1BHGA 4PT6A 2BZDA 4P00B 2HYXA 4KMQA 4IUGA 3NJXA 4XUTA 1GOGA 2Y8KA 2ORXA 3C7OA 1UYYA 2WZ8A 1F4HA 3K4AA 4W8JA 3C7FA 1UYZA 4AG4A 1JZ8A 1JHJA 3T0AA 4QDRA 4BK5A 2W47A 3I2IA 4A44A 2VMEA 3WNLA 4DUVA 1W99A 2JD9A 3BGAA 1UY4A 2R7EB 2XOMA 2W94A 4DEQA 1K42A 1W9TA 2VO5A 2XQXA 1EUUA 4CU8A 4P02B 1GQPA 3AC0A 3K4DA 3VDBA 3CIHA 1JZ7A 2LW8A 1JI6A 3MUZ1 3EYPA 2WO3A 3MV11 3HNMA 3C7GA 5EJ1B 1W8OA 3ABZA 3VDAA 3PUHA 1NKGA 1NX9A 2QQOA 3GDBA 3A23A 4CU6A 2YFZA 3WEZA 3T2PA 1YQ2A 3WNPA 4OMDA 3IDAA 3OEAA 4CUAA 2W92A 3CZJA 1PMHX 1GUIA 3F2ZA 3JXSA 1CIYA 3LPFA 1ULOA 2WBKA 5B4XA 2KD7A 3VD9A 2Z4FA 1UXZA 4DXTA 3EB7A 2DDUA 5LCWL 2J22A 4CU9A 4QDSA 4CVUA 3ACHA 2W1UA 4QB1A 3I2GA 2Y64A 4UI9L 2DCKA 2J1VA 4DUXA 2BGPA 2J1TA 4A3ZA 4CU7A 1UMHA 3HPNA 1JZ2A 5DQ0A 2ZXQA 4W50A 2QQKA 2W87A 1WKYA 4RYDA 5CZKA 1WCQA 2QBXA 2C4XA 2EIEA 3T2OA 1CZTA 4OZOA 1T2XA 1TG7A 4YPJA 3SEPA 2JE8A 3LPGA 4DUWA 1GU3A 4DXRA 3T0BA 3K4ZA 2BGOA 4TXWA 3LEKA 4TTGA 1K12A 2X05A 4QDQA 3LE0A 2RJ2A 4XUQA 5CYYA 1R64A 1OF3A 5IFPA 2VL4A 3WF3A 3K75B 2E32A 2VC9A 4RN5A 1XNAA 4MGSA 5IJRA 2VZ3A 4GWIA 3CDZB 1JYWA 3UETA 4KWUA 3K46A 2ZEYA 3WSOA 2ZEXA 1W0NA 2J1EA 5JMOA 3OB8A 4PQQA 3D3AA 3ECQA 1SG3A 4E8CA 4QX1A 2WO2A 2EIDA 5DMYA 2VZUA 2DCJA 3MUY1 3IB3A 3I2KA 3LQCA 4ZZ5A 2E31A 2CDOA 2HLEA 3VD5A 3FL7A 2W95A 4CUBA 1JZ3A 1PMJX 4XUNA 1EUTA 2V72A 2WAAA 2WN2A 3I3DA 4JKMA 3WF1A 4JX0A 2VZRA 1OH4A 4UAPA 2VR4A 2J1UA 3OBAA 4A45A 4QB2A 4BJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZ9 A;  1RYY A;  2Y6G A;  1DP0 A;  4JHZ A;  3CKH A;  2CDP A;  2C9K A;  1J84 A;  1KGY A;  4PF1 A;  1XPW A;  2W46 A;  3IAP A;  3I3B A;  3CQO A;  2J1A A;  1L7R A;  2V5D A;  4QX3 A;  2E33 A;  5DPN A;  4ZY9 A;  1UXX X;  4P08 A;  1O59 A;  2VTF A;  3WNN A;  3FN9 A;  4BDV B;  2C26 A;  1HN1 A;  2WDB A;  2XHN A;  3THC A;  3OGR A;  2VZV A;  3UES A;  3DYP A;  3ACI A;  1NUK A;  2X09 A;  2W1W A;  3ACF A;  3C8X A;  1UMI A;  2BER A;  3T0D A;  2YFU A;  3OGS A;  3I2J A;  2XON A;  3GGL A;  2YC2 A;  2YC4 A;  3LEI A;  2W3J A;  5HPO A;  2JDA A;  2VQU A;  3DYM A;  4QB6 A;  4QPW A;  4KI5 M;  3FHQ A;  2WYS A;  3HJR A;  1JYV A;  3I3E A;  2ZEW A;  2B9V A;  2RVA A;  4M4P A;  3T09 A;  2ORZ A;  5LA1 A;  5A1A A;  4XUR A;  2W91 A;  1US3 A;  4E8D A;  4XZU G;  1UY1 A;  3W5N A;  5EJZ B;  4ARX A;  2V4V A;  4W4Z A;  4MOA A;  2VZQ A;  3A7Q A;  1US2 A;  5JR2 A;  5JXG A;  3VDC A;  3ACG A;  1O8P A;  3PUI A;  3VD3 A;  2VZP A;  4JKK A;  1UZ0 A;  3P6B A;  1OT5 A;  2VZ1 A;  5F7U A;  5JXI A;  1UY3 A;  1D7P M;  5DN2 A;  4LKS A;  3SKV A;  3WNO A;  5I0D A;  3OGV A;  2WQ8 A;  2QQN A;  2W1Q A;  4M4R A;  1XC6 A;  4BXS V;  3NJV A;  2ZEZ A;  5LA2 A;  4L0P A;  4JKL A;  4MAD A;  3WNM A;  3C7H A;  1JU3 A;  2W9X A;  4QX2 A;  2WN3 A;  2WZE A;  2EIC A;  3GXU A;  1DYO A;  4ZXE A;  5LA0 A;  2RV9 A;  2Y6J A;  2VZS A;  3HOB A;  1H6X A;  2J1R A;  3VD7 A;  2EIB A;  4XVH A;  5IHR A;  3WF0 A;  1GNY A;  1GOH A;  3T2Q A;  1O8S A;  2YB7 A;  5JXJ A;  3MO4 A;  4DXS A;  2OKX A;  4BK4 A;  2WO1 A;  2BBA A;  1J83 A;  1JZ6 A;  1SHW B;  5G04 L;  3T08 A;  4MGQ A;  2J7M A;  3E1F 1;  5G05 L;  3GM8 A;  3WF2 A;  4QAW A;  1JU4 A;  1UYX A;  1GMM A;  3OG2 A;  1ULP A;  2VJX A;  2Y6L A;  4D8M A;  2VM9 A;  5J1X A;  1PX3 A;  4A42 A;  2VZT A;  4HG6 B;  2VCC A;  1K45 A;  4ZZ8 A;  3I97 A;  2QQJ A;  5IFT A;  2WAB A;  3FHA A;  2W1S A;  1CX1 A;  3I2F A;  4P5Y A;  1CZS A;  1KEX A;  2PQS A;  3J7H A;  4CUC A;  4ARY A;  3U37 A;  3WQB A;  3WNK A;  2LS6 A;  3WF4 A;  2VZO A;  3ZM8 A;  3DEC A;  3HNB M;  2VMC A;  3SKJ E;  1JZ4 A;  4FI9 A;  2QQL A;  3CMG A;  1UX7 A;  1F4A A;  1LNS A;  2E26 A;  2Y6H A;  1JYN A;  4LPL A;  4OMC A;  2VCA A;  3MBW A;  5C7G A;  5C70 A;  3DYO A;  3THD A;  1P8J A;  1DLC A;  3III A;  1NAE A;  1K3I A;  2Y6K A;  1OF4 A;  4QX0 A;  4AAX A;  3K77 A;  1XNT A;  2QQI A;  2W5F A;  2JKX A;  4DEV A;  3A21 A;  4Z2A A;  3MV0 1;  2ID4 A;  3BN6 A;  2WAO A;  2VMD A;  4A4A A;  4UOJ A;  5JUV A;  3NRU A;  2B4K A;  3SEE A;  4ET7 A;  1OD3 A;  3OEB A;  5HXM A;  3W5M A;  4MO3 M;  4OYU A;  1PX4 A;  3UNP A;  1UY0 A;  3NQH A;  3NNG A;  3IAQ A;  1GOF A;  1L7Q A;  1UY2 A;  2J1S A;  3P1I A;  2L9L A;  2WUH A;  1W9W A;  2X10 A;  3HNY M;  4GWJ A;  3VD4 A;  3I2H A;  3HN3 A;  5FUI A;  2VCB A;  1W9S A;  4D0Q A;  3ETP A;  2YG0 A;  1MPX A;  3C7E A;  4A41 A;  4OUE A;  4A6O A;  5IYY A;  1W8N A;  2VQT A;  5JXH A;  4LHS A;  1JYX A;  2VMF A;  1I5P A;  1JZ5 A;  1H6Y A;  1CZV A;  1SDD B;  1IQD C;  2VOT A;  4XUO A;  1UWW A;  3HEI A;  5B4N A;  3CZU A;  2QQM A;  3A22 A;  1TVG A;  4LQR A;  5EIY B;  3LEG A;  4XUP A;  5C71 A;  1BHG A;  4PT6 A;  2BZD A;  4P00 B;  2HYX A;  4KMQ A;  4IUG A;  3NJX A;  4XUT A;  1GOG A;  2Y8K A;  2ORX A;  3C7O A;  1UYY A;  2WZ8 A;  1F4H A;  3K4A A;  4W8J A;  3C7F A;  1UYZ A;  4AG4 A;  1JZ8 A;  1JHJ A;  3T0A A;  4QDR A;  4BK5 A;  2W47 A;  3I2I A;  4A44 A;  2VME A;  3WNL A;  4DUV A;  1W99 A;  2JD9 A;  3BGA A;  1UY4 A;  2R7E B;  2XOM A;  2W94 A;  4DEQ A;  1K42 A;  1W9T A;  2VO5 A;  2XQX A;  1EUU A;  4CU8 A;  4P02 B;  1GQP A;  3AC0 A;  3K4D A;  3VDB A;  3CIH A;  1JZ7 A;  2LW8 A;  1JI6 A;  3MUZ 1;  3EYP A;  2WO3 A;  3MV1 1;  3HNM A;  3C7G A;  5EJ1 B;  1W8O A;  3ABZ A;  3VDA A;  3PUH A;  1NKG A;  1NX9 A;  2QQO A;  3GDB A;  3A23 A;  4CU6 A;  2YFZ A;  3WEZ A;  3T2P A;  1YQ2 A;  3WNP A;  4OMD A;  3IDA A;  3OEA A;  4CUA A;  2W92 A;  3CZJ A;  1PMH X;  1GUI A;  3F2Z A;  3JXS A;  1CIY A;  3LPF A;  1ULO A;  2WBK A;  5B4X A;  2KD7 A;  3VD9 A;  2Z4F A;  1UXZ A;  4DXT A;  3EB7 A;  2DDU A;  5LCW L;  2J22 A;  4CU9 A;  4QDS A;  4CVU A;  3ACH A;  2W1U A;  4QB1 A;  3I2G A;  2Y64 A;  4UI9 L;  2DCK A;  2J1V A;  4DUX A;  2BGP A;  2J1T A;  4A3Z A;  4CU7 A;  1UMH A;  3HPN A;  1JZ2 A;  5DQ0 A;  2ZXQ A;  4W50 A;  2QQK A;  2W87 A;  1WKY A;  4RYD A;  5CZK A;  1WCQ A;  2QBX A;  2C4X A;  2EIE A;  3T2O A;  1CZT A;  4OZO A;  1T2X A;  1TG7 A;  4YPJ A;  3SEP A;  2JE8 A;  3LPG A;  4DUW A;  1GU3 A;  4DXR A;  3T0B A;  3K4Z A;  2BGO A;  4TXW A;  3LEK A;  4TTG A;  1K12 A;  2X05 A;  4QDQ A;  3LE0 A;  2RJ2 A;  4XUQ A;  5CYY A;  1R64 A;  1OF3 A;  5IFP A;  2VL4 A;  3WF3 A;  3K75 B;  2E32 A;  2VC9 A;  4RN5 A;  1XNA A;  4MGS A;  5IJR A;  2VZ3 A;  4GWI A;  3CDZ B;  1JYW A;  3UET A;  4KWU A;  3K46 A;  2ZEY A;  3WSO A;  2ZEX A;  1W0N A;  2J1E A;  5JMO A;  3OB8 A;  4PQQ A;  3D3A A;  3ECQ A;  1SG3 A;  4E8C A;  4QX1 A;  2WO2 A;  2EID A;  5DMY A;  2VZU A;  2DCJ A;  3MUY 1;  3IB3 A;  3I2K A;  3LQC A;  4ZZ5 A;  2E31 A;  2CDO A;  2HLE A;  3VD5 A;  3FL7 A;  2W95 A;  4CUB A;  1JZ3 A;  1PMJ X;  4XUN A;  1EUT A;  2V72 A;  2WAA A;  2WN2 A;  3I3D A;  4JKM A;  3WF1 A;  4JX0 A;  2VZR A;  1OH4 A;  4UAP A;  2VR4 A;  2J1U A;  3OBA A;  4A45 A;  4QB2 A;  4BJ0 A; 
#chains in the Genus database with same CATH topology
 1SMV A;  1RUJ 1;  1NCQ A;  4COV A;  3ZPY A;  2ADE A;  3ZMN A;  5FPL A;  2X5I B;  2JDK A;  1RYY A;  4O65 A;  5FPU A;  2WRA A;  3ASI A;  2Y38 A;  1UPI A;  4OFG A;  2B9U A;  3D0S A;  1EAH 2;  1POV 3;  3CKH A;  1HQL A;  3VKL A;  2EA7 A;  3AXD A;  1SEF A;  4QX7 A;  2EXK A;  3IAP A;  3SLI A;  2J1A A;  1L7R A;  2RS1 2;  4K40 A;  2NQY A;  4ASM B;  3RZG A;  5FXZ A;  1VBD 1;  4QX3 A;  1RUI 2;  1VBC 3;  5FO7 B;  1RXF A;  2ET7 A;  1PGW 2;  1RUE 2;  3B00 A;  2ZTN A;  2XJS A;  2HKX A;  4Q0S A;  1RXG A;  1YI9 A;  2PAK A;  5JI7 A;  1EV1 1;  4FQ4 A;  3BIW E;  4PQ9 A;  3SH5 A;  3WNN A;  4BDV B;  3T1M A;  4AFA A;  1XYO A;  1ZNP A;  1HN1 A;  2XHN A;  1WBL A;  3WP5 A;  4XMI A;  4URA A;  4LBQ A;  4N43 B;  5K4L A;  3IMN A;  5HCB A;  4Y22 B;  1AXK A;  5E6H A;  4Q4V 3;  1R1A 1;  3UES A;  1XE8 A;  3ACI A;  3BU7 A;  2EXI A;  5JI9 A;  1GWM A;  3OGJ A;  4C91 A;  5BNN B;  5FP7 A;  1FI2 A;  1LR5 A;  1SFY A;  1U5X A;  1HJG A;  3KZ4 C;  4AEK A;  5A6Y A;  1V6K A;  1PIV 2;  1D4M 1;  2XON A;  3NO8 A;  2A3W A;  3UKN A;  1KJR A;  1URX A;  3LEI A;  4CDU C;  2CL2 A;  4K7J A;  4OUM A;  4ASK A;  4RS5 B;  2VGD A;  2MNG A;  4LE4 A;  4QB6 A;  3B3Q E;  5FJH A;  3IZO A;  1AR9 1;  1ULD A;  3ZVX A;  1YI7 A;  4D6R A;  3B02 A;  3FHQ A;  2WYS A;  2RDN A;  3FLT A;  4Q1R A;  4CE8 A;  4OHX A;  4QXC A;  1CVN A;  1M06 G;  3ST7 A;  2QZ3 A;  3T09 A;  5CB7 A;  1QJF A;  2DCT A;  1ENS A;  5LA1 A;  3EMR A;  2JIC A;  1RUC 1;  2W91 A;  4XUR A;  4E8D A;  1BEV 3;  2P6H A;  4K21 A;  3LIH A;  4UWD A;  3FWE A;  1O4T A;  2VNG A;  3H0O A;  4XZU G;  5EJZ B;  1HRV 3;  3H7J A;  1Y7B A;  2V4V A;  2ZOE B;  2VZQ A;  3A7Q A;  2P5B A;  3VDC A;  1YIP A;  5EP9 A;  1V6I A;  1SCR A;  1VBA 3;  4L2N A;  5D2A A;  1GR3 A;  3Q8C A;  2W0X A;  4HLT A;  3VD3 A;  1IS6 A;  3BOW A;  1LEM A;  3MIB A;  2VZP A;  2QCS B;  1FOD 1;  4ZU7 A;  1DDL A;  4LBL A;  1W03 A;  5JXI A;  2DTW A;  5DN2 A;  2WA4 A;  1O4Y A;  3AFK A;  1AUY A;  3TYJ A;  5F9T A;  3MW4 A;  4OCT A;  4Q5O A;  1OFS A;  2QQN A;  2W1Q A;  1PO1 2;  4YGE A;  3APB A;  1TZO A;  3ON7 A;  4LMF A;  4CDW C;  5LRS A;  3S0M A;  3NL1 A;  4CCO A;  3PME A;  2R07 3;  4HN0 A;  3AKR A;  1ALY A;  4CEW C;  5FO8 B;  4MAD A;  4DRR A;  4QGL A;  2CAU A;  1LCL A;  3SH3 A;  2N7G A;  1YYN A;  3POY A;  3RMX A;  5FPZ A;  5KBF A;  4QX2 A;  2WN3 A;  2PHD A;  2BRT A;  1GP6 A;  2EIC A;  1NXD 1;  5M0T A;  1MZF A;  2DVA A;  1O91 A;  1EY2 A;  3LD8 A;  4OQ9 A;  4CDQ A;  3D8C A;  3RZM A;  5FZF A;  2UYA A;  4JCK A;  3SCF A;  3V0B B;  3HQX A;  3ZIW A;  3VD7 A;  3H3L A;  1MZ6 A;  4E4H A;  2XJQ A;  4QPI A;  2QDR A;  2FDK A;  3NKG A;  4XXA A;  2ZAH A;  4RQP C;  3KGZ A;  3WF0 A;  3KCC A;  3T2Q A;  3WVJ A;  2JE9 A;  3NV2 A;  2XJT A;  3NAP C;  3Q8A A;  5T50 A;  2VNR A;  5EJ3 A;  2BNO A;  2OPW A;  1LKN A;  2P4E A;  4YW1 A;  3WNX A;  3OF1 A;  4KU8 A;  4YZ3 A;  4OHZ A;  5KXD A;  1EPW A;  1SHW B;  2SBA A;  3N9Q A;  4MGQ A;  1GSL A;  3QOP A;  2BJS A;  3ZFE B;  5C3O A;  4WM7 B;  4BQ4 A;  2WWJ A;  5A6X A;  3GM8 A;  4QM8 A;  5AFE A;  4D69 A;  4RL7 A;  4RSU A;  4AHY A;  5FP8 A;  4COY A;  1GMM A;  2HEW F;  3VN4 A;  1ULP A;  1G9A A;  1AXY A;  1OQ1 A;  2VJX A;  1ZZ8 A;  3WDU A;  2Y6L A;  1OOP A;  2VW1 A;  3OTF A;  2WS9 2;  2BVV A;  3UJQ A;  4K1Z A;  1PX3 A;  5LEJ A;  3N7M A;  4QQP A;  4A42 A;  2XL9 A;  5FO9 B;  3SNM A;  2YZ4 A;  3FJS A;  3AYC A;  3RS6 A;  2WFF 1;  2IXH A;  3VBO A;  3OYW B;  3O5S A;  1RUF 3;  1K45 A;  3IT8 A;  4UFM A;  2RDS A;  4YW2 A;  3N7L A;  4PIY A;  3SH4 A;  5IK4 A;  2G9Z A;  5GZC A;  5IFT A;  1HIX A;  1R08 3;  1RVF 3;  2WAB A;  3KT4 A;  3DEM A;  1UYP A;  3WP4 A;  2JX9 A;  3UGH A;  2W1S A;  3V65 A;  4XJ8 A;  4NUB A;  3GZT B;  1H8T A;  5AFB A;  1CZS A;  3LGR A;  5BNO C;  2NZ9 A;  4WM8 B;  2JDZ A;  4XF3 A;  4CP9 B;  5CFD A;  4XF0 A;  3MIC A;  3WQB A;  3POW A;  2D6P A;  4NIA A;  3WF4 A;  1AR6 1;  2G1M A;  1H4G A;  1NXM A;  3ZM8 A;  3HNB M;  2QZ2 A;  4QHZ A;  2ZGU A;  3GHM A;  4QGN A;  3SKJ E;  5F1R A;  5FWE A;  1JZ4 A;  1HRI 3;  4B1M A;  4UFH A;  1RHI 2;  4BHP A;  1YEW A;  3VKF C;  1QJX 1;  1WZX A;  4S2G A;  3ZYB A;  1F4A A;  5FMB A;  2Y6H A;  1BK0 A;  4LPL A;  1RUG 3;  5FYV A;  1WGP A;  2WQ4 A;  4E4Z A;  2VCA A;  3VKO A;  5CG8 A;  2CGN A;  2TEP A;  4YZ2 A;  3DYO A;  1D2S A;  4FBF A;  1ZRE A;  4IGP A;  4IEU A;  4YG6 A;  5A7W A;  1W6O B;  3ME2 A;  1DGW X;  3VBU A;  1JMU B;  2LAL A;  2VBD A;  1AXZ A;  3BPS A;  4YM3 A;  2D93 A;  4NHX A;  4LBK A;  2PHR A;  4LOT A;  4GKX A;  4Q4Y 1;  2RM2 2;  2WAO A;  3KMH A;  2NM1 A;  4MHR A;  5F6L B;  5FBZ A;  5KHG A;  3GCW A;  4OUL A;  4FAG A;  4GQ7 A;  3NRU A;  4IER A;  1HXS 3;  2HBU A;  4GKY A;  2YYO A;  4ET7 A;  1W6Q B;  5ABJ A;  2R04 1;  5CIR A;  3M1H A;  5C3P A;  1LU2 A;  3NQH A;  3NNG A;  3IAQ A;  3NST A;  3NNF A;  5HCF A;  1AR7 2;  2WNV A;  2GC0 A;  4AVB A;  1UY2 A;  5JSR A;  1JBC A;  1AR8 3;  1CJD A;  4CTE A;  5HCH A;  1X82 A;  3BCW A;  3I7D A;  2IXK A;  5BNP A;  1UN1 A;  5LEK A;  1AX2 A;  4ZHN A;  2WUH A;  3FUO A;  2ZX4 A;  4HOO A;  5EV7 A;  4HN1 A;  1SFP A;  5CKQ A;  5FP4 A;  3VDD A;  1UD1 A;  5HBA A;  4P9G A;  4L8Q A;  1YUD A;  4CDU B;  3WCR A;  4GWJ A;  2BU9 A;  3R4D B;  5LRR A;  4A7Y A;  4LT5 A;  1BBT 2;  1SLI A;  2LTN A;  3UYJ A;  2F17 A;  3WQ0 A;  2VU9 A;  3KQ4 B;  5D21 A;  2YG0 A;  4Z2W A;  3C7E A;  5E16 A;  5EWS A;  3V0A A;  2JG8 C;  4P9J A;  3SCG A;  5IYY A;  3O12 A;  4M3C A;  5L9V A;  1JW6 A;  4Y4Y A;  4AI3 A;  4YLZ A;  1VB2 A;  3PL0 A;  1X8E A;  3ES4 A;  5F6K A;  1MS3 A;  3T4H B;  2RS5 3;  1XU1 A;  2ZMN A;  3VB9 A;  4DNY A;  1JZ5 A;  3B93 A;  4XDP A;  2P2K A;  1IQD C;  2VOT A;  4XAB A;  1RIT A;  5TSW A;  1B35 A;  4BA6 A;  3IKW A;  3PUA A;  2R1B A;  4OI2 A;  3HEI A;  2XUE A;  5DDJ 3;  2HWC 3;  3WP6 A;  2AR6 A;  4QPG C;  1OC1 A;  4Y5S A;  5IVF A;  1RGS A;  2RJK A;  5A7Q A;  4YZ5 A;  5C5T A;  5C8C C;  2E7A A;  5I93 A;  4KU7 A;  5J98 B;  1FMD 1;  1A6C A;  3HT1 A;  2IC1 A;  4RR3 C;  1PZ8 A;  2CTV A;  2JXA A;  3E5Q A;  2GND A;  1S0D A;  3J7L A;  5CFC A;  1OPO A;  4CP2 A;  1ZBE 1;  2A73 B;  3GF6 A;  2DUO A;  4PDW A;  2EAA A;  3EHK A;  2ORX A;  3C7O A;  1LAJ A;  2WZ8 A;  4LUK A;  2PLV 2;  2V09 A;  4XE9 A;  5D8A C;  3O1T A;  3LAG A;  2GP3 A;  2O1Q A;  4CDW B;  4S2F A;  4YFW A;  4BOW A;  5A7S A;  5FYT A;  1PO2 1;  2IXJ A;  3J7M A;  4CEW B;  5H9S A;  3LOB A;  1DG6 A;  4JGZ A;  4JV4 A;  1W99 A;  3ACL A;  3O1P A;  4ASL A;  1W2U A;  2W94 A;  1FAT A;  2HWB 2;  2V4A A;  4DEQ A;  3OBZ A;  4AGR A;  1K42 A;  1JS9 A;  2RR1 1;  4H3W A;  3C3V A;  5JAX A;  4KG0 A;  1LRH A;  1E5R A;  2XQX A;  5J37 A;  1PZ9 A;  4DXZ A;  4YFZ A;  2ZX1 A;  2YBS A;  4J25 A;  3VBF A;  3PNA A;  3O0X A;  2LW8 A;  4RQP B;  1RUN A;  2IFW A;  5BNQ A;  3ZYJ B;  4Z82 A;  5C4W B;  4YM0 A;  4YVW A;  3EYP A;  1FAY A;  2DU1 A;  3NAP B;  1SLC A;  5FOJ B;  5L9B A;  3KT7 A;  1AL2 2;  4D6S A;  1GNH A;  1OPM A;  2WR9 A;  3B94 A;  1A78 A;  2Q1Z B;  1IQA A;  3RJ2 X;  3ABZ A;  5JZG C;  5K8S A;  4FP2 A;  3VDA A;  2ZGK A;  1NX9 A;  1CAW A;  1QJY 2;  2PHX A;  5GLU A;  3RZZ A;  3LZZ A;  3OY8 B;  2WII B;  2XR4 A;  2BEO A;  2D98 A;  3WEZ A;  1Y3T A;  5KR7 A;  2RS3 2;  3AMM A;  1JHN A;  3JB4 C;  2FDJ A;  3VBH A;  5KXC A;  5HV4 A;  4GA9 A;  2MEV 1;  1Q8O A;  3ZN6 A;  4CUA A;  1KIT A;  1QNY A;  2R49 A;  3T2T A;  5DAP A;  1LOD A;  2PYT A;  2QUO A;  3K3N A;  1PMH X;  1VIW B;  4P9X A;  2FMY A;  2KR2 A;  4QX8 A;  2E51 A;  3QAC A;  3LPF A;  2JD4 A;  1ULO A;  1H4H A;  2KD7 A;  1YQ8 A;  1UXZ A;  3GYD A;  1G9F A;  3UJO A;  3VBS C;  4AVA A;  2JB4 A;  2P3I A;  3JZV A;  4IV1 A;  4XIK A;  1S0I A;  2CNA A;  4YG3 A;  2QQP A;  1XE7 A;  3ZFF A;  4MGK E;  1TMF 3;  1V0A A;  3NMB A;  2SLI A;  1UL9 A;  3FBM A;  5FZ9 A;  4E2G A;  1NY7 1;  1OA4 A;  4CVU A;  3MYX A;  2E6V A;  3ACH A;  5FYZ A;  4V2V A;  5FCC A;  2W1U A;  1AJO A;  3FBY A;  5BNO B;  5FMD A;  5I8Y A;  1REF A;  2DCK A;  4OHV A;  1W6P A;  2PTM A;  2F4P A;  2XVL A;  4HPK A;  1DQ4 A;  1VRH 3;  5IT6 A;  1DYP A;  4AED C;  3AJZ A;  1POV 1;  2RMU 3;  2HH9 A;  4A3Z A;  4CU7 A;  1HKD A;  2HBT A;  1JZ2 A;  5FMO L;  5KXE A;  4XW3 A;  1TME 3;  2ZXQ A;  1VR3 A;  4W50 A;  1ZRC A;  1UF2 C;  2D7F A;  4N53 C;  5FZK A;  1OLM A;  3W20 A;  1VBC 1;  2QBX A;  3U78 A;  2C4X A;  5FY8 A;  1UO9 A;  5DG1 A;  3T3Y A;  3T2O A;  4AZZ A;  4BQ3 A;  5J3U A;  1CZT A;  1QOS A;  3KV9 A;  4YPJ A;  4YM1 A;  3WQ1 A;  4B4Q A;  3AMP A;  2JE8 A;  3SEP A;  5JOY A;  3CJI B;  3O1R A;  2HWE 2;  5A7N A;  4DUW A;  3PTR B;  2FZ1 A;  2HWF 1;  2P6C A;  3LCP A;  3POJ A;  3S30 A;  2Q4S A;  1IS4 A;  4Y1Z A;  4Q4V 1;  2VD7 A;  5FZO A;  4IQP A;  4E4S A;  3IDB B;  2X05 A;  4A2U A;  4QDQ A;  3ZKU A;  2YBK A;  2RJ2 A;  4XQD A;  2VMG A;  1AYM 2;  4XUQ A;  2XJR A;  2GSY A;  4DMI A;  5CAZ A;  4K1Y A;  1X50 A;  5DAX A;  1LU1 A;  2DVD A;  2A6W A;  4KWK A;  4NPM A;  2OYZ A;  4GJZ A;  3WF3 A;  1ULC A;  4BU2 A;  4E4D X;  5L7O C;  3HR9 A;  3HN1 A;  1SBE A;  3I3Q A;  2VZ3 A;  3GNE A;  1G9D A;  4CYD A;  1JYW A;  1GZW B;  4E9K A;  4JGY A;  4W65 A;  5JWP A;  1RUJ 2;  1ZYB A;  1BQP A;  2ZEX A;  1W8Z A;  1GIC A;  3L2H A;  3AP5 A;  3THT A;  4HSJ A;  1UU4 A;  4Q29 A;  2TNF A;  1PVC 3;  4YW5 A;  2HWD 2;  5FPA A;  4DRV A;  1T6G C;  5EFU A;  1ULG A;  3LEM A;  1NLQ A;  3ILR A;  4XQW A;  4FAH A;  3EO6 A;  4QX1 A;  4YAR A;  1GBG A;  2OT7 A;  2EID A;  2O0O A;  1GFF 2;  1BEV 1;  2P34 A;  4XAC A;  5LY1 A;  2R6Q A;  2AEY A;  1HRV 1;  4GAZ A;  2JG8 B;  1ENR A;  1RJ8 A;  1H2K A;  3E6C C;  2OVU A;  1OHF A;  2BNM A;  1LOC A;  1VBA 1;  5FXV A;  4BH9 A;  1JZ3 A;  1PMJ X;  5J96 B;  4XJU A;  1BMV 2;  4PHZ A;  1UOG A;  1OLR A;  5FKC A;  1COV 3;  4RHV 2;  5FZ3 A;  3D5O A;  2V73 A;  2BFU L;  2WYF A;  1EUT A;  1LHV A;  1W28 A;  3J8F 2;  1C8M 3;  3E6B A;  3WF1 A;  4JKM A;  4O61 A;  5HI0 A;  5LWB A;  4TLG A;  4WVM B;  2JDN A;  1OH4 A;  4AK3 A;  4OLL A;  4QPG B;  1KDK A;  2O14 A;  3OBA A;  2YGL A;  3DKQ A;  3WUD A;  5CAD A;  4NIH A;  4EV0 A;  1NQJ A;  1YLL A;  2CSG A;  2R07 1;  1D4M 2;  4MYE A;  4BJ0 A;  2QNK A;  3H8U A;  4Q0Q A;  4RR3 B;  2NPI A;  4GZ9 A;  1Q43 A;  1QF3 A;  2Q8O A;  1RL3 A;  4XTM A;  5A33 B;  5C33 A;  5FZM A;  3S7I A;  1NA1 A;  5FZH A;  3T1L A;  1XNB A;  3VBR A;  4D6Q A;  4AI0 A;  1KGY A;  2W39 A;  4P9W A;  1DIW A;  5D8A B;  1IKQ A;  2RS1 3;  3UGG A;  4AVC A;  5CKN A;  4B7E A;  1RUI 3;  4J1W A;  4Y24 A;  5AC9 3;  1R09 1;  3SC7 X;  3VZK A;  4ZY9 A;  2EF6 A;  4HK8 A;  4Q8L A;  1RUC 2;  4GWM A;  2UU8 A;  3RMY A;  4GMP 3;  1O59 A;  2WZP P;  3TEX A;  3W5N A;  1W0P A;  4Y26 A;  3T4V A;  2WA3 A;  2UWB A;  3FN9 A;  4K3U A;  2EVX A;  3DCQ A;  3H50 A;  1VMF A;  1XB9 A;  4LUL A;  4P9Y A;  5F2S A;  2WNU A;  1OXC A;  2AYH A;  3MFC A;  1QH6 A;  3OGR A;  3AKS A;  3ZFG A;  2VZV A;  4KWJ A;  1EP0 A;  1NUK A;  4QQH A;  4JZR A;  2GU9 A;  3ACF A;  3M70 A;  1UNB A;  1SLT A;  3GBF A;  3O1S A;  1FOD 2;  1W9F A;  1PIV 3;  2YFU A;  4N8M A;  1VMH A;  4Q8K A;  3OCP A;  3I2J A;  2QQW A;  4FPY A;  2YC2 A;  2YC4 A;  2YUE A;  4BWO A;  4F8A A;  2W3J A;  2JDA A;  1V00 A;  1WWY A;  4YNI A;  4QKN A;  3ZXE A;  4XMA A;  2E9Q A;  1OA3 A;  1KFX L;  3VL9 A;  2GH8 A;  4AEM A;  1YIF A;  1HB4 A;  5DUV A;  2R06 1;  5FPV A;  2OXB A;  3HJR A;  4IE5 A;  4NRM A;  4QM9 A;  1RB8 G;  4QKF A;  3NNL A;  4JRA A;  4MXV A;  3TN9 2;  4EWD A;  1RUF 1;  1C57 A;  2RVA A;  5FK8 A;  1QHD A;  1XE0 A;  4M4P A;  3BTX A;  2ORZ A;  1NT0 A;  1I1E A;  4Z8B A;  2VQA A;  1R08 1;  1RVF 1;  3PIG A;  3R0R A;  5KHH A;  5A1L A;  1PVX A;  1FNZ A;  4N7I A;  3WY6 A;  5C9A A;  5C8W A;  2YBP A;  2Q5T A;  4W4Z A;  4MOA A;  3ZXA C;  4JAA A;  1PHM A;  1DYK A;  5EYX A;  3WDV A;  3S7E A;  1JXN A;  1UKG A;  5A3P A;  3AM2 A;  3VBS B;  4AFM A;  5CEH A;  1F31 A;  2X5I A;  4OHY A;  1XJA A;  2IXC A;  4FXG B;  1PGL 1;  1VJ2 A;  4C1X A;  1HRI 1;  4W6X A;  5F7U A;  3P3N A;  3WNO A;  1GKB A;  4FPF A;  4H7M A;  5FYC A;  2NMO A;  2WQ8 A;  1RUG 1;  2JDH A;  5F2W A;  3E5U A;  3BU0 A;  1Y43 B;  3JBG 2;  1TEI A;  2XML A;  3NJV A;  5LY2 A;  4AVV A;  1RUH 3;  1IPJ A;  2A3X A;  4BQY A;  4CP0 A;  1REE A;  2VVD A;  2ZPX A;  2GDF A;  5LA2 A;  3DPR C;  3I2D A;  4L0P A;  3TAY A;  4AED B;  2ZX2 A;  5CBL A;  3ILF A;  2Q1F A;  2VPV A;  3ZYG A;  2PA7 A;  4LKD A;  2OW4 A;  5DUU A;  2FZ2 A;  4L11 A;  4FSJ A;  3MFA A;  5KHJ A;  1N1Y A;  3ZYP A;  1JU3 A;  1NQD A;  4N53 B;  1UZV A;  2W2I A;  2WZE A;  2VE1 A;  3J4U H;  4N43 A;  4Y22 A;  2OUJ A;  5LA0 A;  4CSW A;  4YVS B;  3LDB A;  4FFH A;  2WZR 2;  3CBN A;  2RV9 A;  4XET A;  4K9S A;  2ZGP A;  5FY9 A;  2WFF 2;  5BNN A;  4MGT A;  4B3N A;  2J1R A;  1UZW A;  1OBN A;  3IPV B;  1HXS 1;  2EIB A;  4Q4W 2;  4ATE A;  2KA3 A;  3NJZ A;  4Q4X 2;  2VH9 A;  2W08 A;  2ERF A;  5FYS A;  3S6P A;  4UFJ A;  4AWD A;  2B42 B;  4RS5 A;  4YYO A;  2OKX A;  1AR8 1;  1NCR C;  3IDC B;  2XWJ B;  1VRB A;  5IVV A;  1JZ6 A;  5G04 L;  4A3X A;  2PHW A;  3T08 A;  1V6O A;  3SIT A;  1HQW A;  1AR6 2;  1XND A;  4Y20 B;  3USU B;  2WFP A;  3AZX A;  5FMC A;  2VAU A;  5G05 L;  1ZBA 3;  5GKA C;  5L7O B;  4EN7 B;  3AYE A;  2RE9 A;  4XFG A;  5FYY A;  4XBN A;  5LBE A;  5FQ0 B;  3RWN A;  2WWU A;  5GZF A;  4QAW A;  5A7P A;  1DGR N;  2C0Z A;  4QKB A;  3RVH A;  4W6Y A;  1QXJ A;  1V9U 3;  2WKK A;  3LWC A;  3KCX A;  3RZL A;  2PAM A;  3RJR A;  1ZM1 A;  1Z7S 2;  1BVV A;  2BGC A;  2PXJ A;  2WS9 3;  2DUP A;  2XHK A;  1LES A;  5I8S A;  3VLB B;  3WXP A;  3ZDV A;  2VM9 A;  5FMO S;  4I09 A;  3JD7 3;  3MDP A;  2RS5 1;  3AKP A;  5JMC A;  2H0B A;  4AFC A;  5IVJ A;  4HG6 B;  4SLI A;  2VCC A;  1QJE A;  3ZSM A;  3QH7 A;  5JPN B;  5DDJ 1;  4AHZ A;  2HWC 1;  4FFI A;  4P14 A;  4UXA A;  3POE A;  4B8E A;  1YNA A;  4QHO A;  5I0R A;  1JYI A;  1W9Y A;  4BQX A;  2FCV A;  2GME A;  4HFS A;  3PVN A;  4CDX C;  1O3Q A;  4XPV A;  1H9P A;  5CVR A;  4YZ1 A;  4CUC A;  4EE2 A;  4ARY A;  2FCU A;  3KB5 A;  3U37 A;  4AGG A;  4WBB A;  2LS6 A;  1F9K A;  3WNK A;  1YXW A;  1X36 A;  5F8P A;  1D0G A;  1ZZB A;  3R6S A;  1RHI 3;  4N9I A;  3QH6 A;  1SCS A;  4B4P A;  4D7Y A;  3GZE A;  4I2O A;  1SLL A;  2QQL A;  4FI9 A;  4HKL A;  2JEN A;  2UWA A;  2B5H A;  4UF0 B;  5K0U C;  4O7X A;  3CMG A;  1VAK A;  1LNS A;  3OOX A;  3H42 B;  1JYN A;  2VXR A;  1DGW A;  2RG4 A;  4OMC A;  5F5Q A;  3ZYR A;  4Q0P A;  4XTP A;  5LBC A;  5C7G A;  1CAX B;  5DAV A;  2ET1 A;  2JG9 C;  1STM A;  2JIJ A;  1OF4 A;  2PHL A;  4AAX A;  3PU3 A;  4QXB A;  4NIG A;  1W2A X;  1DZR A;  2W5F A;  3A21 A;  3I4I A;  3W21 A;  3MI8 A;  2RM2 3;  4GIQ A;  3BN6 A;  4MXW B;  4A4A A;  1AYN 2;  4IND A;  5JUV A;  4QWN A;  3ZFE A;  2Q8D A;  4WM7 A;  2B4K A;  4XBQ A;  4PBP A;  1YCI A;  3MF6 A;  1BXH A;  5C3R A;  1Y9M A;  1OD3 A;  3KWV A;  3O1M A;  1QJU 2;  2W52 A;  2PAE A;  3HBZ A;  1MQT C;  4EQV A;  4OYU A;  5FZ7 A;  4JHT A;  1AR7 3;  1PX4 A;  4KBZ A;  5A32 A;  3UNP A;  1A34 A;  4DIN B;  3G7D A;  2E53 A;  1WMX A;  3PDQ A;  3PJQ A;  2XGX A;  3U75 A;  4ONU A;  2GAL A;  1KS5 A;  1ZBE 2;  1J1T A;  1GAN A;  1TE1 B;  1UKR A;  2OQ6 A;  2WNO A;  4U36 A;  3KHB A;  3AP6 A;  5IW0 A;  3S5A A;  1W9W A;  3FMG A;  4KBB A;  1SAC A;  1BBT 3;  4N90 A;  4IEY A;  2AZ5 A;  3ATG A;  5FUI A;  2YMZ A;  1M4W A;  4MVT A;  2A1X A;  4M00 A;  1QWR A;  4MGI E;  2PQQ A;  4ZKT B;  5EHD A;  1GLH A;  4R9B A;  3OUJ A;  1PO2 2;  3Q9O A;  3ZKY A;  1CWP A;  1G6N A;  5HCA A;  3Q8B A;  3WZ1 A;  1W2T A;  3N9L A;  2VQT A;  1DZT A;  3SXW A;  1TNR A;  1YQ6 A;  4WM8 A;  2FD8 A;  4LBJ A;  2FDI A;  4CP9 A;  5T54 A;  4IEP A;  2QTW B;  3MLK A;  1H2M A;  1PK6 C;  3WV6 A;  2DF7 A;  2RR1 2;  5HXV A;  1H6Y A;  3DF0 A;  4BXF A;  4FTE A;  3VKN A;  1TMF 1;  4RGG A;  4JRL A;  4CEY A;  1DGL A;  1VE0 A;  1S0E A;  1WCD J;  4LK7 A;  4ISQ A;  4IET A;  1HB3 A;  2QQM A;  1ZZ6 A;  3A22 A;  3KF5 A;  4XIL A;  1TVG A;  2ZHK A;  5J48 A;  2VUJ A;  2BOI A;  3N9O A;  1V6L A;  3AZW A;  1KQR A;  3QBQ A;  2D6K A;  4LBQ B;  4LKE A;  1VRH 1;  4PT6 A;  4AAP A;  2ARA A;  4CCM A;  4D94 A;  4NRO A;  5C4W C;  1QQP 3;  2HYX A;  2WNV C;  2D40 A;  2RMU 1;  3PUQ A;  3PVE A;  2UWC A;  3GZU C;  1IKP A;  1W6N A;  5FY0 A;  2BQP A;  1GOG A;  4XJW A;  4BQW A;  2PLV 3;  4N9H A;  3ZSK A;  1TME 1;  2P3K A;  1W6O A;  4FFG A;  3K4A A;  3FX3 A;  3C7F A;  1UYZ A;  5FR3 A;  5GLV A;  1JHJ A;  3P5B A;  4BK5 A;  4DIQ A;  1WA6 X;  2C24 A;  3H1M A;  4BLJ A;  4HXC A;  1I5Z A;  3DPR B;  1WCU A;  2VEC A;  4CCE A;  4Q26 A;  3LF7 A;  4C0B A;  1ZZ7 A;  1C5H A;  4BIS A;  1ND3 C;  2VTX A;  3LKJ A;  3VHN A;  1S2E A;  3FFQ A;  2HWB 3;  4YW7 A;  1UZZ A;  1W6Q A;  3AKQ A;  2QVS B;  1UY4 A;  3G6J B;  4AR2 A;  2E7Q A;  4I30 A;  3WHT A;  1APN A;  2WWS A;  3LDR A;  2A75 A;  4X6Q B;  4IEQ A;  2FQP A;  1S2K A;  4CU8 A;  3POG A;  4IEO A;  3LA3 A;  4P02 B;  4MGZ E;  3RSJ A;  1GQP A;  3AC0 A;  4GB3 2;  1S4C A;  2C9A A;  3PVO A;  1IOA A;  2YPD A;  4XXP A;  1JI6 A;  3DL3 A;  1OVP A;  3MUZ 1;  4AQT A;  1N3Q A;  4CDU A;  3AXE A;  3HD8 B;  1AL2 3;  4EWE A;  4HON A;  2Z42 A;  3MV1 1;  1CPM A;  3HNM A;  4YW3 A;  1NCR B;  3AMQ A;  1TNF A;  4ZU5 A;  3C7G A;  1W8U A;  1PVC 1;  5C5U A;  4H14 A;  1JOP A;  3E6D A;  3PUH A;  3GZA A;  3PU8 A;  4CU6 A;  4PI0 A;  5L73 A;  3BOP A;  3KF3 A;  2Q8C A;  2RS3 3;  4PIZ A;  3WNP A;  1UOJ A;  2GNM A;  1NZC A;  4NMI A;  3D6E A;  4NHM A;  4CXY A;  2VY0 A;  1LOB A;  2JDM A;  4HSL A;  3CZJ A;  3JUU A;  4IW3 A;  1AVB A;  4M01 A;  2OZ6 A;  3JXS A;  5ACA 3;  3CJI C;  4EYU A;  1COV 1;  2WBK A;  4XIO A;  5B4X A;  2XKO A;  1CAU B;  3LOI A;  1H1M A;  2HWF 2;  4L99 A;  1HB2 A;  2O8Q A;  3VD9 A;  2Z4F A;  4G3Y C;  2VMH A;  4QU2 A;  1C8M 1;  2RDR A;  4Q4V 2;  5JIU A;  1YHF A;  3AZV A;  1WW5 A;  4LJH A;  5GZG A;  3B7M A;  1NE6 A;  4JC1 A;  1UCX A;  1QXR A;  4R9D A;  2GZW A;  2Q0A A;  3AFG A;  4CDX B;  3LA7 A;  4CDW A;  1X9T A;  3I2G A;  2Y64 A;  4UI9 L;  5GZD A;  1OQE A;  1S0G A;  2J1V A;  4CCN A;  1CAV B;  3RFR A;  4CEW A;  1OSG A;  4L92 A;  5FUN A;  1RIN A;  5FZI A;  2ZS6 B;  4DUX A;  3WW3 A;  4KQ7 A;  3GAL A;  1G7Y A;  2ZAA A;  3ZX7 A;  4X6R B;  1WBF A;  4GWN A;  1VBB 3;  3FHI B;  3IBM A;  3UT0 A;  3GBW A;  1VP6 A;  2RS1 1;  1O7F A;  4EN8 B;  5JCT A;  1KFU L;  4O9G A;  5K0U B;  1RUI 1;  3VKM A;  1FPN 3;  1XNC A;  4COZ A;  5AC9 1;  1PGW 1;  5T5J A;  5FP3 A;  1FXZ A;  1WLW A;  4LE3 A;  4AQS A;  2GNT A;  4ITC A;  4OZO A;  5FKB A;  4GMP 1;  2CWM A;  2YHJ A;  1O5U A;  2HWE 3;  3FLR A;  1H0B A;  2JDY A;  1VLN A;  2JG9 B;  3LPG A;  5GM0 A;  4Y4R A;  3BYW A;  4AFB A;  3NAP A;  4NWW A;  2BYV E;  2A70 A;  3K4Z A;  4Q1P A;  1LHN A;  4TXW A;  5T55 A;  4AXO A;  2P37 A;  2DCY A;  4LO6 B;  1FV3 A;  1AYM 3;  1GYK A;  1Y4W A;  4TTG A;  4GXL A;  1HJF A;  3BOD A;  3M3O A;  4C8D A;  5CYY A;  1R64 A;  4XF4 A;  2DCZ A;  2CY6 A;  1C1F A;  5IFP A;  2CGO A;  3HT2 A;  4IEZ A;  5FXW A;  2Q1M A;  4UT5 A;  4S2D A;  3GCX A;  4RN5 A;  3OY8 A;  4YGC A;  2ZA9 A;  4L97 A;  5FDB A;  1H8T B;  1MQT B;  4XAE A;  4F3J A;  2GC3 A;  3AX4 A;  4R9C A;  4WVZ A;  1QIQ A;  2CYF A;  2A6X A;  3UET A;  3X29 B;  2A6V A;  4QXH A;  4KGQ A;  2ZJC A;  2HWD 3;  5JMO A;  3OB8 A;  4BB3 A;  3I59 B;  1MZ5 A;  2D44 A;  3PVB B;  3AYA A;  1WLT A;  3D4K A;  1ONA A;  2PN5 A;  2ES3 A;  1SG3 A;  1BYH A;  1KXG A;  1ULE A;  4LHK A;  4E8C A;  5IWF A;  4AQ2 A;  1XU2 A;  2Z79 A;  4FPJ A;  2VZU A;  3IB3 A;  3URF A;  3LQC A;  1K5M C;  4QPY A;  2E31 A;  1LEC A;  5L19 A;  3H8R A;  2CDO A;  1R09 2;  2HLE A;  4ZU4 A;  3JU9 A;  1G9B A;  4EN6 B;  4GAL A;  3Q8F A;  4I0A A;  4UFI A;  1A8D A;  1Q8P A;  5LB6 A;  2Y33 A;  4RHV 3;  4XUN A;  5BNO A;  5FLI A;  3ZSJ A;  4Y3O A;  1PK6 B;  1RUD 2;  3W59 A;  1L7L A;  1JN2 P;  1KD7 A;  1PMI A;  1XSR A;  3J8F 3;  4GH4 C;  4AHX A;  3VUO A;  5CG9 A;  5B2G B;  3I49 A;  3BB6 A;  1ZA7 A;  3AMN A;  3VZL A;  4JX0 A;  1YRZ A;  5FBJ A;  4FTS A;  1YQC A;  5KC5 A;  5E89 A;  5FY1 A;  1YQ5 A;  5FLH A;  3U07 A;  1HB1 A;  4A45 A;  1LGB A;  1RUH 1;  4Y33 A;  1S1A A;  4B4R A;  3C2U A;  3U11 A;  1LOA A;  2WNV B;  5FYH A;  3LSE A;  3CL1 A;  1RMU 2;  4C0H A;  1E5I A;  2Y6G A;  1EPZ A;  5FYM A;  4ERO A;  4Y1Y A;  1X9P A;  2CDP A;  2VOW A;  2C9K A;  3SQO A;  2EAK A;  1H9W A;  2R06 2;  4LOR A;  5BUV A;  1XPW A;  4RA0 A;  3CQO A;  4GUL A;  4M3C F;  4H55 A;  4BME A;  3FFZ A;  4MV2 A;  1AX0 A;  2V5D A;  1S0B A;  5DPN A;  2WJS A;  5KHK A;  1NYW A;  1ST8 A;  2YC0 A;  1ND3 B;  1VAL A;  2VMI A;  1G86 A;  1R08 2;  2F6B A;  2R0H A;  1OD5 A;  3POI A;  2VTF A;  2ZBJ A;  3OPW A;  2GNB A;  1XRU A;  2C26 A;  2WDB A;  3OJB A;  5EZW A;  2IFR A;  1MEC 2;  3THC A;  3WCS A;  1GZW A;  4LLF A;  4HT1 T;  5FJK A;  4R8H A;  3ZPO A;  3DYP A;  4WVV A;  2W1W A;  3PMS A;  3S57 A;  1FOD 3;  3H9A A;  3C8X A;  3N7J A;  4NOT A;  1PGL 2;  1ZZ9 A;  4ZON A;  3INA A;  4TSV A;  3T0D A;  1ASJ 3;  1ZBA 1;  3WG3 A;  1OFN A;  1U5Y A;  1WW6 A;  3GGL A;  2LRO A;  4I01 A;  3DGT A;  3RI9 A;  4PBO A;  4AFD A;  4DY5 A;  2Y60 A;  4MH0 E;  1V9U 1;  2XKP A;  5HPO A;  2VQU A;  3FC0 A;  3DYM A;  5T5P A;  2Z2S B;  4QPW A;  5CNA A;  2I07 B;  2JG8 A;  4IE7 A;  4FOW A;  2DBN A;  2WS9 1;  3K3O A;  2AAC A;  4KI5 M;  4PDW B;  1H8V A;  3M3I A;  4HVO A;  3ZIX A;  2RDQ A;  3ZR5 A;  3JD7 1;  3TN9 3;  3WDX A;  3NVC A;  5BXX A;  3CU7 A;  2ZEW A;  3LB9 A;  2B9V A;  2VXJ A;  1XXN A;  4NAO A;  4EN0 A;  1VBE 2;  3KVA A;  2GP5 A;  4UYB A;  5FZL A;  4NRP A;  4HVR A;  3WW2 A;  1DZQ A;  1PNG A;  4NVP A;  5A1A A;  4FTB A;  2IUW A;  2ZGT A;  4WVM A;  4YVS C;  1Q56 A;  1UY1 A;  2PMW B;  2GN7 A;  2R0F A;  3WOG A;  4RFR B;  4XCB A;  4LBN A;  2HEY F;  4QPG A;  1A3K A;  4ARX A;  5I8T A;  1IG0 A;  1W05 A;  1W8T A;  1HXS 2;  4QU1 A;  5C8C A;  5F5I A;  1US2 A;  5JR2 A;  5JXG A;  1YFW A;  3ACG A;  1ODM A;  4FPC A;  2G9G A;  1S2B A;  4RR3 A;  1O8P A;  5FYI A;  1FYU A;  3F95 A;  2B46 X;  3PUI A;  4BQ1 A;  5FAX A;  2XPJ A;  3NNJ A;  5H9R A;  4F7Z A;  5GLT A;  2YRO A;  2ZAC A;  4JKK A;  5F3G A;  3PHM A;  1UPS A;  1UZ0 A;  1RHI 1;  3N4M A;  1WUV A;  3VBF B;  2ZHN A;  4BIF A;  4IV3 C;  4LKS A;  3KV4 A;  1JH5 A;  1Z78 A;  2ZKL A;  3OGV A;  5D8A A;  3VL8 A;  4YVW B;  3JBG 3;  4YZ4 A;  3IMM A;  4M4R A;  2XBO 2;  4AVT A;  5FOB B;  1XC6 A;  3PIJ A;  2ZGM A;  4YG0 A;  3AK0 A;  1FV2 A;  4OHW A;  4A6S A;  3LA2 A;  5LBB A;  2KXL A;  2ZGS A;  4EJR A;  3WW4 A;  5A3L A;  1CAW B;  3C7H A;  3I8T A;  4NHL A;  2NN8 A;  2TUN A;  1SLB A;  3I3M A;  2D6L X;  2LM3 A;  1H1A A;  3AP4 A;  2RM2 1;  4IES A;  4JTN A;  5DUX A;  2WZR 3;  4U2A A;  3GXU A;  1DYO A;  2WIN B;  4ZXE A;  1JOD A;  3CJX A;  1HDK A;  1LOG A;  1WD3 A;  3ZN6 B;  5FZ6 A;  2VZS A;  3J9S A;  3D82 A;  1H6X A;  3MEP A;  4Q4W 3;  4YM2 A;  2IVJ A;  2R32 A;  5IK8 A;  5DAW A;  1ND2 C;  1VBD 2;  4Q4X 3;  3AP7 A;  3AYD A;  3TEZ A;  4OI4 A;  5E88 A;  1AR7 1;  1O8S A;  1EV1 2;  2A6Y A;  4AI1 A;  3EQE A;  3PUS A;  4CCD A;  4IV1 B;  4XC9 A;  3OPT A;  5JZG A;  4BK4 A;  2BBA A;  1J83 A;  2FCT A;  3ZFF B;  2B8M A;  3AMH A;  4YW6 A;  3DKW A;  1HLC A;  1BLZ A;  1R1A 2;  2QJV A;  3KQR A;  1LOF C;  1POQ A;  2VW0 A;  2VG9 A;  1AZD A;  1BBT 1;  5APA A;  1QOO A;  5LBF A;  1W6P B;  4AYU A;  1N1S A;  4R4Z A;  3JB8 A;  5IAV A;  1DQ1 A;  2A5Z A;  1Z7S 3;  1ZRD A;  1SBF A;  2D43 A;  2CHH A;  1EAH 3;  4Y1X A;  1GV9 A;  1WD4 A;  1BJQ A;  3B01 A;  5FRA A;  4LBO A;  1AR9 2;  1VAM A;  2QQV A;  3N9M A;  2NYY A;  5J1X A;  1CQ9 A;  3VBS A;  1CN1 A;  3N35 A;  2YDE A;  3DN7 A;  5FZB A;  3HBK A;  1K5M B;  3NNM A;  4YGD A;  3MHZ A;  3AVR A;  4ZZ8 A;  1RUE 3;  3CHX A;  4GD4 A;  1F8V A;  4Q0U A;  3EJK A;  1J3P A;  4HAN A;  1POV 0;  3O1V A;  1XBF A;  3I2F A;  4KL1 A;  3B9C A;  4P5Y A;  3ROU A;  1QJZ A;  1QQP 1;  3J7H A;  2BNN A;  4LHN A;  5FTT C;  2BTV C;  4XYX A;  4GH4 B;  4AED A;  5J36 A;  2YGM A;  1GP5 A;  3H1Y A;  4CP1 A;  1XOY A;  3VHR A;  2PLV 1;  1NE4 A;  3DEC A;  2VMC A;  1GZ9 A;  1U5I A;  4N53 A;  3POS A;  4BPZ A;  2AC1 A;  3K51 A;  4LO7 A;  1UX7 A;  5A3N A;  5FV3 A;  2E26 A;  3ZN4 A;  3H3U A;  5I0S A;  5JPM B;  1J3Q A;  2ZHM A;  2UY8 A;  3MBW A;  1NCQ C;  5C70 A;  1Q3E A;  4YWA A;  2UYB A;  3THD A;  4CPB D;  5ANQ A;  1GZC A;  2HWB 1;  1NAE A;  2C1F A;  1LHO A;  2Y6K A;  5FZ8 A;  1MVE A;  4QX0 A;  3TNP B;  2G19 A;  4IE6 A;  5FK7 A;  1XNT A;  3NJY A;  4E27 A;  3AL6 A;  2ARB A;  2JKX A;  3WHU A;  4JVA A;  5D1I A;  1JOB A;  3MV0 1;  2ID4 A;  2D3P A;  1AYN 3;  2CU5 A;  4QQL A;  1W3V A;  3H3Z A;  1DQ6 A;  1L3J A;  2VMD A;  3OBT A;  1E5H A;  2WQZ C;  4MLO A;  3PLQ A;  2ATF A;  4Y20 A;  2VVE A;  3USU A;  2B45 X;  2ARC A;  1QJU 3;  3SEE A;  5FPB A;  5A3T A;  5K7P A;  5L7O A;  1AL2 1;  2XJP A;  2IWG B;  4Y5T A;  5BYN A;  1S0F A;  4KNC A;  5HXM A;  2BDR A;  5JSO A;  3UV9 A;  5FQ0 A;  4MO3 M;  3ZSL A;  1DU3 D;  1PZ7 A;  1UY0 A;  4NPR A;  1DGR A;  1BKZ A;  3ZXD A;  2QDN A;  3KGL A;  3LFM A;  4JDN A;  1GOF A;  1L7Q A;  1Q8S A;  2VBP A;  2RJL A;  3TNQ A;  2PFW A;  1DQ0 A;  2E7T A;  2RMU 2;  3GBG A;  4Y1U A;  2L9L A;  1UOB A;  5KXB A;  4TZD A;  4JDO A;  1A8M A;  1LUL A;  1J58 A;  4JDM A;  2RS3 1;  5C3S A;  2OA2 A;  3EBR A;  1ACC A;  1PO1 3;  2P1B A;  2ZZQ A;  3UL2 A;  4Z07 A;  3VD4 A;  1QU0 A;  3I2H A;  3ZN5 A;  5E1R A;  1KRI A;  1KS4 A;  2VCB A;  1VMJ A;  1W9S A;  4D0Q A;  3ETP A;  4NHK A;  1NA1 B;  2K46 A;  4Q27 A;  5KHI A;  5ACA 1;  1CIW A;  1W8N A;  1MS8 A;  4BE3 A;  2B39 A;  4WZF A;  5JXH A;  3WDY A;  2ZGO A;  1LGC A;  4LHS A;  3J26 N;  1JUH A;  2QE3 A;  3ZSE A;  3O0W A;  2VMF A;  4EZ4 A;  1I5P A;  2QFE A;  1O4Z A;  1SDD B;  3SMH A;  1SPP B;  1ZVF A;  1QDC A;  1OUX A;  4XUO A;  4LR4 A;  5B4N A;  2F4L A;  2HYK A;  1SQ4 A;  2JEM A;  1SFN A;  3SHR A;  1T6B X;  4UF0 A;  1LJ7 A;  4LQR A;  5EIY B;  1W6M B;  4LIU A;  3LEG A;  2K0G A;  1XQN A;  3P3P A;  1BHG A;  4I3P A;  1G9C A;  2BZD A;  4P00 B;  2UUR A;  5J7M A;  3NV4 A;  1OH3 A;  1YC6 1;  1IPS A;  2WSV A;  1CAX A;  3N7K A;  3NJX A;  4IUG A;  4LNV A;  2OX0 A;  1VBB 1;  4J1X A;  4V1P A;  1NLR A;  5IK5 A;  1D4V B;  2Y0O A;  2AUY A;  4IV3 B;  1PVC 2;  2XDV A;  2QQU A;  1DQ2 A;  1FPN 1;  2K9Z A;  4W8J A;  4I0B A;  4XJZ A;  4AG4 A;  4MG2 A;  1JZ8 A;  5EQU A;  2DFC A;  3T0A A;  3JQX A;  1UAI A;  1RED A;  1AHS A;  2W47 A;  3I2I A;  4MXW A;  2VME A;  5ISL A;  4NWV A;  1QJX 2;  4LEJ A;  4DUV A;  2HWE 1;  4LLO A;  1O3T A;  1IGO A;  2DTY A;  2JD9 A;  4FOY A;  3BGA A;  3N9N A;  1YFY A;  3UK9 A;  3WW1 A;  1AYM 1;  1DF0 A;  3R05 A;  3KVB A;  4ES8 A;  1J59 A;  2OPK A;  3U0Z A;  2OUH A;  4FPG A;  5FPX A;  1EUU A;  4FOV A;  3ORJ A;  3FZ3 A;  3POF A;  2ZGQ A;  1C8M 2;  3FUQ A;  4GB3 3;  4CDQ C;  2ZCW A;  1GP4 A;  1ND2 B;  1W06 A;  1S55 A;  1CGP A;  3AL5 A;  4Q4Y 2;  3CIH A;  1JZ7 A;  4QPI C;  2DUR A;  3OGG A;  4RD7 A;  4XDO A;  1N1T A;  4KH9 A;  1JUI A;  1U5Z A;  2XXZ A;  3TWI A;  3HWJ A;  5DG2 A;  2R04 2;  1J3R A;  3AZZ A;  3RZK A;  2GC1 A;  2HWD 1;  5EYY A;  3MIG A;  1W8O A;  2I74 A;  5FY4 A;  4RGA A;  2YPJ A;  2IZW A;  4DQA A;  4BM8 A;  4QQO A;  5T5O A;  2YFZ A;  4J6G A;  1FNY A;  3NV1 A;  3T2P A;  1YQ2 A;  3ZXJ A;  1Q8V A;  4OMD A;  1I6X A;  5AC9 2;  1QH7 A;  3IDA A;  3OEA A;  4D3W A;  3KV5 A;  2W92 A;  1CR7 A;  2VNV A;  3IWZ A;  4QKD A;  3V0B A;  2VUD A;  1BMV 1;  3V64 A;  1SLA A;  2VUC A;  4FPE A;  3F2Z A;  4RHV 1;  2LRP A;  4RFT 0;  3L2Y A;  1CIY A;  2HWF 3;  2X29 A;  1OOP C;  4LBQ D;  2AH2 A;  2JKB A;  2ZGL A;  1CX4 A;  3J8F 1;  4HVQ A;  3RZJ A;  3VV1 A;  3ES1 A;  4DXT A;  1GNZ A;  3L9J T;  4R52 A;  3VBO C;  2DDU A;  1NG0 A;  2D3R A;  3WUC A;  1EYB A;  5F5C A;  1V6M A;  2IVI B;  4Q0V A;  4AOC A;  3HMY A;  5F3E A;  2J22 A;  2Z5W A;  5L9R A;  1LTE A;  5FZA A;  1VB4 A;  4CUG A;  2JIG A;  2ZKN A;  2JDU A;  1GQG A;  3ETQ A;  1H8T C;  2XLG A;  3DPR A;  5IUQ A;  5CFD C;  4AQ6 A;  1DLL A;  3GHN A;  1S0C A;  5JOX A;  1FMD 2;  3M3Q A;  2BFU S;  5C6C A;  2BGP A;  1F15 A;  1IZ3 A;  1LED A;  1WCK A;  3MW2 A;  3B5L B;  1UMH A;  5DQ0 A;  3AZY A;  1K5J A;  4LIV A;  4SBV A;  4D7T A;  4YSF A;  5FWJ A;  2QQK A;  2W87 A;  1WA4 A;  4K20 A;  1WKY A;  4RYD A;  1WCQ A;  1WW7 A;  2EIE A;  4Y5Z 0;  1BVP 1;  1N3P A;  3OYW A;  5FZG A;  1F2N A;  1NCQ B;  5H9Q A;  1T2X A;  1TG7 A;  1C28 A;  1NZI A;  2DVF A;  3IM0 A;  3AJY A;  4EWA A;  2NMN A;  1GU3 A;  3VGI A;  1HV1 A;  3T0B A;  2D3S A;  4BZ4 A;  2BGO A;  1CES A;  3VBU C;  3ITQ A;  5FZ4 A;  5BV6 A;  3LEK A;  1NCR A;  1DHK B;  4I3G A;  1LB2 A;  3LE0 A;  2H0V A;  4B1L A;  3ZXG A;  1ASJ 1;  1OF3 A;  4AE2 A;  4QHB A;  4XFI A;  2YV8 A;  4LA3 A;  3OD0 A;  5FRE A;  4MGS A;  1V6N A;  4FO9 A;  1H2N A;  2R30 A;  4NO4 A;  4XEZ A;  5ABJ C;  3U4X A;  4NID A;  4FFF A;  2H6C A;  4AF9 A;  3CDZ B;  1RUH 2;  5A3M A;  4KWU A;  1CON A;  2ZEY A;  3K46 A;  4M3C E;  3WSO A;  4E2S A;  1OKQ A;  2X8K A;  4JQR A;  5JSP A;  3TB0 A;  3TN9 1;  2D5H A;  5BNP C;  3D3A A;  4TYS A;  1CAU A;  1ZRI A;  2FBE A;  3MPB A;  3MZH A;  3MF9 A;  1AL0 G;  3VDD C;  2GMP A;  4ORF A;  4LO4 B;  2WO2 A;  3MIE A;  2P3J A;  2QKD A;  4IEV A;  2DCJ A;  2XH6 A;  1R09 3;  3I2K A;  3MUY 1;  4LIT A;  4ZXK A;  2C6S A;  5JOZ A;  2XB6 C;  1O3R A;  3H7Y A;  4DS0 A;  2V5Y A;  3VD5 A;  2MEV 2;  1XYN A;  2W95 A;  4CDX A;  1R1Z A;  2J42 A;  5LAS A;  3W9A A;  1RUD 3;  3H1W A;  5GLZ A;  3HVD A;  1CAV A;  1HW5 A;  1X8M A;  1F5F A;  1XYP A;  2V72 A;  2WAA A;  2WN2 A;  1B35 C;  1HQN A;  1MS1 A;  2EXJ A;  3WG4 A;  3JBG 1;  3K48 A;  4Z92 B;  2J1U A;  1ZA4 A;  5K0U A;  5FY7 A;  5A6Z A;  1ZBA 2;  2A6Z A;  2ZX3 A;  1NY7 2;  5A32 B;  3D0J A;  5FP9 A;  5IVB A;  1ENQ A;  5FZ0 A;  1RMU 3;  3CO2 A;  5CKM A;  1V9U 2;  1ZX5 A;  5CFC C;  4G9S B;  3VHO A;  2JG9 A;  3O1U A;  3OSD A;  1DP0 A;  5A3U A;  4YGB A;  4JHZ A;  4KGG A;  3BTZ A;  2R06 3;  1ODN A;  4PDW C;  1IS5 A;  1QJY 3;  1J84 A;  2YXS A;  4PF1 A;  3I54 A;  4UBG A;  5H9P A;  2WZR 1;  1WMD A;  3JD7 2;  2DWR A;  4N7U A;  2W46 A;  4Z1V A;  2LUW A;  3I3B A;  5T52 A;  4LUM A;  4Q4W 1;  2E33 A;  3PUR A;  5A70 A;  3U4S A;  1CJP A;  4Q4X 1;  1ENX A;  1VBC 2;  4CCC A;  4JGZ C;  1UXX X;  4P08 A;  2DU0 A;  3TOJ A;  2CAV A;  3DXU A;  5ERL A;  1MVQ A;  1W0O A;  1MEC 3;  1MQT A;  4RGK A;  1UX6 A;  3JQW A;  1JTZ X;  4NJ4 A;  4K8R B;  2GAU A;  3RQ0 A;  2ARX A;  5A3O A;  3QLQ A;  3V56 A;  3H8X A;  3RYP A;  4H2A A;  1D0H A;  1U12 A;  3NV3 A;  4P9I A;  4ZS3 A;  4JQT A;  4CEY B;  2X09 A;  1WW4 A;  4CDQ B;  4PCR A;  5A7O A;  1UMI A;  3B69 A;  1LGN A;  2BVB A;  2VUA A;  3EXU A;  2BER A;  3I59 A;  2ZHL A;  4QPI B;  3OGS A;  3MLJ A;  3VBF C;  4I02 A;  3BVC A;  4COW A;  4KG8 A;  1V6J A;  4YVW C;  4UW5 A;  4AI9 A;  1XSQ A;  1Z7S 1;  2BWA A;  3MGU A;  3RRD A;  2DYC A;  1WCS A;  1IG3 A;  1QXP A;  1W6N B;  2VBB A;  1EAH 1;  5FY5 A;  3QCW A;  2XLF A;  5CA6 A;  3VZM A;  2GH2 A;  3BAL A;  4PIX A;  1W90 A;  5K9Y A;  2D5F A;  3M3C A;  1JYV A;  4HKO A;  3I3E A;  1VBE 3;  1H1I A;  3O0V A;  1PK6 A;  5IVE A;  1I9R A;  1WME A;  5CU1 A;  3BUC A;  1W39 A;  5LK5 A;  1RUE 1;  4NPL A;  2ZAB A;  1US3 A;  5AVP A;  3VBH C;  5GJ6 A;  2ZZJ A;  4XHX A;  5BY5 A;  1BEV 2;  4OUS A;  2BV4 A;  4BYY A;  1HRV 2;  4LO8 A;  4RQP A;  1OOP B;  3NWK A;  3OUI A;  3RYR A;  5A6Q A;  5HV0 A;  2D6N A;  5C4W A;  1JYC A;  1LOE A;  4YW4 A;  3K2O A;  1VBA 2;  2BP6 A;  4A7Z A;  3VBO B;  4IV1 C;  3P6B A;  1DCS A;  2TBV A;  4NRQ A;  4LBM A;  5E8A A;  1AF9 A;  3ZFF C;  4M0H A;  1OT5 A;  2VZ1 A;  2XL7 A;  1OLM E;  1UY3 A;  1D7P M;  1PIV 1;  2WL1 A;  3SKV A;  3VHP A;  5C3Q A;  3RGB A;  5I0D A;  2XBO 3;  3WG1 A;  3UGF A;  1JYT A;  3HQR A;  3OUH A;  4C1W A;  3LSD A;  3CF6 E;  4BXS V;  1OA2 A;  2R1D A;  4I0W B;  4UW4 A;  4UBH A;  1QMJ A;  3KM5 A;  3CNA A;  3M4F A;  2PEL A;  2ZEZ A;  4X8N A;  4XF9 A;  4DFS A;  5CFD B;  1GWL A;  1ND3 A;  1PM7 A;  2R07 2;  1RUJ 3;  4JKL A;  3WNM A;  1RTV A;  4QXK A;  3RYK A;  5LK7 B;  4Q2F A;  4LTA A;  1WLC A;  2W9X A;  1UU6 A;  2H6B A;  5GAL A;  2AEN A;  1AYN 1;  3R4S A;  1AJK A;  4DY3 A;  1LEN A;  1WLD A;  2Y6J A;  3HOB A;  2VOX A;  3DXT A;  4KWL A;  1QKQ A;  1VBD 3;  5DAQ A;  2BBV A;  1QJU 1;  4XVH A;  1MR5 A;  1YFX A;  4TLF A;  4QX5 A;  5IHR A;  1OVS A;  5A7W B;  1GNY A;  1EV1 3;  1GOH A;  5GLW A;  2EAL A;  3WT3 A;  4NN0 A;  4QGM A;  3VBU B;  2YB7 A;  3UKV A;  5JXJ A;  3MO4 A;  1SBD A;  4DXS A;  4C90 A;  1QQP 2;  3PTY A;  2WO1 A;  3LDK A;  3ZYF A;  3U10 A;  1R1A 3;  1BZW A;  2CWS A;  4ZPI A;  3W58 A;  5LAT A;  2J7M A;  4DB5 A;  2R16 A;  5GZE A;  1PO1 1;  3E1F 1;  4IE0 A;  1X7N A;  1N47 A;  4A7K A;  4UW3 A;  5DZG A;  5ABJ B;  1YFU A;  3O7O A;  2IXL A;  1D4M 3;  3WF2 A;  3J7N A;  5AVA A;  5DUW A;  4UW6 A;  3CEW A;  1DQ5 A;  2OQ7 A;  2XVG A;  5T3N A;  4HBN A;  1JU4 A;  5F5A A;  3ZLI A;  1UYX A;  2ZX0 A;  3OG2 A;  4IXL A;  3WD5 A;  4JGY C;  4PLN A;  1GWK A;  1AR9 3;  1QEX A;  2BWC A;  2JE7 A;  3CJI A;  5BNP B;  5C71 A;  2CGP A;  2JDP A;  4D8M A;  2WNE A;  3VDD B;  1CD3 G;  5JLV A;  2VZT A;  4FP3 A;  3M8L A;  4PI2 A;  1PGS A;  1F5J A;  1RUF 2;  3I97 A;  2QQJ A;  3V0A B;  3A0N A;  1RUC 3;  2VTX J;  4FVV A;  4CXW A;  1E5S A;  1OUS A;  2PHT A;  5DXD A;  2WT1 A;  1RVF 2;  3FHA A;  4M3C B;  4CCL A;  2BUK A;  2DBI A;  4UFK A;  1CX1 A;  4JTO A;  2OII A;  3ELN A;  3BPZ A;  1KEX A;  2PQS A;  2P3Y A;  3R4U A;  2WSU A;  4QD2 A;  1YO8 A;  2Y26 A;  5FLJ A;  4PLO A;  1DBN A;  2VZO A;  4XJA A;  4HMZ A;  1W2O A;  1LHW A;  3OBR A;  4OI1 A;  1B35 B;  2AEZ A;  5JR7 B;  1V70 A;  5IAT A;  4NHY A;  3FE5 A;  2YY1 A;  3HQU A;  3M3E A;  1YWK A;  2Q30 A;  4GMP 0;  2UY9 A;  4ISR A;  1QY4 A;  5KC6 A;  1HRI 2;  2A3Y A;  2G4I A;  3CLP A;  3M2M A;  3VZO A;  1RIR A;  1UOF A;  3RWK X;  3GJA A;  3WX5 A;  2YU1 A;  4G4F A;  1GQH A;  1IS3 A;  4W6W A;  1RUG 2;  2DVB A;  2VOV A;  2ZMK A;  1OMI A;  5CFC B;  3HAG A;  1UZY A;  1DLC A;  1P8J A;  3U1X A;  3III A;  1IPK A;  1C1L A;  1D2Q A;  1K3I A;  1NA1 C;  2I45 A;  3ZYH A;  2OZJ A;  1MS0 A;  2W68 A;  3K77 A;  3MLL A;  1X33 A;  4XF1 A;  3VBR C;  2QQI A;  5ACA 2;  2D97 A;  2P17 A;  3KS7 A;  4Y1V A;  4DEV A;  1Q5O A;  4Z2A A;  4FPK A;  5I0T A;  5IK7 A;  1O5L A;  4GB3 1;  4IGQ A;  3SIS A;  2VUL A;  2WC2 A;  2K2S A;  5I91 A;  2WT2 A;  4BLI A;  1B09 A;  4UOJ A;  4JGZ B;  3H8O A;  3JCI A;  1BCX A;  5FYB A;  4LK6 A;  3U14 A;  5LW9 A;  1F35 A;  3IIA A;  3OEB A;  2ILM A;  1Y9Q A;  3W5M A;  4PLM A;  2WNU C;  2DVG A;  4MHU A;  4AEJ A;  3P1I A;  2J1S A;  3ZFG C;  1BK1 A;  4XFB A;  5A33 A;  3USS A;  2OS2 A;  1OI6 A;  1AR8 2;  1VBB 2;  4P5H A;  2XG3 A;  2X10 A;  2VQ0 A;  3HNY M;  2DV9 A;  1FPN 2;  4CXX A;  4AL9 A;  3OD4 A;  1MS9 A;  4BCU A;  3HN3 A;  1K5M A;  4HKW A;  4ATF A;  2WO7 A;  5F39 A;  5FFO C;  1W8F A;  4CZS A;  1MPX A;  3POB A;  4S2H A;  5FUP A;  4A41 A;  3PJY A;  2D6M A;  4MSV A;  2Z69 A;  4OUE A;  5IVY A;  4A6O A;  4AGV A;  1GZT A;  2VCM A;  4FCA A;  5JOW A;  3I2O A;  4TWT A;  3BI3 A;  2ARE A;  3AVS A;  5I0U A;  1E57 A;  1QOT A;  1PNF A;  2JWP A;  4FXK B;  1JYX A;  1UIK A;  4XZP A;  4GH4 A;  2Y6F A;  3E5X A;  3RG0 A;  4DOU A;  3ZMO A;  1CZV A;  2RS5 2;  3VBH B;  2WFF 3;  2C5D A;  2FDF A;  5DAB A;  2ETE A;  1UWW A;  3TRS B;  5J09 A;  1IHM A;  5FZD A;  3CZU A;  2FHR A;  3LFI A;  4HET A;  4HZF A;  4MET A;  5DDJ 2;  3UKT A;  2HWC 2;  1OUR A;  5C9A C;  5JDB A;  3MW3 A;  1MS5 A;  4BIO A;  4TN7 A;  4XUP A;  3AB0 A;  1NLS A;  4GJY A;  4KMQ A;  3WG2 A;  2G9F A;  2IXI A;  1Q8Q A;  2X5I C;  4IDZ A;  4F83 A;  4XUT A;  1AR6 3;  4FPH A;  4XBL A;  2NLR A;  2Y8K A;  4H7L A;  4IGO A;  4UFL A;  1UYY A;  5A3W A;  1F4H A;  4OQ8 A;  2A7A A;  1AX1 A;  3WDW A;  2VW2 A;  5SV8 A;  2XJU A;  1QJX 3;  4QDR A;  2FDH A;  3E97 A;  4COU A;  4BQ5 A;  5L36 A;  4A44 A;  1NOV A;  4WZC A;  3WNL A;  3WR0 A;  4HPK B;  4IL7 A;  2DUQ A;  3RZH A;  3TEY A;  5A80 A;  4AI2 A;  1VPH A;  2EXH A;  5A1F A;  3ZDS A;  1J1L A;  1YJL A;  4XQ4 A;  1U0A A;  3M7A A;  2R7E B;  2XOM A;  5F3I A;  3SCH A;  1N3O A;  3MIH A;  5F32 A;  4X8P A;  3B9I A;  3WDT A;  1W9T A;  2VVF A;  2GC2 A;  3ZR6 A;  3AP9 A;  1W2N A;  4N43 C;  3ALQ A;  4XAA A;  2VO5 A;  1ZRR A;  1O6U A;  1OKO A;  3BTA A;  3DV8 A;  4R4X A;  3ZXK A;  4AHW A;  2X53 S;  4B29 A;  5BNN C;  2B7Y A;  4Q4Y 3;  3WLU A;  3K4D A;  4K6B A;  4DPN A;  3VDB A;  1HX6 A;  3VZN A;  1OLQ A;  1WMF A;  2VNO A;  5C8C B;  2WLQ A;  4XFC A;  2XQR A;  5IVC A;  3O1O A;  4IEX A;  2WO3 A;  2EIG A;  4QMA A;  3ZXF A;  2R04 3;  1UIJ A;  2GMM A;  4BMB A;  2XVK A;  4RS5 C;  3TBD A;  5FZO B;  4QT6 A;  3FLP A;  1Z0H A;  4LXL A;  5EJ1 B;  2Q8E A;  1QNW A;  4CCJ A;  1LHU A;  1PM4 A;  3O14 A;  1I3H A;  3VZJ A;  3OPZ A;  1NKG A;  2QQO A;  3GDB A;  4QQ2 A;  3A23 A;  3KD4 A;  4XHB A;  1HN0 A;  3KLS A;  3MIF A;  1KDM A;  4FOQ A;  2XLA A;  2A71 A;  1SPP A;  3N9P A;  4YVS A;  2XJV A;  4LA2 A;  4PJY A;  3NKT A;  3RNS A;  4JGY B;  3KHC A;  3IPV A;  4EZH A;  2Y0I A;  1YJK A;  1W3X A;  1GUI A;  4CPB A;  4E2Q A;  5LZ6 A;  1W6M A;  3N3H A;  3MPP G;  1RUD 1;  5FZ1 A;  5SV5 A;  1FT9 A;  4LKF A;  3QD6 A;  1W04 A;  4P9L A;  4EN9 B;  3EB7 A;  4AI8 A;  4XDQ A;  2ZGR A;  3AKT A;  4IE4 A;  3LIG A;  2BW8 A;  4L9B A;  5DZF A;  4IV3 A;  5LCW L;  1O3S A;  5BPX A;  4CU9 A;  1FX5 A;  1TMF 2;  1ASJ 2;  1RC6 A;  4QDS A;  5JIA A;  1VAV A;  2WT0 A;  4QB1 A;  2NP0 A;  4XCA A;  3TEW A;  1RMU 1;  4D7S A;  2FDG A;  4ES9 A;  1Y9G A;  4M0N A;  5JZG B;  4NAM A;  1FMD 3;  5FXX A;  4CA9 A;  1SDW A;  1VRH 2;  1HV0 A;  4OI0 A;  2GN3 A;  2J1T A;  1QJY 1;  1ZBE 3;  2BPA 2;  1XNK A;  4XFA A;  4FQZ A;  4YRD A;  3MID A;  3HPN A;  5FZC A;  1UMZ A;  5CIS A;  4CRQ A;  3BKZ A;  3GJB A;  1TME 2;  1ZRF A;  5CZK A;  5FZE A;  4WV8 A;  4LOS A;  2E63 A;  4CCK A;  4AW7 A;  3HIF A;  2XWB B;  2AGS A;  3THP A;  5F3C A;  1ND2 A;  1PO2 3;  4LO5 B;  1QDO A;  3WQ7 A;  2DFB A;  1C5I A;  1MS4 A;  1MEC 1;  1ULF A;  3ILN A;  2FMD A;  4OZX A;  4URT A;  5IAX A;  4DXR A;  3VBR B;  1MAC A;  3NW4 A;  4ZS2 A;  2PHU A;  4FPL A;  5FYU A;  1C3H A;  4XFH A;  4MZU A;  2I2S A;  4AVS A;  2RR1 3;  2ENR A;  3T30 A;  1KJL A;  1K12 A;  1RJ7 A;  1JOJ A;  4R9A A;  2BOJ A;  1W8H A;  2ZML A;  1UQX A;  4OVE A;  2RHP A;  1LOF A;  2VL4 A;  3KV6 A;  3KT1 A;  3K75 B;  4MGY E;  4DZG A;  2E32 A;  2VC9 A;  3ZFE C;  5F37 A;  4WM7 C;  5LA9 A;  1XNA A;  1SZB A;  2MPF A;  5KWR A;  3S5Q A;  2O8O A;  1C4R A;  5EPA A;  5DZE A;  5IJR A;  2HEV F;  4GWI A;  2WNU B;  4NII A;  1S0J A;  4XJ9 A;  1CPN A;  3RPQ A;  3RI8 A;  4B7K A;  3BTY A;  1H30 A;  3ZFG B;  1OQD A;  3KSC A;  1W0N A;  4LHL A;  3IN9 A;  2J1E A;  2Y34 A;  1RUO A;  2JJ6 A;  4PQQ A;  4FT8 A;  3A0K A;  1VBE 1;  3ECQ A;  4V2W A;  1UW8 A;  5ANN A;  2KM2 A;  4XFF A;  4O9E A;  5T5L A;  3Q8E A;  4XOG A;  5FIX A;  1UU5 A;  3ZOI A;  5JVV A;  5DMY A;  3BIE A;  1C8N A;  3ENR A;  4MX3 A;  4K8F A;  1QGL A;  1ZZC A;  4ZZ5 A;  2ADD A;  4FPO B;  2MEV 3;  2ZGN A;  4PF5 A;  3ZO0 B;  3ZYI B;  2JEC A;  3N36 A;  3FL7 A;  4NE9 A;  2WLP A;  3KCY A;  4CUB A;  4IEW A;  2CV6 A;  2XUM A;  4HK9 A;  1H2L A;  4WM8 C;  4BQ2 A;  5EXO A;  1COV 2;  1MZE A;  1TQ5 A;  3A4U A;  3WP3 A;  2PHF A;  2YU2 A;  2JB8 A;  3RDI A;  3I3D A;  4CEY C;  1DFQ A;  4WVW A;  2HJI A;  2VZR A;  2XBO 1;  4UAP A;  5C9A B;  2VR4 A;  1W8W A;  3DUI A;  4MUV A;  4HL0 A;  4NR1 A;  1G8W A;  1N1V A;  3IDE A;  4QB2 A;  4DO0 A;  2MHF A;  3WIN E;  2VOK A;  3ZXL A;  2D6O X; 
#chains in the Genus database with same CATH homology
 4GZ9 A;  1RYY A;  2Y6G A;  1DP0 A;  4JHZ A;  3CKH A;  2CDP A;  2C9K A;  1J84 A;  1KGY A;  4PF1 A;  1XPW A;  2W46 A;  3IAP A;  3I3B A;  3CQO A;  2J1A A;  1L7R A;  2V5D A;  4QX3 A;  2E33 A;  5DPN A;  4ZY9 A;  1UXX X;  4P08 A;  1O59 A;  2VTF A;  3WNN A;  3FN9 A;  4BDV B;  2C26 A;  1HN1 A;  2WDB A;  2XHN A;  3THC A;  3OGR A;  2VZV A;  3UES A;  3DYP A;  3ACI A;  1NUK A;  2X09 A;  2W1W A;  3ACF A;  3C8X A;  1UMI A;  2BER A;  3T0D A;  2YFU A;  3OGS A;  3I2J A;  2XON A;  3GGL A;  2YC2 A;  2YC4 A;  3LEI A;  2W3J A;  5HPO A;  2JDA A;  2VQU A;  3DYM A;  4QB6 A;  4QPW A;  4KI5 M;  3FHQ A;  2WYS A;  3HJR A;  1JYV A;  3I3E A;  2ZEW A;  2B9V A;  2RVA A;  4M4P A;  3T09 A;  2ORZ A;  5LA1 A;  5A1A A;  4XUR A;  2W91 A;  1US3 A;  4E8D A;  4XZU G;  1UY1 A;  3W5N A;  5EJZ B;  4ARX A;  2V4V A;  4W4Z A;  4MOA A;  2VZQ A;  3A7Q A;  1US2 A;  5JR2 A;  5JXG A;  3VDC A;  3ACG A;  1O8P A;  3PUI A;  3VD3 A;  2VZP A;  4JKK A;  1UZ0 A;  3P6B A;  1OT5 A;  2VZ1 A;  5F7U A;  5JXI A;  1UY3 A;  1D7P M;  5DN2 A;  4LKS A;  3SKV A;  3WNO A;  5I0D A;  3OGV A;  2WQ8 A;  2QQN A;  2W1Q A;  4M4R A;  1XC6 A;  4BXS V;  3NJV A;  2ZEZ A;  5LA2 A;  4L0P A;  4JKL A;  4MAD A;  3WNM A;  3C7H A;  1JU3 A;  2W9X A;  4QX2 A;  2WN3 A;  2WZE A;  2EIC A;  3GXU A;  1DYO A;  4ZXE A;  5LA0 A;  2RV9 A;  2Y6J A;  2VZS A;  3HOB A;  1H6X A;  2J1R A;  3VD7 A;  2EIB A;  4XVH A;  5IHR A;  3WF0 A;  1GNY A;  1GOH A;  3T2Q A;  1O8S A;  2YB7 A;  5JXJ A;  3MO4 A;  4DXS A;  2OKX A;  4BK4 A;  2WO1 A;  2BBA A;  1J83 A;  1JZ6 A;  1SHW B;  5G04 L;  3T08 A;  4MGQ A;  2J7M A;  3E1F 1;  5G05 L;  3GM8 A;  3WF2 A;  4QAW A;  1JU4 A;  1UYX A;  1GMM A;  3OG2 A;  1ULP A;  2VJX A;  2Y6L A;  4D8M A;  2VM9 A;  5J1X A;  1PX3 A;  4A42 A;  2VZT A;  4HG6 B;  2VCC A;  1K45 A;  4ZZ8 A;  3I97 A;  2QQJ A;  5IFT A;  2WAB A;  3FHA A;  2W1S A;  1CX1 A;  3I2F A;  4P5Y A;  1CZS A;  1KEX A;  2PQS A;  3J7H A;  4CUC A;  4ARY A;  3U37 A;  3WQB A;  3WNK A;  2LS6 A;  3WF4 A;  2VZO A;  3ZM8 A;  3DEC A;  3HNB M;  2VMC A;  3SKJ E;  1JZ4 A;  4FI9 A;  2QQL A;  3CMG A;  1UX7 A;  1F4A A;  1LNS A;  2E26 A;  2Y6H A;  1JYN A;  4LPL A;  4OMC A;  2VCA A;  3MBW A;  5C7G A;  5C70 A;  3DYO A;  3THD A;  1P8J A;  1DLC A;  3III A;  1NAE A;  1K3I A;  2Y6K A;  1OF4 A;  4QX0 A;  4AAX A;  3K77 A;  1XNT A;  2QQI A;  2W5F A;  2JKX A;  4DEV A;  3A21 A;  4Z2A A;  3MV0 1;  2ID4 A;  3BN6 A;  2WAO A;  2VMD A;  4A4A A;  4UOJ A;  5JUV A;  3NRU A;  2B4K A;  3SEE A;  4ET7 A;  1OD3 A;  3OEB A;  5HXM A;  3W5M A;  4MO3 M;  4OYU A;  1PX4 A;  3UNP A;  1UY0 A;  3NQH A;  3NNG A;  3IAQ A;  1GOF A;  1L7Q A;  1UY2 A;  2J1S A;  3P1I A;  2L9L A;  2WUH A;  1W9W A;  2X10 A;  3HNY M;  4GWJ A;  3VD4 A;  3I2H A;  3HN3 A;  5FUI A;  2VCB A;  1W9S A;  4D0Q A;  3ETP A;  2YG0 A;  1MPX A;  3C7E A;  4A41 A;  4OUE A;  4A6O A;  5IYY A;  1W8N A;  2VQT A;  5JXH A;  4LHS A;  1JYX A;  2VMF A;  1I5P A;  1JZ5 A;  1H6Y A;  1CZV A;  1SDD B;  1IQD C;  2VOT A;  4XUO A;  1UWW A;  3HEI A;  5B4N A;  3CZU A;  2QQM A;  3A22 A;  1TVG A;  4LQR A;  5EIY B;  3LEG A;  4XUP A;  5C71 A;  1BHG A;  4PT6 A;  2BZD A;  4P00 B;  2HYX A;  4KMQ A;  4IUG A;  3NJX A;  4XUT A;  1GOG A;  2Y8K A;  2ORX A;  3C7O A;  1UYY A;  2WZ8 A;  1F4H A;  3K4A A;  4W8J A;  3C7F A;  1UYZ A;  4AG4 A;  1JZ8 A;  1JHJ A;  3T0A A;  4QDR A;  4BK5 A;  2W47 A;  3I2I A;  4A44 A;  2VME A;  3WNL A;  4DUV A;  1W99 A;  2JD9 A;  3BGA A;  1UY4 A;  2R7E B;  2XOM A;  2W94 A;  4DEQ A;  1K42 A;  1W9T A;  2VO5 A;  2XQX A;  1EUU A;  4CU8 A;  4P02 B;  1GQP A;  3AC0 A;  3K4D A;  3VDB A;  3CIH A;  1JZ7 A;  2LW8 A;  1JI6 A;  3MUZ 1;  3EYP A;  2WO3 A;  3MV1 1;  3HNM A;  3C7G A;  5EJ1 B;  1W8O A;  3ABZ A;  3VDA A;  3PUH A;  1NKG A;  1NX9 A;  2QQO A;  3GDB A;  3A23 A;  4CU6 A;  2YFZ A;  3WEZ A;  3T2P A;  1YQ2 A;  3WNP A;  4OMD A;  3IDA A;  3OEA A;  4CUA A;  2W92 A;  3CZJ A;  1PMH X;  1GUI A;  3F2Z A;  3JXS A;  1CIY A;  3LPF A;  1ULO A;  2WBK A;  5B4X A;  2KD7 A;  3VD9 A;  2Z4F A;  1UXZ A;  4DXT A;  3EB7 A;  2DDU A;  5LCW L;  2J22 A;  4CU9 A;  4QDS A;  4CVU A;  3ACH A;  2W1U A;  4QB1 A;  3I2G A;  2Y64 A;  4UI9 L;  2DCK A;  2J1V A;  4DUX A;  2BGP A;  2J1T A;  4A3Z A;  4CU7 A;  1UMH A;  3HPN A;  1JZ2 A;  5DQ0 A;  2ZXQ A;  4W50 A;  2QQK A;  2W87 A;  1WKY A;  4RYD A;  5CZK A;  1WCQ A;  2QBX A;  2C4X A;  2EIE A;  3T2O A;  1CZT A;  4OZO A;  1T2X A;  1TG7 A;  4YPJ A;  3SEP A;  2JE8 A;  3LPG A;  4DUW A;  1GU3 A;  4DXR A;  3T0B A;  3K4Z A;  2BGO A;  4TXW A;  3LEK A;  4TTG A;  1K12 A;  2X05 A;  4QDQ A;  3LE0 A;  2RJ2 A;  4XUQ A;  5CYY A;  1R64 A;  1OF3 A;  5IFP A;  2VL4 A;  3WF3 A;  3K75 B;  2E32 A;  2VC9 A;  4RN5 A;  1XNA A;  4MGS A;  5IJR A;  2VZ3 A;  4GWI A;  3CDZ B;  1JYW A;  3UET A;  4KWU A;  3K46 A;  2ZEY A;  3WSO A;  2ZEX A;  1W0N A;  2J1E A;  5JMO A;  3OB8 A;  4PQQ A;  3D3A A;  3ECQ A;  1SG3 A;  4E8C A;  4QX1 A;  2WO2 A;  2EID A;  5DMY A;  2VZU A;  2DCJ A;  3MUY 1;  3IB3 A;  3I2K A;  3LQC A;  4ZZ5 A;  2E31 A;  2CDO A;  2HLE A;  3VD5 A;  3FL7 A;  2W95 A;  4CUB A;  1JZ3 A;  1PMJ X;  4XUN A;  1EUT A;  2V72 A;  2WAA A;  2WN2 A;  3I3D A;  4JKM A;  3WF1 A;  4JX0 A;  2VZR A;  1OH4 A;  4UAP A;  2VR4 A;  2J1U A;  3OBA A;  4A45 A;  4QB2 A;  4BJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...