4ZZLA

Mexr r21w derepressor mutant causing multidrug resistance in p. aeruginosa by mexab-oprm efflux pump expression
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
146
Chain Sequence
b'GVDLGTENLYFQSMVNPDLMPALMAVFQHVWTRIQSELDLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MULTIDRUG RESISTANCE OPERON REPRESSOR
publication title Mutation-Induced Population Shift in the Mexr Conformational Ensemble Disengages DNA Binding: A Novel Mechanism for Marr Family Derepression.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
total genus 47
structure length 146
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zzlA01
2QWWA 2TDXA 3V7SA 3FXQA 4L0YB 3WU0A 5DCMA 2XVCA 1XDUA 2ZXJA 3LAJA 4M71A 1FP2A 2ISZA 1MZBA 4LG0A 1BOAA 1U6GA 2A07F 1U3EM 1FYLA 5HLHA 3F8NA 4EM1A 4LK0F 3GUDA 3FX3A 3KP7A 4XSZF 2PG4A 4A0YA 5LHIA 1ODDA 4KN4X 2G7UA 2EWNA 3MWMA 4G8XA 1BI2A 2X4HA 5E20A 5D5WB 1ZH5A 1S29A 1P92A 4A0XA 1ZGJA 1HQCA 4N9HA 4WF2A 5F1RA 1XD7A 2LDUA 4MEYF 3R61A 5E8GA 5LRRA 3KFWX 3LA3A 1W7PA 4MGRA 2R7DA 2EA2A 3E5QA 3JSOA 4EVIA 4HDVA 1E2XA 1XGOA 4G6DA 3ULQB 2DT5A 4N9IA 3EYYA 1W7PD 2QQAA 2H09A 1O57A 3N97A 4KYWA 4ZYHA 2OD5A 3KLOA 3T0YA 1FT9A 3GW2A 3DFGA 1IRGA 2FSWA 4M6YA 4OOIA 3WGIA 1F9NA 2EK5A 1R7JA 3P7NA 3R4KA 3JTHA 1LDJA 3K1MA 5J6XA 5ILVA 2DFIA 2D2WA 4KMFA 3HRMA 1U5TA 3GZ6A 1LNWA 4EJOA 2Z5UA 4RAYA 3KEOA 3MFKA 4CHUA 2V6CA 4DQ2A 5DUIA 2HTSA 4HF0A 3HRUA 3JSPA 1KQ0A 5D5XB 4RS8A 2O61A 4JK1X 1A04A 2XAHA 3CDHA 1LDKB 4Y17A 2VOPA 1YW7A 3W6JB 2UXNA 2X0LA 5D4RA 3ECOA 4EGZA 3P9KA 4CICA 3SXYA 4U0YA 3WTYC 2YSRA 5CVIA 3BY6A 5L3FA 3GF2A 1FSEA 1FP1D 1F1ZA 4YG2F 1KGSA 3MZYA 4HBLA 2GIVA 4A2UA 2XAQA 4IHTA 4L9JA 3EETA 5EEHA 4HYEA 3U2RA 3E5UA 1RNLA 4KFCA 3BDDA 2A6HF 3R0JA 5K5QA 4IRIA 2O6GE 3HIFA 2VC1A 5L3GA 4MTEA 1WQ2A 3Q9SA 3KP3A 4F7ZA 1I1SA 1FSHA 1SFXA 3PQJA 1BI1A 1H9GA 3VB2A 3TDZC 4ZH4F 1G3SA 2CSOA 1R58A 1T98A 2EV0A 3HSFA 4XSXF 3HTSB 1YW9A 2HTJA 2MD5A 4P9UA 2W25A 3GYHX 3QP6A 4G9YA 3OV8A 3I0TA 1LVAA 2EA4A 1UCRA 3KZZA 3LAPA 3CLOA 2ADUA 4G6QA 3EDPA 3NQOA 2JZYA 1FOKA 2RN7A 2PN6A 5LRSA 3DP7A 2MLKA 5ICGA 3BJAA 4L18B 3T5XA 3QOPA 1ZRCA 5HDNA 3IKVA 1MKMA 4ON0A 2XKPA 3B73A 2P5KA 1ZGAA 4OIQF 4RGSA 5KVRA 4FT8A 4GCVA 1TW3A 4Y13A 4AIKA 2QM3A 3CJNA 2ELHA 2IJLA 4BHPA 3F6OA 3GFJA 4PDKA 1Z9CA 1TW2A 3ZPLA 1PP8F 3FXUA 2EJRA 4P5OA 4ETSA 1SD4A 4EJWA 2HKXA 2HDCA 4E70A 4ZYEA 1S7AA 1T6SA 5KK1A 3E3VA 4UNOA 2UWMA 4HW0A 1D5VA 4YIFA 3WTTC 5BPDA 4HF2A 4EV0A 3TDUC 3GXOA 5A2QZ 1ZLKA 2CW0F 3HHGA 4NHJA 3C18A 5H6QA 5FD5A 2YX4A 3BWGA 2F5CA 2PJPA 4Q47A 1JGSA 4ENKA 2DPDA 4RAZA 1Z7UA 4JBAA 2FE3A 1FYMA 4HV5A 3PFIA 1XMAA 4KA4A 5BPIA 3IKTA 4WK8F 2DI3A 3J81K 5K5RA 4R8HA 2IA0A 3RKWA 3GWZA 2XIGA 4HV6A 1B1BA 4P9FA 3RIRA 2VE9A 3LSTA 5LEKA 2P8TA 3I4PA 3IRRA 4ZZDA 2MA3A 2DQLA 2MH9A 2MH2A 1OKRA 5JFRA 5BOXA 2H94A 4ESJA 2DO7A 3TOAA 1XMKA 3DKWA 2YU3A 2BYVE 3RTRA 2UXXA 3ISPA 5TRDA 4MNUA 5F64A 5HS9A 2PBIA 2P4WA 2P6TA 4WXHA 2QYOA 3FM3A 1G3TA 2EFWA 1S7OA 4KDPA 2H6CA 2XAJA 4EM0B 1I1GA 3K2ZA 4BH9A 5E8IA 4H0EA 4MEXF 1J2XA 1S8NA 2K27A 1IW7F 1KYWA 2QVOA 2EB7A 3FMQA 1HKSA 1L0OC 1MD0A 4PZJA 2OAZA 4KIGA 4I7HA 3TGNA 5DEQA 4EMSA 1UHMA 3EYIA 4L0ZB 3QAHA 5CVVA 2JSCA 2RKHA 2GXGA 1XN7A 2G7HA 2WC2A 1O3RA 4OU0A 5E1WA 1BBYA 1O3SA 5FD6A 1ZAOA 2FBHA 1HKTA 4TV7A 1ULYA 3O3KA 1I27A 4XLNF 4KN7X 5AONA 2W24A 2GA2A 3D0SA 3G73A 1IN8A 4I98B 1TBXA 2HZTA 1K6OA 3IHUA 3F23A 3E5XA 4WCGA 1YIOA 3RYPA 1IXRC 1CF7B 5ILSA 4KMUX 4LB5A 3QPTA 1UHWA 3P9IA 2ZFWA 2KJBA 2RQPA 4BHBA 1AWCA 5FGMA 1QQIA 2ZCWA 1TTYA 1YFHA 3V7CA 3NEUA 3DXJF 1YO5C 5FLXK 1Z05A 1OR7A 4LLLA 5LBQA 5L3BA 5BMZA 5HOOA 4S04A 1T2KA 1EH7A 2W84A 1IUYA 3ZN0A 1WRJA 1FBUA 1Z91A 1B59A 3GFLA 1T39A 4XRFA 3WE3A 1O3QA 1D8JA 2IRFG 2YR2A 4UXNA 2XASA 5E1XA 1REPC 3V8KA 1WWXA 5LHGA 2M45A 3M8EA 4RGRA 2K7LA 5D6FA 1BM9A 3EUHA 2FA5A 1U78A 2R3SA 2IA1A 2ZKZA 3GFIA 3I5UA 4A6EA 4CXFA 2PEXA 3GZ5A 1FZPB 4YIIA 3ABTA 2PI0A 1XSVA 1QZYA 2KIUA 4IVNA 3BROA 3RKXA 1IXSB 3V8LA 2IW5A 3DPLC 4G94A 3F21A 2ESHA 5LGTA 1LQ1A 2XAGA 2PLYA 2BE5F 3DF8A 2VXZA 2ISYA 2HS5A 3FZVA 1USTA 1J5YA 3KP5A 5K5OA 1QNTA 4RB0A 3KCCA 5EEGA 1YG2A 1XGMA 3K9TA 4I0AA 3TOBA 2NAZA 1KA8A 2HEOA 3GVAA 2KJCA 4IHSA 5D5VB 5HS7A 1DPRA 1SMTA 1Z6RA 2FQ3A 4EGYA 1ON2A 1EV7A 4A5MA 2CYYA 4AD9A 2HYGD 3CO6C 4OIRF 3RPUA 2L4MA 1ZLJA 1DDNA 4UVAA 2A69F 1BIBA 1RZ4A 1W4MA 1GXPA 1J75A 1QZZA 1HSJA 3DPTA 2XV4S 1GVJA 4P55A 3L9FA 1RIOH 2O3FA 4HDUA 1YS6A 2V1XA 3KP4A 2IA2A 2M87A 2HWVA 3GFMA 4LMYA 3FMRA 1R1UA 2COMA 1BI0A 3BPVA 2E1CA 2UZKA 1WSUA 4IPAA 3VEPA 5HVQC 2DK8A 2KIFA 1B6AA 5BS6A 2K4JA 2ZMEB 1U2WA 3R0AA 4QLCU 1OYYA 2A5YB 2J5PA 1S6LA 1J0RA 5LGUA 2E7XA 3F8CA 3CO7C 1XB4A 5JI6A 2VOOA 4G7HF 5L3EA 2QUFA 2CGPA 2EV5A 4OIPF 3FM5A 1Y0UA 2ZO4A 4XLPF 3I53A 1UB9A 1IN4A 4GGGA 4I02A 2E7WA 2PFBA 4A5NA 3J7AO 3HRSA 1T0FA 2DTRA 3WODF 5HDKA 3HSEA 4GXOA 4YFXF 1G4DA 4HAMA 4NB5A 1SFEA 1FC3A 4UVBA 5D5UB 4RB2C 3HYIA 2PMHA 4EQQA 4CDGA 4BQAA 1JHFA 2A6EF 1ZHFA 2B0LA 3M7GA 3WTUC 3MZHA 2H6BA 3IL2A 4BAYA 2ZMEA 3WU1B 4M73A 4CGZA 1LEBA 1TQPA 5ICFA 2NS0A 1IZ1A 4OMZA 1K79A 3C7JA 5LEJA 3IWZA 4WWCA 4BYYA 1K7AA 2Y48A 2QLZA 3SHFA 4R79A 1Z6TA 3WG9A 4RGXA 1HW2A 1K78B 4M9SA 5DDGA 2HOEA 4OMYA 1OYWA 1XCVA 2JTVA 4N0BA 4U0VA 2OBPA 5E1ZB 4HQMA 5L3CA 4U88A 3V8JA 2L01A 1ZARA 3WGHA 2CWEA 2GAUA 2VBZA 5LLQA 4CZZA 1O7LA 1P6RA 5ILUA 4O6JA 1XGSA 4AWXB 4O3MA 4A6DA 2KKOA 1IAWA 1MJ9A 4P96A 1J9IA 3J81Z 2FEZA 2L02A 3Q9VA 4IF4A 3R60A 1P2FA 4HQEA 4LLNA 1H0MA 1HW5A 3HOTA 5BQTA 1P4WA 3HOSA 4WX9A 5D8LB 1WKMA 1K78A 2EFQA 2F5DA 3GX4X 3ABUA 2P7VB 3EQLF 4FX0A 2OZ6A 1Q1HA 2LKPA 4MHGA 3RKYA 2V9VA 2F2EA 3T8TA 5D8KB 5J8CA 1SAXA 3FXRA 3E6CC 5IT9Z 4LJZF 3TQNA 4CYDA 1KQ8A 1G3YA 4A0ZA 1XDSA 3ML6A 1BIAA 5E18F 4RB3C 2FNAA 4HLXA 1SMYF 3IWFA 1EH6A 4HF1A 1G3WA 2QQ9A 4PGHA 3L00A 5H6RA 2M30A 4Z2YA 3CUQB 4FX4A 4AVPA 2O8XA 2Y0MA 2D1VA 3I58A 3BJOA 2Q8KA 1SD7A 1JXSA 1FWZA 1DPUA 3KZYA 3ZN1A 2W57A 4WXDA 2CO5A 1J59A 4M6XA 3FHZA 5IT9K 3HRTA 3CTAA 2M8EA 1ZG3A 3K0LA 4AIHA 1IF1A 1RUNA 5E17F 4EJVA 2GXBA 3ZMTA 6PAXA 5CVRA 2VT2A 1ON1A 4IJAA 4LB6B 4PCQA 2OA4A 3VODA 3ZMVA 2BGCA 2FU4A 3ZMUA 4LFUA 2MC3A 1ZG5A 1R1VA 2W85A 2NNYA 4KUMA 2XUBA 4FHTA 2VBYA 1TQIA 2ESNA 3E6DA 2VBWA 5FFXA 1IXCA 3ROUA 1RUOA 3L09A 1HXDA 2WV0A 1ZRFA 4GYIA 2ACJA 3QRFF 3F8BA 2L4AA 5FLXZ 1YLFA 3NRVA 4HZFA 2DK5A 5FFZA 4YFNF 2HFHA 2HGCA 2HQNA 3H3ZA 3SZPA 1ZRDA 4S05A 4QWQA 2D1HA 2STTA 2RV8A 3JAMK 4XBFA 1QPMA 4B09A 4K2EA 4KIBA 3K1PA 1X3UA 3FF5A 4U0WA 3U9GA 4MQVA 1ZG1A 2RGVA 3BP8A 3OOPA 3ZMSA 5IT3A 3HHHA 4HX4A 2EV6A 2YPRA 3M8FA 4RB1A 3J80K 4EJTA 5D4SA 5HLIA 1QBJA 5K1YA 2FF4A 3N4MA 2DBBA 5HDGA 2XHKA 1FYKA 1XSDA 4KICA 3PQKA 3DV8A 2G9WA 1GXQA 1CF7A 1IN7A 4UV8A 2YX7A 3I71A 2Z9OA 1HKQA 4Q48A 3F22A 2OU2A 4KIFA 5D6EA 3T8RA 1BI3A 2DLLA 3C3WA 1W7PB 1BC8C 5AIPA 5DV5A 4HLYA 3E97A 4KT5C 1R36A 2VC0A 2XKOA 2VBXA 1E17A 1IN5A 1D8KA 2OQGA 2M1BA 3ZMZA 3TO6A 2L54A 5ICCA 4I0BA 4ESFA 3HSRA 1MGTA 2GA1A 4OINF 4DNCA 2Z99A 5CJ9A 5J8FA 2QENA 4HA8A 3KEQA 1YW8A 1C0WA 2HYFA 1I5ZA 2FBIA 1U5TB 3ECHA 5ED4A 5H20A 3HTUA 3WTSC 2FBKA 3K69A 2GZWA 3B02A 3WGGA 3P9CA 3F3XA 2A61A 3KETA 3O6BB 2RDPA 4GYGA 4JQFA 2QZ8A 1YS7A 4Q4ZF 4KNYA 2VODA 1P4XA 1R5GA 2V1UA 4IRHA 1PDNC 3KP6A 2QBYB 3I59B 3MQ0A 2KIMA 1KQ9A 2XRNA 2FMLA 3BPXA 1F4KA 1QGPA 3JW4A 2ZJ2A 2AXLA 3QP5A 1FY7A 2BEOA 3RI4A 3KE2A 2VONA 2WTEA 1Z1DA 3KP2A 1TLHB 1UFMA 2V1DA 2K02A 1KU7A 3F8FA 2CG4A 3QPHA 3WTWC 1MDMB 1V3FA 3F72A 4RGUA 2M5WA 1J7KA 3V7RA 4UHTA 4LLGF 4I01A 1JE8A 1SD6A 4A12A 4G7OF 1LJ9A 2FOKA 3GEZA 3L2CA 1TNTA 3TO9A 5JR3A 5LGNA 4L9VA 1HW1A 4BXUA 2QQBA 1FX7A 5LHHA 1TNSA 2RNJA 5JVTA 1YQAA 2QBYA 3I59A 2JT1A 1B4AA 3ZQ7A 3D5LA 3DEUA 3LA7A 3CUQC 2LF7A 2ETHA 5CYVA 4WXCA 5L3DA 2OZUA 5JHUA 1CGPA 3LWFA 1RI7A 3LQQA 4L5IA 1FNNA 1MDMA 1H9TA 2F5EA 3F6VA 3LA2A 1BC7C 2IT0A 3Q5FA 3RDIA 4ZZLA 1R23A 4R1HA 1WI9A 2A3SA 3SZTA 2PMUA 2Q2EA 5DUKA 2H27A 2XAFA 1TQMA 1ONVA 3H3UA 2WWYA 1V4RA 1L3LA 1HBXG 3BOQA 1AOYA 1R5HA 2EFOA 2DQRA 2NNNA 4ENNA 4EM2A 3I64A 1FBSA 4CO8A 2ZNYA 2ZBKA 2KRFA 3WTZA 5DD8A 4M72A 1B9MA 2DW4A 1QO0D 1YTYA 1W5SA 4M74A 1O7FA 3BJ6A 1DP7P 3KLNA 1MJAA 2P5LC 2A68F 2OQRA 2JPCA 1BJAA 3K1NA 3QU3A 5CVUA 4EJUA 2EFNA 2ZNZA 3H92A 4BNCA 3DQVC 2CFXA 2PQ8A 4I09A 2P6SA 1D3YA 1LEAA 3GLXA 2RVCA 2F5FA 3V4GA 3O2PE 4AIJA 1EH8A 1JHHA 1KU3A 1STZA 3WE2A 2LNBA 5HS8A 2R7FA 2EFPA 2MBFA 1O3TA 4UV9A 1U8RA 2HQRA 1XCBA 4LK1F 5DCFA 3ZMDA 2O03A 4UUVA 2HR3A 2AS5F 3C1DA 1DUXC 2VE8A 1USSA 3RPQA 4D0PA 1G6NA 2BBYA 3ZP5A 3HUGA 3I54A 2FMYA 4NQWA 4MTDA 1KU9A 3ELKA 1R22A 5HLGA 2D45A 2MLGA 3BZ6A 1ZYRF 2DAOA 5FB2A 3MAJA 1ZN2A 3LFKA 1R00A 3R6SA 1BN5A 2BV6A 4M9ZA 5AIQA 4YFKF 5CLSA 5A2QK 2XROA 1FPQA 1OPCA 1MJBA 1XSXA 3SFZA 3SQNA 1B9NA 2HKOA 5ERIA 5CVJA 3M9AA 3AAFA 1S3JA 3FMSA 3IC7A 2Q0OA 1R1TA 3RJPA 2LF8A 3VOEA 4L9TA 3E6BA 4ESBA 1ZREA 4UVCA 1KU2A 1LDDA 1IN6A 4B8XA 4MQ9F 1VTNC 2DU9A 3CUOA 1HSTA 3REOA 5DD4A 1PUEE 3W6KB 2Z3YA 4GO1A 3JAMZ 4HOBA 4IXAA 3TO7A 4BHCA 1LB2A 2FNPA 3GO5A 2DPUA 3CUQA 3U1DA 1F5TA 2L3DA 4U7DA 1U5TC 2K86A 1OYIA 2JRTA 4IRGA 2LSOA 4ENJA 4O5VA 2J5OA 3FWEA 3S2WA 1W5TA 4LD5A 3F8MA 4ASNA 1GHCA 3T1BA 4ZYDA 1T38A 1PP7U 1KYZA 3IRQA 3J80Z 3L7WA 3COAC 2K4BA 1SD5A 4LGWA 1XGNA 2IVMA 2JPBA 3LQRA 2FRHA 3RYRA 2NYXA 2E1NA 2RC4A 2NRAC 4Q5SF 5TJJA 3QU6A 5FO5A 5ICEA 4G7ZF 3TKYA 3WTXC 4Y15A 2O0YA 3MEXA 3JTGA 2GWRA 5DCMB 4U7BA 4OIOF 4ZYGA 4HX7A 3VFZA 1OMIA 1YYVA 2GQQA 3E6MA 3G3ZA 2VT3A 2CQKA 2P7CB 2VN2A 1FBQA 2XGXA 4L5JA 4LG0B 2Z33A 1IRFA 2FXAA 4HX8A 5F6FA 2V79A 4M9XA 3WTVC 2C6YA 5DYMA 4ENMA 2STWA 3M1EA 2IPQX 1NHAA 1I6XA 1FLIA 1P4AA 2IP2A 2P5VA 4L9NA 4PGGA 3ERED 2Y75A 3MCZA 1SFUA 4I2OA
chains in the Genus database with same CATH superfamily
2HU9A 2QWWA 1U9OA 3BR2A 2TDXA 1DGRM 3V7SA 1RETA 1TWGJ 4XN3A 1YJNI 3OYAA 4XK4A 3BLYA 4UY8I 3FXQA 4L0YB 3WU0A 3AL0B 1FOYA 5DCMA 3BG6A 2XVCA 1LVKA 1XDUA 2ZXJA 1UZCA 2F6CA 3HKZA 3LAJA 1V54H 4F52A 4M71A 1FP2A 2ISZA 1VQ6I 1MZBA 4LG0A 2K3FA 4XRMA 1BOAA 1U6GA 2CW7A 2A07F 3S3OA 1U3EM 1FYLA 1MNMC 5HLHA 4Y7NJ 3F8NA 1VFCA 4ITVA 1X1BA 4EM1A 2VKHA 4LK0F 2LD5A 3GUDA 2XPVA 3HGYA 3FX3A 3K2AA 3KP7A 2P0WA 4DZPA 2ZJPF 3A1YA 2DJIA 1JKQC 4XSZF 2PG4A 4A0YA 5LHIA 1JJ8C 1ODDA 1HC8A 5IOZA 4KN4X 4IOAF 2G7UA 3A0BC 1S72I 2EWNA 3MWMA 4G8XA 1BR1A 1BI2A 1YOVB 2R7QA 3CC4I 2B63J 1R5ID 2X4HA 1VI0A 2VJ5A 3D5RC 2PMZN 5E20A 2XB0X 5D5WB 1ZH5A 1S29A 1P92A 3DCFA 4A0XA 1ZGJA 2H8WA 3HOUJ 1HQCA 4A3JJ 4N9HA 4WF2A 3BR1A 1V55H 4DW6A 3FBIB 5F1RA 1XD7A 2LDUA 4MEYF 2R7TA 3R61A 5E8GA 3K4KA 2M3AA 3QOEA 4X6AJ 5LRRA 3KFWX 3LA3A 1W7PA 1VZ0A 2X1CA 2V9KA 4MGRA 2R7DA 1U0JA 2EA2A 3E5QA 3DEWA 4BQOA 3S2DJ 3JSOA 2L9VA 4EVIA 3OYHA 4HDVA 1E2XA 3S3MA 3ZQQA 2WAQA 1ETXA 2NS8A 4FE4A 1XGOA 3BR6A 4G6DA 3ULQB 5FROA 2DT5A 3CJRB 4LITA 2V26A 4N9IA 3EYYA 2MD0A 3H36A 1W7PD 2VJ4A 2QQAA 2H09A 1O57A 2L7KA 4A3EJ 4I99C 2DFFA 5J1RA 3N97A 4ZYHA 3OS2A 4KYWA 2OD5A 2UV1A 5B1AH 1X58A 2LY9A 3KLOA 3T0YA 1QZEA 4IHXA 1FT9A 1V5GA 1Y0NA 2KP6A 3GW2A 3DFGA 1IRGA 3FXLA 2FSWA 4M6YA 4OOIA 3WGIA 2E1MB 1F9NA 2A5WA 2EK5A 3HPGA 1R7JA 3P7NA 3R4KA 4XR6A 3A02A 2RREA 3JTHA 4PK4A 2MSYA 1LDJA 3K1MA 1F36A 5J6XA 3GBGA 5ILVA 4BJ6C 2DFIA 3SJMA 1FEXA 2D2WA 4KMFA 1X4OA 3HRMA 1U5TA 3GZ6A 1LNWA 4EJOA 2ZB9A 3BC8A 1PVEA 3BTJA 2Z5UA 4RAYA 1X1CA 3KEOA 3MFKA 4ZDLA 1BL0A 4CHUA 2V6CA 1MBJA 4DQ2A 1JUSA 2E5ZA 5DUIA 2HTSA 4HF0A 4PJJA 3MKZA 3HRUA 3JSPA 1KQ0A 3PSFA 5D5XB 2ECCA 4JP0A 4M3BA 4RS8A 2O61A 1D1BA 4JK1X 2ME0A 3G6EI 1G59A 1A04A 2XAHA 3CDHA 2XGEA 3K4MA 1LDKB 4Y17A 2VOPA 4XONA 4HPQA 1YW7A 2XF6A 5IYDJ 3JRCA 3W6JB 2UXNA 4D5CA 4BY1J 2X0LA 4DBQA 4FISA 5D4RA 1JUMA 3ECOA 4EGZA 1YIJI 3P9KA 2KZGA 4DGWB 1XS9A 2JK3A 3RZOJ 4CICA 3SXYA 4U0YA 2VUMJ 3WTYC 2JA2A 2YSRA 4BDYA 5CVIA 3BY6A 5L3FA 3D1NI 3BQYA 3GF2A 1FSEA 1MSEC 5CPRB 1FP1D 1F1ZA 2A05A 1MMNA 2BY1A 4YG2F 1KGSA 3MZYA 4HBLA 2GIVA 4A2UA 2CJJA 1JKOC 2XAQA 3LSGA 2EILH 2LYCA 4L9JA 3EETA 4IHTA 5EEHA 1A35A 4HYEA 3U2RA 1IO2A 3E5UA 1RNLA 4KFCA 3BDDA 4GDFA 1GV5A 2A6HF 3R0JA 5K5QA 3K4LA 4IRIA 2IS4A 2O6GE 3HIFA 2VC1A 3HOVJ 3A03A 2JRMA 1W36C 5L3GA 5GP9A 1T08B 4MTEA 3CCMI 2LP0A 4E7LA 4UB6C 2K40A 1FOXA 4V19K 1WQ2A 1N78A 3Q9SA 3KP3A 4F7ZA 5B66C 2I5UA 1I1SA 1FSHA 1SFXA 3PQJA 1BI1A 1QVUA 1H9GA 2IXSA 3TDZC 3VB2A 4I76A 2EZHA 1IGNA 1AHDP 4ZH4F 1G3SA 2CSOA 1R58A 1T98A 2EV0A 1UMQA 3HSFA 4XSXF 4KITB 3HTSB 1YW9A 4XM3A 2HTJA 2MD5A 3C2BA 4P9UA 5M5YJ 3J7AY 2W25A 3SDGA 1OFCX 1SANA 3GYHX 3QP6A 4G9YA 1A36A 3H5AA 3OV8A 2CW8A 3I0TA 1LVAA 3K4CA 2EA4A 4AIDA 1OJLA 4QSHA 3DKXA 3LSMA 3PNYA 1X2MA 1UCRA 3KZZA 3LAPA 3CLOA 2ADUA 4G6QA 3EDPA 3NQOA 2KL4A 2VKVA 3CMAI 2JZYA 1M1EB 1FOKA 1FMWA 1WJEA 4RA2A 4J00A 2RN7A 2PN6A 5LRSA 3DP7A 2MLKA 1TZLA 3OIPA 1VQ4I 5ICGA 3BJAA 4L18B 1AU7A 1KONA 3T5XA 3QOPA 1ZRCA 3A4CA 3W2VA 5HDNA 3IKVA 3TL4X 3HBLA 1MKMA 4ON0A 2XKPA 3B73A 3OSFA 4II2A 1OR7C 2P5KA 1VQ9I 2R7XA 4B47A 1ZGAA 2XB5A 2WB1A 3I56I 4OIQF 2KMUA 3QPSA 3GTMJ 2DOAA 1SVOA 3AFHA 4RGSA 3WG7H 1HF0A 5KVRA 4FT8A 4A3LJ 5C4JJ 4BXXJ 4GCVA 2FJ1A 2EZLA 1RKWA 1TW3A 4Y13A 2ZSHB 3K70C 4AIKA 3S3NA 2Y31A 4BEHB 2QM3A 3CJNA 3IP4B 2AHQA 1JTXA 2ELHA 2IJLA 4BHPA 4XOTA 3F6OA 3GFJA 4PDKA 5HODA 1Z9CA 1RRJA 4E7JA 2IGNA 3DTEA 3ERMA 2CU7A 1TW2A 3ZPLA 2HPIA 4YELA 1PP8F 3FXUA 2EJRA 1APLC 4P5OA 4ETSA 3BR5A 2B7EA 3OL4A 1SD4A 1NK2P 2DT7B 3S1RJ 1V5FA 4EJWA 2HKXA 4UB8C 2HDCA 1K4TA 3DU5A 4E70A 2R7ZJ 2MG4A 3P5JA 2VQCA 1TT5B 1S7AA 1T6SA 5KK1A 3E3VA 2VJIA 4ZYEA 2BW3B 4UNOA 2UWMA 4HW0A 4RBOA 4YIFA 1D5VA 3WTTC 5BPDA 5HNFA 4HF2A 4EV0A 3EUHC 3TDUC 4CH7A 3HKZN 4FCYA 3GXOA 1IUFA 5A2QZ 1XC5A 3DBRB 2NS7A 2QKLB 1ZLKA 2CW0F 3H35A 3HHGA 3OYFA 4NHJA 3I55I 3C18A 5H6QA 3C2HA 5FD5A 4Y33A 3LSRA 1IRZA 2YX4A 3BWGA 2F5CA 2HOAA 5EF6A 2PJPA 4Q47A 1JGSA 3FXJA 1MMAA 4ENKA 2DPDA 3OR1C 1SAUA 4RAZA 2CV1A 1Z7UA 4JBAA 2FE3A 1FYMA 4HV5A 3PFIA 3LOCA 1IV6A 4FTHA 1XMAA 4PJMA 2HXOA 4BEHA 4RMNA 4KA4A 1JT6A 4WK8F 3IKTA 5BPIA 1TL8A 4A3GJ 2KHMA 2DI3A 4C3IJ 1MSFC 4XRSG 2X48A 3J81K 2DA2A 2MC4A 5K5RA 4R8HA 2R7OA 3CJQB 5FRMA 2IA0A 3RKWA 1WFXA 2XIGA 3GWZA 2X85A 2V7FA 4HV6A 3ESWB 1B1BA 4P9FA 3RIRA 4LG3A 1PUFB 2VE9A 3NWSA 3LSTA 3SDBA 1R9TJ 5LEKA 3AL0C 3C2GA 3DLAA 2E34A 2P8TA 3I4PA 1J09A 2KT0A 3EUKL 3IRRA 4ZZDA 1Z7LA 2MA3A 3DPUA 4PSWA 3OYBA 2DQLA 2MH9A 2Y30A 2MH2A 4E7IA 1OKRA 5JFRA 5EG0B 5BOXA 2BW3A 2H94A 3PUFA 4ESJA 3MVPA 2DO7A 1YX5A 1A6IA 4BE2A 3TOAA 1XMKA 4E6KG 2V1NA 3DKWA 2ZC2A 4D9JA 5CQGA 2YU3A 3J7ZI 4BJTA 2BYVE 3RTRA 2M0CA 2UXXA 2WAQN 3HOWJ 2JSPA 3ISPA 5TRDA 4MNUA 5F64A 2V6EA 3CMYA 4NC8A 3PL8A 5HS9A 3L2QA 1HDDC 5GAHJ 2PBIA 2P4WA 2P6TA 3A01B 4WXHA 4ZC3A 1OCTC 2QYOA 3FM3A 1SVLA 1G3TA 3CCUI 1XG1A 1XMXA 2EFWA 1S7OA 4KDPA 3BZCA 2K9QA 2H6CA 1LFPA 2XAJA 4M3FA 3HGGA 3H9GA 4EM0B 1I1GA 3K2ZA 4BH9A 2DYSH 4E7KA 3G1LA 1DP3A 4XKBA 5E8IA 4H0EA 4D7NA 2COBA 1H8AC 4W1UA 3FK6A 2ZFUA 4MEXF 1J2XA 3HC7A 1PUFA 2E2HJ 1S8NA 2K27A 3KZIC 1IW7F 1ETYA 3I4NJ 3QWLA 2GLOA 1X1AA 2Y2ZA 1KYWA 3TBIA 1SFKA 4XIDA 1UHSA 2QVOA 1Z67A 2LR8A 2LBFB 2EB7A 5EG0A 5JVGF 3FMQA 4ABZA 4HRIA 4CCLA 4RAGA 1MMSA 1HKSA 1L0OC 1MD0A 4PZJA 2W4SA 2OAZA 4KIGA 3ASNH 1D0YA 4I7HA 5DEQA 3TGNA 1VQ7I 5GAGJ 4EMSA 2K9SA 3TMOA 5GPAA 1UHMA 3EYIA 4L0ZB 3QAHA 5CVVA 2JSCA 2RKHA 4BDZA 2GXGA 1XN7A 3LSPA 3BT9A 2G7HA 2WC2A 4M3GA 4OU0A 1O3RA 5E1WA 1BBYA 1O3SA 3BTLA 5FD6A 5EGOB 1ZAOA 5JHFA 2WY8Q 1POGA 1T8IA 2CQNA 2FBHA 5E3OA 3EPZA 1HKTA 4TV7A 3BTCA 1ULYA 3O3KA 3OWTA 1I27A 1W1WE 4XLNF 4IO9F 4KN7X 5AONA 2W24A 1D0XA 1ITYA 2GA2A 3D0SA 4XORA 3G73A 2E1MC 4G12A 2W82A 2R5ZB 1IN8A 4I98B 1OCPA 5IYBJ 1TBXA 2HZTA 1RKTA 1K6OA 5JLWA 5F1JA 3IHUA 1LPQA 1UJ8A 3JRGA 1G2HA 3W2AA 3F23A 3E5XA 3FXMA 2Y0SA 2EIKH 5H2FC 3CC2I 2HXIA 2E19A 4JX4A 3RQ4A 1ENHA 3FISA 4WCGA 1YIOA 3RYPA 1IXRC 5HLTA 3E1SA 4BJ5C 2BXZA 1CF7B 1T0FC 2WA0A 2ID6A 5ILSA 2DA7A 4KMUX 2QGUA 2VKEA 2AXTC 4LB5A 2JA5J 2Z1DA 1LFUP 3QPTA 1UHWA 2LBFA 2XDVA 1WJCA 3P9IA 2DA4A 2KIQA 2WV1A 2ZFWA 2KJBA 2RQPA 4BHBA 1AWCA 3PNVA 1WPKA 2M7BA 2OPTA 3GTJJ 1DGWY 3RCOA 5FGMA 1QQIA 4E4HA 3JRAA 1WZ2A 2ZCWA 1VF9A 4BKXA 1TTYA 3S17J 2QA4I 1YFHA 3CZ6A 3V7CA 3VYTB 2R5YB 3OSGA 3FK7A 3NEUA 2DT6A 3DXJF 4CCKA 1YO5C 4YRVA 4IZZA 5FLXK 1Z05A 1E3PA 1OR7A 1LUJB 2DXIA 2WY7Q 2DJNA 4NDLA 4DIQA 1OCRH 4LLLA 5LBQA 5L3BA 1ZGWA 2KFDA 5BMZA 2WAFA 5HOOA 2ZXHA 2L5QA 1YJ9I 2LKSA 2ZMEC 4CCOA 4S04A 1T2KA 1EH7A 1Z3YA 2R7VA 2W84A 1MBHA 1IUYA 5K7HA 3ZN0A 1WRJA 3ZCOA 1FBUA 1Z91A 1B59A 3HG9A 4CYCB 2R5ZA 3GFLA 4BY7J 1ZELA 3VPRA 1A31A 1T39A 4BBRJ 1TC3C 4XRFA 1GT0C 3WE3A 1O3QA 1D8JA 1FIPA 2OCCH 2EZIA 2JVGA 2IRFG 1GLNA 1HCRA 2L9RA 2YR2A 2XASA 4UXNA 5E1XA 2HI3A 4AYBA 3OS1A 1REPC 3L1PA 3B6CA 1X4PA 3V8KA 3BG5A 4C3JJ 1WWXA 5LHGA 3S1MJ 2DA5A 1A6QA 1X19A 3LSJA 2M45A 3M8EA 5B1BH 4RGRA 4XLHA 3AG3H 2K7LA 3V42A 3G1MA 4XNFA 1BM9A 5D6FA 3OIOA 3EUHA 2FA5A 1U78A 2R3SA 2IA1A 2ZKZA 1Y6IA 2Y69H 1MIJA 1V5EA 3GFIA 1VQNI 2ICWG 3ABLH 3I5UA 3HOZJ 1ZR2A 4A6EA 2WB1N 4CXFA 2PEXA 1Z77A 2CUFA 3DWLE 3GZ5A 1FZPB 4YIIA 3ABTA 4IX7A 5FKMA 2MABA 3ZQHA 1P7JA 2NOGA 2PI0A 1WJFA 1XSVA 1QZYA 3JCUC 5KAIC 2KIUA 4IVNA 3BROA 3ZR8X 4CYCA 3RKXA 1IXSB 4QTRA 3PIOF 4RM2A 3V8LA 3VYSB 3OS0A 2IW5A 3TP3A 3DPLC 4G94A 5BNGA 2ESHA 2TCTA 5LGTA 4ZYAA 3F21A 1R49A 2M7AA 1LQ1A 2XAGA 2PLYA 2BE5F 3ZQFA 2F48A 3GMEA 1RPWA 4F93B 3DF8A 3CMEI 3NWTA 3CD6I 1JKPC 2VXZA 2LC2A 3BG9A 5KCMA 2ISYA 2HOSA 2KDOA 2IS6A 3BG3A 2HS5A 3FZVA 5B5EC 1USTA 1J5YA 3KP5A 5K5OA 1QNTA 4RB0A 4A93J 3LNQA 3KCCA 2ELKA 5EEGA 1YG2A 1XGMA 3K9TA 1YHQI 2PX9A 4I0AA 3TOBA 3GTGJ 1OQYA 2JA7J 1QHGA 2NAZA 1KA8A 2HEOA 3GVAA 4II3A 2KJCA 4RAFA 4IHSA 2EBIA 5D5VB 5HS7A 1DPRA 1SMTA 1T56A 1Z6RA 1OLTA 2FQ3A 2HDWA 4M3EA 1ON2A 3KYCB 4EGYA 4KISA 3HDDA 3AKZA 1EV7A 4JOMA 2F4OB 1JT0A 3HXLA 4A5MA 2CYYA 4AD9A 1CQTA 3M4OJ 1QU3A 2K85A 2HYGD 5DM7F 3CO6C 4OIRF 3RPUA 1B72B 2L4MA 1ZLJA 1DDNA 4UVAA 2A69F 5GTHC 1BIBA 1RZ4A 1W4MA 1DQUA 2BHYA 1GXPA 3JRIA 1J75A 1QZZA 2YUSA 2Y9ZA 1HSJA 4J01A 2F5VA 2ZJQF 3M8JA 3DPTA 1R71A 3Q0UA 3GTQJ 2BHZA 2XV4S 1VNDA 1R4MB 1GVJA 5EYRA 4P55A 3J7YJ 2MW8A 3OYGA 1MH3A 3L2WA 3L9FA 4MO7A 1MBFA 2KQRA 1I3QJ 2ELJA 2PJRB 1RIOH 2O3FA 4HDUA 5GTIC 3W6VA 1YS6A 5EZHA 4CCMA 2V1XA 3KP4A 3DEEA 2Y9YA 2IA2A 2M87A 3WU2C 2M4KA 2HWVA 4IHYA 3GFMA 4LMYA 3FMRA 1R1UA 2COMA 5LD2C 1BI0A 2BXYA 3FKJA 3BPVA 2E1CA 2UZKA 1WSUA 4IPAA 3VEPA 2HOTA 4BE1A 3GTLJ 5HVQC 4B43A 3VDXA 4IL6C 3QODA 2DK8A 2KIFA 2CV2A 1B6AA 5BS6A 2K4JA 1RESA 1U2WA 2ZMEB 3R0AA 2KDZA 1Y8QB 2JN6A 4QLCU 1OYYA 2A5YB 2L0KA 4F91B 1MH4A 2J5PA 1S6LA 4MIMA 1BW6A 1J0RA 5LGUA 2E7XA 3F8CA 3CO7C 1B72A 1XB4A 3MKYB 5JI6A 2M4GA 2VOOA 4Y3OA 4G7HF 5L3EA 2QUFA 1IG7A 2EV5A 1ETQA 2CGPA 4OIPF 3FM5A 4F92B 1Y0UA 2ZO4A 1QVTA 3Q0VA 4XLPF 3CCRI 2NXNB 1UB9A 3I53A 1IN4A 1FMVA 2XAUA 2FD5A 4GGGA 2E7WA 2PFBA 4I02A 3BG7A 4A5NA 3HRSA 3GTOJ 3J7AO 1SVMA 1T0FA 1ETOA 2DTRA 2MGQA 3WODF 5HDKA 4XMYA 3HSEA 3A0HC 2GOXB 2EZKA 4GXOA 2DA1A 2PJRA 1WH5A 4YFXF 4BBSJ 4HSTA 1G4DA 2IEKA 4HAMA 2BY0A 4NB5A 1SFEA 1FC3A 1MW7A 4UVBA 5D5UB 4RB2C 1X2NA 3HYIA 1TWHJ 2LH9A 2PMHA 4EQQA 4CDGA 4BQAA 5F0HA 1SFOJ 1JHFA 2A6EF 1ZHFA 2B0LA 5J40A 2DMTA 3M7GA 3WTUC 3MZHA 2VPLA 4X0GA 2H6BA 2VQHA 2DOFA 3IL2A 2M9HA 2ZMEA 4BAYA 3WU1B 4M73A 3U21A 5IPAA 4CGZA 1LEBA 4PSXA 1LKXA 1TQPA 5ICFA 2NS0A 3L2VA 1IZ1A 4OMZA 1K79A 3C7JA 5LEJA 4XLAA 4YEJA 2Y0SN 4F3QA 3IWZA 5LFAA 4WWCA 4BYYA 1K7AA 1JI8A 1YI2I 1Y1WJ 2DCEA 2FUG2 2Y48A 5J4YA 2QLZA 3SHFA 3S93A 4R79A 2VQLA 4B3XA 4A3IJ 1Z6TA 3BCAA 4AVZA 3IH4A 2K9NA 3KYLA 3CP2A 3L2UA 4ZTJA 3WG9A 4RGXA 1HW2A 1K78B 4M9SA 1WH7A 5DDGA 2HOEA 1YJWI 1FTZA 2EPFA 4OMYA 1OYWA 1XCVA 2JTVA 4N0BA 4U0VA 2OBPA 5E1ZB 4HQMA 2AQFA 4U88A 5L3CA 2JJ7A 4DZJA 3V8JA 2L01A 2QEXI 5E3LA 1ZARA 3WGHA 2NVXJ 3JR9A 2CWEA 3DU6A 4NC6A 2GAUA 2DDBA 2QCOA 2VBZA 2V4JC 5FLVA 1DU6A 5LLQA 4UUTA 4CZZA 2X6WA 3OYDA 1HDPA 1O7LA 1P6RA 2L9SA 5ILUA 4O6JA 3PJRA 1XGSA 2KZVA 3PIPF 2L7MP 3GZNB 4AWXB 1VQPI 4O3MA 2W7NA 4A6DA 2KKOA 3NARA 2MYSA 1MJ9A 2VXDA 4P96A 1IAWA 1J9IA 3J81Z 1TP4A 2FEZA 2L02A 3Q9VA 5KAFC 4IF4A 3R60A 1P2FA 3ABKH 4HQEA 4AYBN 5C3EJ 2XGDA 2BVMA 2QQ8A 4NC7A 4LLNA 1H0MA 1HW5A 3HOTA 2X1EA 3OOUA 5BQTA 1P4WA 4ZDPA 3HOSA 4WX9A 2QSHX 5D8LB 2OF7A 2LK2A 1UG2A 3LFUA 1WKMA 2I8DA 1EJ9A 1K78A 2EFQA 2F5DA 3HJEA 1O4XA 3GX4X 2QF7A 3ABUA 2P7VB 1RR7A 3EQLF 4FX0A 2OZ6A 1XTAA 1OISA 1Q1HA 2LKPA 2RQQA 3BR0A 4MHGA 3RKYA 5B3SH 3AG1H 2V9VA 1GV2A 2F2EA 3T8TA 2VKDA 1N77A 2KRCA 1BR2A 1U9NA 2VLAA 2IGMA 5D8KB 2E60A 5J8CA 3FXRA 1SAXA 4CUGA 4CCNA 4U87A 3E6CC 5IT9Z 2IS2A 2WAEA 4LJZF 3TQNA 2XF7A 4CYDA 1JUPA 1UAAA 3ZQLA 1KQ8A 4HNVA 1LE8B 1G3YA 1K83J 2H8RA 4DOZA 4A0ZA 4A3CJ 1XDSA 3ML6A 1BIAA 3G71I 1JJ6C 2VQGA 3M1CA 5E18F 4RB3C 4B3AA 3VYRB 2FNAA 3JRFA 4HLXA 1SMYF 3IWFA 1EH6A 3IAS2 1ZQ3P 4IQJA 2LREA 1WJBA 4HF1A 2EQRA 1G3WA 2QQ9A 4PGHA 2BOLA 2XPWA 3L00A 5H6RA 3IV5A 2M30A 4Z2YA 2XF5A 3S8PA 2CQXA 1GVDA 4V2GA 3CUQB 4FX4A 4AVPA 2O8XA 3D5SC 2WBMA 2Y0MA 2D1VA 3I58A 4XOPA 3CCSI 3BJOA 2Q8KA 1JTYA 1WI3A 1SD7A 3H9JA 5GADJ 1IDZA 1JXSA 1FWZA 4HNTA 4HG2A 1DPUA 2GIZA 3KZYA 4MFEA 3ZN1A 2W57A 1NH3A 4WXDA 1K6YA 3JREA 2CO5A 3CF5F 3S16J 1J59A 4M6XA 3FHZA 5IT9K 5FRNA 1R6RA 3G4SI 2O8KA 2R7WA 3HRTA 2LKXA 2ME6A 3CTAA 1D1AA 3K4NA 2M8EA 1ZG3A 2ECBA 3SEZA 3K0LA 3TEDA 4AIHA 3RSNA 3S1NJ 1WVRA 1IF1A 1RUNA 1LE8A 1AKHB 4EJVA 4C2TA 2GXBA 3IH2A 4N4NB 3ZMTA 6PAXA 2ZXWH 5E17F 2HVSA 1D5YA 2EINH 5CVRA 1I6HJ 2VT2A 1ON1A 4IJAA 1YRNB 4LB6B 2RAEA 4PCQA 3NAUA 3OMYA 2OA4A 3VODA 5IP6A 3ZMVA 3CQZJ 2OUMA 2BGCA 2FU4A 2L9NA 3CCLI 3ZMUA 2VJJA 4LFUA 3FXOA 2MC3A 1ZG5A 1R1VA 4BUPA 2W85A 1HOMA 3OYEA 2NNYA 1GUUA 2DOEA 3MKLA 4JX5A 5IYCJ 2VL8A 4KUMA 4AUXA 2XUBA 2BY2A 2HQ5A 2KRHA 4FHTA 2KPMA 2VBYA 1TQIA 1N25A 2DA6A 2ESNA 3E6DA 1X1DA 1S7EA 4H4KC 2VBWA 4YIRX 5FFXA 1IXCA 3ROUA 1RUOA 3L09A 1HXDA 2WV0A 2NVQJ 4RM3A 3ZGKA 1ZK8A 2HYJA 3CLQA 1D0ZA 1E3HA 1ZRFA 3RKQA 2VIXA 4GYIA 2ACJA 4KJZA 2IGKA 5M3MJ 3A01A 3QRFF 3F8BA 2L4AA 4QIWN 5FLXZ 2E36A 1YLFA 3NRVA 4HZFA 1WJ5A 2DK5A 1W36D 3H3VK 5FFZA 4YFNF 3DKYA 2HFHA 2LG4A 5IP7J 1ZR4A 1SEUA 1AKHA 2HGCA 1FOWA 2OTLI 3TP0A 1RR8C 4XRSA 2X6OA 2HQNA 4IEJA 1E0EA 1G8XA 3H3ZA 3SZPA 3W2WA 3Q3SA 1D1CA 4QWQA 4C30A 4S05A 1YRNA 1ZRDA 2D1HA 5F0FA 5GAEJ 2STTA 4B1RA 5M5XJ 2RV8A 3JAMK 4XBFA 1QPMA 4IKFA 2R4GA 5GPCA 2DA3A 4B09A 2DYRH 3BZKA 1B8IB 4K2EA 4XLEA 4KIBA 2XC7A 1NG6A 4S0HB 3K1PA 1X3UA 2HQAA 3OY9A 3FF5A 4U0WA 4X1EA 2E5NA 3U9GA 1IV8A 4MQVA 1ZG1A 2RGVA 4XKCA 3BP8A 3OOPA 3ZMSA 1QA6A 5IT3A 3K6GA 3CF2A 2F4MB 3DBHB 4IHWA 2E71A 2X6XA 1BA5A 4CA0A 3HHHA 4HX4A 1VQ8I 5EGOA 1XX5A 2ZJRF 2DN0A 2I10A 1NG7A 2EV6A 4D5FA 2YPRA 3K7AJ 3M8FA 4L5EA 1A5JA 4RB1A 3J80K 2DMNA 2NVUB 1X3ZB 4DYCA 1IJWC 3OR2C 4EJTA 1Z3XA 5D4SA 5HLIA 1QBJA 5K1YA 2FF4A 4MFDA 3MD2A 3N4MA 2DBBA 3HM5A 3HPHA 4CSWA 3CCJI 5HDGA 2VI6A 2XHKA 3PO3J 1FYKA 2HNHA 1XSDA 3M07A 1H88C 1WJAA 4KICA 3DTKA 3PQKA 3DV8A 1DU0A 2L2OA 1T33A 3K70D 2G9WA 1H89C 1GXQA 4C3HJ 4FE7A 5CQEA 1IN7A 1CF7A 1NK3P 1MBEA 3CP8A 1QRYA 1B8IA 3ONQA 4UV8A 2JWTA 2YX7A 1UELB 3K4JA 4DBRA 1XPXA 2JQ7A 3I71A 1OCCH 2Z9OA 1HKQA 1Y8RB 4Q48A 4V2FA 3F22A 2OU2A 4I6ZA 1W0TA 4KIFA 1X1PA 5D6EA 3T8RA 4XLCA 1BI3A 1PYVA 2DLLA 3C3WA 4Z6YA 4XKWA 4JX6A 5EEAA 4RLFA 1BOBA 2R5YA 1W7PB 3G1OA 3SEQA 1BC8C 1FJLA 3MN2A 5AIPA 5DV5A 5KNLA 4HLYA 2JUGA 1N75A 2L7FP 3E97A 4BQNA 4KT5C 4J19A 3IUOA 1R36A 2CV0A 3CCVI 4IHVA 2VC0A 3PNTA 3UKGA 2XKOA 1QPIA 2VBXA 1E17A 1IN5A 1D8KA 4BACA 2FQ4A 2OQGA 2M1BA 3HEFA 2V9PA 3ZMZA 2YU9J 2BVLA 1TWAJ 9ANTA 3ZOBA 2OCEA 5HNHA 3TO6A 2L54A 3VWBA 5ICCA 4NBQA 4I0BA 4ESFA 2FX0A 3HSRA 1MGTA 4XKVA 1JKRC 1VQLI 2GA1A 4OINF 3ZQCA 3BR3A 5FJ8J 4GRIA 4DNCA 2E2JJ 2Z99A 3KYDB 3QQAA 1W5CC 5CJ9A 2IAIA 5M5WJ 5J8FA 2R92J 4DJAA 2QENA 3QYFA 4HA8A 3CESA 3KEQA 3PM1A 4OAZA 5JLXA 1YW8A 1C0WA 4A3DJ 1MBKA 2ZXIA 5TGTA 3F9KA 2HYFA 1I5ZA 2FBIA 4OWRB 4D1QA 1U5TB 3ECHA 2HPMA 3OYJA 3LMMA 3LL7A 5ED4A 5H20A 3HTUA 3SZGA 3GCMA 1U8BA 3H1CA 3WTSC 4QPQA 2FBKA 5DTDA 3K69A 2IS1A 2GZWA 2R7RA 2IGOA 3B02A 3GTPJ 3WGGA 3UR3C 3P9CA 3F3XA 2A61A 4A69C 3KETA 3O6BB 3TW6A 2RDPA 2AQEA 4GYGA 2LTPA 4JQFA 2QZ8A 1W0UA 1ETWA 3OL3A 4C2MJ 1YS7A 4Q4ZF 4KNYA 2VODA 2JUCA 1P4XA 5DS9A 2ZSIB 1IRXA 3HOXJ 1R5GA 2LRDA 2V1UA 4IRHA 1PDNC 1TWCJ 5J1YA 3KP6A 2QBYB 3I59B 3FHNA 1YE9A 3MQ0A 4XL9A 2KIMA 1KQ9A 2XRNA 2FMLA 3BPXA 1F4KA 1QGPA 3JW4A 2XSDC 1WHUA 2ZJ2A 2AXLA 3QP5A 1FY7A 3I3LA 4BQQA 2MFZA 2BEOA 3VYUB 3RPUD 3RI4A 2FOWA 3KE2A 4BU2A 2LY1A 2VONA 2WTEA 4AU7A 1Z1DA 1E3OC 3KP2A 1TLHB 1UFMA 3JRHA 2V1DA 2K02A 4FASD 1KU7A 3CMMA 3LSHA 3F8FA 2Z16A 2CG4A 2DMPA 1VQMI 2X9DA 3QPHA 3WTWC 1MDMB 1V3FA 4D7MA 3F72A 3S32A 4RGUA 2M5WA 1J7KA 3V7RA 4UHTA 4LLGF 4HNUA 5F04A 4I01A 5IP9J 1JE8A 1SD6A 2CRGA 4A12A 4A3MJ 4G7OF 1LJ9A 2FOKA 3GEZA 3TW7A 3L2CA 1TNTA 3TO9A 5JR3A 4A3BJ 5LGNA 4L9VA 1ZTRA 5FKLA 1HA8A 1HW1A 1HLVA 4BXUA 4JYKA 2QQBA 4LIUA 4BE0A 2Q2EB 5J47A 5K7FA 1FX7A 5LHHA 1TNSA 2RNJA 5JVTA 1YQAA 4ZTFA 2QBYA 3I59A 5TISC 2JT1A 1B4AA 3ZQ7A 3FKIJ 3D5LA 1WGXA 1MMGA 3DEUA 3LA7A 2W1OA 3ZRGA 3X2QH 4PFPA 3WHBA 5J3LA 2OTJI 3CUQC 2LLKA 2LF7A 2ETHA 5CYVA 3SYTA 4WXCA 5L3DA 2K9LA 2OZUA 2LVSA 5JHUA 4B48A 1CGPA 3OYMA 3LWFA 2BZTA 3HB9A 3GTKJ 3OYIA 1SC7A 1RI7A 4XLFA 3LQQA 3BTIA 4L5IA 5E79C 2CQ7A 1TWFJ 5F27A 1FNNA 1MDMA 4A3KJ 3F0CA 3KX2A 2EIMH 2L7ZA 2X6YA 1H9TA 2G0EA 2F5EA 3CDLA 4EATA 1I3AA 3F6VA 2NVTJ 4GFBA 3LA2A 3KEYA 1BC7C 2IT0A 3Q5FA 2EH3A 5EJCA 3RDIA 4ZZLA 1R23A 4R1HA 1WI9A 2A3SA 2QKMB 4W97A 4C2UA 1R4NB 1T95A 3SZTA 1Y56A 2PMUA 3S14J 1X3WB 4AC0A 2Q2EA 2CH0A 5DUKA 2F4IA 2H27A 2NOJB 2XAFA 1EA3A 1TQMA 1ONVA 3H3UA 2TRTA 3DBLB 2WWYA 1V4RA 2E1OA 3H0GJ 1L3LA 2EIJH 1NTCA 1HBXG 1Y1VJ 2XRLA 3BOQA 1AOYA 2DODA 1R5HA 2EFOA 2DQRA 2BY3A 4AM3A 1VQKI 3SFIA 5CKTA 5KHDA 4XN0A 2NNNA 3CCEI 4ENNA 2W48A 4EM2A 3I64A 5FLMJ 1FBSA 3W3CA 2DFHA 4ZDOA 4CO8A 3I4MJ 2ZNYA 2K5CA 4UUSB 2ZBKA 1UG0A 3FXKA 3JRDA 3CDIA 3JRBA 2O5RA 1FIAA 2KRFA 5F0CA 1BR4A 2H1KA 4PJNA 4A3FJ 3WTZA 5DD8A 4M72A 3HUGB 3U1KA 1B9MA 2DW4A 3HL2A 1QO0D 2R7SA 3CJTB 1YTYA 1W5SA 4IOCF 4M74A 4M3DA 2CS3A 2XPUA 4NQWB 1O7FA 3BJ6A 1ORKA 1DP7P 2P81A 4RDUA 3KLNA 1MJAA 2P5LC 2A68F 3PO2J 2OQRA 5J4VA 1K4SA 2HVQA 2JPCA 2LMDA 3G2BA 3KPHA 1BJAA 3K1NA 3QU3A 5FKOA 4DYRA 2VB6A 4NNJA 3MZ8A 5CVUA 4EJUA 4P1WA 2EFNA 2ZNZA 2OJED 3H5RA 3H92A 4BNCA 3DQVC 2CFXA 2PQ8A 3RZDJ 4I09A 2P6SA 1D3YA 1LEAA 3GLXA 2RVCA 2F5FA 2XSJC 5F08A 3V4GA 3O2PE 4AIJA 1EH8A 2PMZA 1FTTA 1JHHA 1KU3A 1STZA 3WE2A 1S9HA 1MMDA 2LNBA 2LOOA 1ERDA 1ETVA 5HS8A 2R7FA 5E3MA 2EFPA 2MBFA 1O3TA 2KLOA 4UV9A 1U8RA 3E7LA 1F43A 1ACIA 2HQRA 5FKNA 4DYQA 1IC8A 1XCBA 1ZKGA 4LK1F 2H1LA 5DCFA 2B9SA 2DMUA 3ZMDA 2O03A 4UUVA 5IY5H 5C44J 2HR3A 2DTZA 2AS5F 3OYCA 2YS9A 3C1DA 4UUSA 2IBDA 1DUXC 2VE8A 4Y52J 3WHCA 3FIWA 3OIQA 1USSA 4PJLA 4B44A 3RPQA 2JVHA 3N05A 4D0PA 1G6NA 2BBYA 1Q1VA 3HUGA 3I54A 3ZP5A 1Z21A 3VSLA 2FMYA 2NVYJ 1IDYA 4NQWA 4IQ4A 4MTDA 3HZJA 2GM4A 2DFEA 1KU9A 4NUBA 3ELKA 3O8HA 1R22A 2X1DA 5HLGA 1BJZA 2D45A 2HDDA 2MLGA 3B6AA 1ZYRF 3BZ6A 3FDYA 4CZCA 4LIVA 3QPLA 2DAOA 5FB2A 4E7SA 3MAJA 2M8GX 1ETKA 3RQIA 1ZN2A 3LFKA 1R00A 2M34A 2R93J 1RC9A 2CUEA 3A2KA 3R6SA 4PUSA 2Q1ZB 4BXFA 3DTIA 4CCJA 1BN5A 2BV6A 2M2EA 2JA8J 4RLQA 4M9ZA 5E3NA 4MLOA 5AIQA 1I50J 2WADA 2XGCA 4YFKF 3QYEA 3H5NA 5CLSA 2HVRA 1MBGA 3E0JB 3K10A 5A2QK 2XROA 4E7HA 5EZGA 1FPQA 1OPCA 1MJBA 2M0MA 3LSKA 1XSXA 3SFZA 1JGGA 4F55A 3SQNA 1B9NA 2O7OA 2HKOA 5ERIA 5CVJA 1Z0XA 2VASA 3M9AA 1S5LC 3OYKA 1VQOI 3S1QJ 3AG2H 3I9V2 3AAFA 2CUJA 1S3JA 3FMSA 3H9QA 3AG4H 3IC7A 2Q0OA 1R1TA 3RJPA 4ZJZA 2GOMA 3QYBA 4XICA 2LF8A 4OAYA 3VOEA 2AO9A 3KIOA 4KT6A 4L9TA 3E6BA 2RNGA 4ESBA 2O9LA 4BS9A 1ZREA 3S15J 4UVCA 1KU2A 1LDDA 3OYNA 1IN6A 4B8XA 4MQ9F 1QHHD 2UUZA 1VTNC 1EKEA 4BL0B 4HSRA 2W00A 2JMWA 3ASOH 1EF4A 2GBYA 2DU9A 3IAM2 2QSGX 3CUOA 1HSTA 3O8GA 5DD4A 3REOA 2LY2A 1PUEE 2R7UA 1WCMJ 2LFBA 2GXAA 3W6KB 2Z3YA 1WJDA 4GO1A 4HOBA 4IXAA 1I39A 1PJRA 3TO7A 3JAMZ 4BHCA 3MMYB 4PFOA 1LB2A 2FNPA 3GO5A 2DPUA 3OYLA 2A6TA 1GDTA 3CUQA 3U1DA 1F5TA 2L3DA 4U7DA 2Z2SB 4FETA 5J1UA 3L2RA 1U5TC 2K86A 2DMQA 3FBNB 1OYIA 1BW5A 2JRTA 3Q0WA 4IRGA 2HZDA 2CQQA 3ZQGA 4XQFA 2LSOA 4ENJA 2N8GA 4LOCA 1KZHA 4C9YA 4O5VA 2J5OA 3H0DA 1TT0A 5C4XJ 3FWEA 3LSIA 1MNEA 3S2WA 2R0QC 1W5TA 2CFOA 3CCYA 4LD5A 3F8MA 4ASNA 1GHCA 3T1BA 4ZYDA 1T38A 4M6VA 1PP7U 2ID3A 1Y39A 1KYZA 2CMPA 3IRQA 5DM6F 3GLLA 1P9QC 5FKKA 3J80Z 2OV7A 3CC7I 2E35A 2X51A 3L7WA 3COAC 2K4BA 2OC6A 1SD5A 3PSIA 3K4BA 4LGWA 1XGNA 1AA7A 2IVMA 3ZXSA 2JPBA 3PUBA 3LQRA 4Y4RA 2FRHA 3RYRA 2NYXA 4G6TB 2E1NA 4FQGA 2RC4A 4EEFG 3PFYA 2NRAC 3HOYJ 1VQ5I 4Q5SF 5TJJA 3QU6A 5FO5A 3ZQIA 5ICEA 4G7ZF 3TKYA 3WTXC 4Y15A 1YITI 4E7ZA 2O0YA 3MEXA 2DDAA 3JTGA 3ABMH 3MKWB 2GWRA 5DCMB 4U7BA 4OIOF 4B4CA 3DLLF 2VPRA 4ZYGA 2KISA 4HX7A 3VFZA 1OMIA 1YYVA 3BQZA 2GQQA 3E6MA 3G3ZA 2QSFX 2VT3A 2CQKA 2P7CB 2VN2A 1FBQA 2XGXA 1OCZH 4L5JA 4N4OB 4LG0B 2K3PA 4ANJA 3M3YJ 2Z33A 1IRFA 2D5VA 2FXAA 4HX8A 1K61A 3IH3A 4QPOA 5F6FA 2E2IJ 2V79A 1P7IA 5EDNA 4M9XA 3WTVC 1OCOH 2C6YA 2CUZA 5DYMA 3BCBA 1YX3A 3UNGC 4ENMA 5M3FJ 3EUAA 5IOYA 3VSKA 3S2HJ 1MNDA 2STWA 2JA6J 3M1EA 2IPQX 3CCQI 4BGDA 1NHAA 1I6XA 4HEA2 1LFBA 1P4AA 2IP2A 2P5VA 4L9NA 5K7ZA 1FLIA 4PGGA 3ERED 2Y75A 4PJ0C 2K9MA 3MCZA 1SFUA 4I2OA
chains in the Genus database with same CATH topology
2QWWA 2TDXA 3V7SA 3FXQA 4L0YB 3WU0A 5DCMA 2XVCA 1XDUA 2ZXJA 3LAJA 4M71A 1FP2A 2ISZA 1MZBA 4LG0A 1BOAA 1U6GA 2A07F 1U3EM 1FYLA 5HLHA 3F8NA 4EM1A 4LK0F 3GUDA 3FX3A 3KP7A 4XSZF 2PG4A 4A0YA 5LHIA 1ODDA 4KN4X 2G7UA 2EWNA 3MWMA 4G8XA 1BI2A 2X4HA 5E20A 5D5WB 1ZH5A 1S29A 1P92A 4A0XA 1ZGJA 1HQCA 4N9HA 4WF2A 5F1RA 1XD7A 2LDUA 4MEYF 3R61A 5E8GA 5LRRA 3KFWX 3LA3A 1W7PA 4MGRA 2R7DA 2EA2A 3E5QA 3JSOA 4EVIA 4HDVA 1E2XA 1XGOA 4G6DA 3ULQB 2DT5A 4N9IA 3EYYA 1W7PD 2QQAA 2H09A 1O57A 3N97A 4KYWA 4ZYHA 2OD5A 3KLOA 3T0YA 1FT9A 3GW2A 3DFGA 1IRGA 2FSWA 4M6YA 4OOIA 3WGIA 1F9NA 2EK5A 1R7JA 3P7NA 3R4KA 3JTHA 1LDJA 3K1MA 5J6XA 5ILVA 2DFIA 2D2WA 4KMFA 3HRMA 1U5TA 3GZ6A 1LNWA 4EJOA 2Z5UA 4RAYA 3KEOA 3MFKA 4CHUA 2V6CA 4DQ2A 5DUIA 2HTSA 4HF0A 3HRUA 3JSPA 1KQ0A 5D5XB 4RS8A 2O61A 4JK1X 1A04A 2XAHA 3CDHA 1LDKB 4Y17A 2VOPA 1YW7A 3W6JB 2UXNA 2X0LA 5D4RA 3ECOA 4EGZA 3P9KA 4CICA 3SXYA 4U0YA 3WTYC 2YSRA 5CVIA 3BY6A 5L3FA 3GF2A 1FSEA 1FP1D 1F1ZA 4YG2F 1KGSA 3MZYA 4HBLA 2GIVA 4A2UA 2XAQA 4IHTA 4L9JA 3EETA 5EEHA 4HYEA 3U2RA 3E5UA 1RNLA 4KFCA 3BDDA 2A6HF 3R0JA 5K5QA 4IRIA 2O6GE 3HIFA 2VC1A 5L3GA 4MTEA 1WQ2A 3Q9SA 3KP3A 4F7ZA 1I1SA 1FSHA 1SFXA 3PQJA 1BI1A 1H9GA 3VB2A 3TDZC 4ZH4F 1G3SA 2CSOA 1R58A 1T98A 2EV0A 3HSFA 4XSXF 3HTSB 1YW9A 2HTJA 2MD5A 4P9UA 2W25A 3GYHX 3QP6A 4G9YA 3OV8A 3I0TA 1LVAA 2EA4A 1UCRA 3KZZA 3LAPA 3CLOA 2ADUA 4G6QA 3EDPA 3NQOA 2JZYA 1FOKA 2RN7A 2PN6A 5LRSA 3DP7A 2MLKA 5ICGA 3BJAA 4L18B 3T5XA 3QOPA 1ZRCA 5HDNA 3IKVA 1MKMA 4ON0A 2XKPA 3B73A 2P5KA 1ZGAA 4OIQF 4RGSA 5KVRA 4FT8A 4GCVA 1TW3A 4Y13A 4AIKA 2QM3A 3CJNA 2ELHA 2IJLA 4BHPA 3F6OA 3GFJA 4PDKA 1Z9CA 1TW2A 3ZPLA 1PP8F 3FXUA 2EJRA 4P5OA 4ETSA 1SD4A 4EJWA 2HKXA 2HDCA 4E70A 4ZYEA 1S7AA 1T6SA 5KK1A 3E3VA 4UNOA 2UWMA 4HW0A 1D5VA 4YIFA 3WTTC 5BPDA 4HF2A 4EV0A 3TDUC 3GXOA 5A2QZ 1ZLKA 2CW0F 3HHGA 4NHJA 3C18A 5H6QA 5FD5A 2YX4A 3BWGA 2F5CA 2PJPA 4Q47A 1JGSA 4ENKA 2DPDA 4RAZA 1Z7UA 4JBAA 2FE3A 1FYMA 4HV5A 3PFIA 1XMAA 4KA4A 5BPIA 3IKTA 4WK8F 2DI3A 3J81K 5K5RA 4R8HA 2IA0A 3RKWA 3GWZA 2XIGA 4HV6A 1B1BA 4P9FA 3RIRA 2VE9A 3LSTA 5LEKA 2P8TA 3I4PA 3IRRA 4ZZDA 2MA3A 2DQLA 2MH9A 2MH2A 1OKRA 5JFRA 5BOXA 2H94A 4ESJA 2DO7A 3TOAA 1XMKA 3DKWA 2YU3A 2BYVE 3RTRA 2UXXA 3ISPA 5TRDA 4MNUA 5F64A 5HS9A 2PBIA 2P4WA 2P6TA 4WXHA 2QYOA 3FM3A 1G3TA 2EFWA 1S7OA 4KDPA 2H6CA 2XAJA 4EM0B 1I1GA 3K2ZA 4BH9A 5E8IA 4H0EA 4MEXF 1J2XA 1S8NA 2K27A 1IW7F 1KYWA 2QVOA 2EB7A 3FMQA 1HKSA 1L0OC 1MD0A 4PZJA 2OAZA 4KIGA 4I7HA 3TGNA 5DEQA 4EMSA 1UHMA 3EYIA 4L0ZB 3QAHA 5CVVA 2JSCA 2RKHA 2GXGA 1XN7A 2G7HA 2WC2A 1O3RA 4OU0A 5E1WA 1BBYA 1O3SA 5FD6A 1ZAOA 2FBHA 1HKTA 4TV7A 1ULYA 3O3KA 1I27A 4XLNF 4KN7X 5AONA 2W24A 2GA2A 3D0SA 3G73A 1IN8A 4I98B 1TBXA 2HZTA 1K6OA 3IHUA 3F23A 3E5XA 4WCGA 1YIOA 3RYPA 1IXRC 1CF7B 5ILSA 4KMUX 4LB5A 3QPTA 1UHWA 3P9IA 2ZFWA 2KJBA 2RQPA 4BHBA 1AWCA 5FGMA 1QQIA 2ZCWA 1TTYA 1YFHA 3V7CA 3NEUA 3DXJF 1YO5C 5FLXK 1Z05A 1OR7A 4LLLA 5LBQA 5L3BA 5BMZA 5HOOA 4S04A 1T2KA 1EH7A 2W84A 1IUYA 3ZN0A 1WRJA 1FBUA 1Z91A 1B59A 3GFLA 1T39A 4XRFA 3WE3A 1O3QA 1D8JA 2IRFG 2YR2A 4UXNA 2XASA 5E1XA 1REPC 3V8KA 1WWXA 5LHGA 2M45A 3M8EA 4RGRA 2K7LA 5D6FA 1BM9A 3EUHA 2FA5A 1U78A 2R3SA 2IA1A 2ZKZA 3GFIA 3I5UA 4A6EA 4CXFA 2PEXA 3GZ5A 1FZPB 4YIIA 3ABTA 2PI0A 1XSVA 1QZYA 2KIUA 4IVNA 3BROA 3RKXA 1IXSB 3V8LA 2IW5A 3DPLC 4G94A 3F21A 2ESHA 5LGTA 1LQ1A 2XAGA 2PLYA 2BE5F 3DF8A 2VXZA 2ISYA 2HS5A 3FZVA 1USTA 1J5YA 3KP5A 5K5OA 1QNTA 4RB0A 3KCCA 5EEGA 1YG2A 1XGMA 3K9TA 4I0AA 3TOBA 2NAZA 1KA8A 2HEOA 3GVAA 2KJCA 4IHSA 5D5VB 5HS7A 1DPRA 1SMTA 1Z6RA 2FQ3A 4EGYA 1ON2A 1EV7A 4A5MA 2CYYA 4AD9A 2HYGD 3CO6C 4OIRF 3RPUA 2L4MA 1ZLJA 1DDNA 4UVAA 2A69F 1BIBA 1RZ4A 1W4MA 1GXPA 1J75A 1QZZA 1HSJA 3DPTA 2XV4S 1GVJA 4P55A 3L9FA 1RIOH 2O3FA 4HDUA 1YS6A 2V1XA 3KP4A 2IA2A 2M87A 2HWVA 3GFMA 4LMYA 3FMRA 1R1UA 2COMA 1BI0A 3BPVA 2E1CA 2UZKA 1WSUA 4IPAA 3VEPA 5HVQC 2DK8A 2KIFA 1B6AA 5BS6A 2K4JA 2ZMEB 1U2WA 3R0AA 4QLCU 1OYYA 2A5YB 2J5PA 1S6LA 1J0RA 5LGUA 2E7XA 3F8CA 3CO7C 1XB4A 5JI6A 2VOOA 4G7HF 5L3EA 2QUFA 2CGPA 2EV5A 4OIPF 3FM5A 1Y0UA 2ZO4A 4XLPF 3I53A 1UB9A 1IN4A 4GGGA 4I02A 2E7WA 2PFBA 4A5NA 3J7AO 3HRSA 1T0FA 2DTRA 3WODF 5HDKA 3HSEA 4GXOA 4YFXF 1G4DA 4HAMA 4NB5A 1SFEA 1FC3A 4UVBA 5D5UB 4RB2C 3HYIA 2PMHA 4EQQA 4CDGA 4BQAA 1JHFA 2A6EF 1ZHFA 2B0LA 3M7GA 3WTUC 3MZHA 2H6BA 3IL2A 4BAYA 2ZMEA 3WU1B 4M73A 4CGZA 1LEBA 1TQPA 5ICFA 2NS0A 1IZ1A 4OMZA 1K79A 3C7JA 5LEJA 3IWZA 4WWCA 4BYYA 1K7AA 2Y48A 2QLZA 3SHFA 4R79A 1Z6TA 3WG9A 4RGXA 1HW2A 1K78B 4M9SA 5DDGA 2HOEA 4OMYA 1OYWA 1XCVA 2JTVA 4N0BA 4U0VA 2OBPA 5E1ZB 4HQMA 5L3CA 4U88A 3V8JA 2L01A 1ZARA 3WGHA 2CWEA 2GAUA 2VBZA 5LLQA 4CZZA 1O7LA 1P6RA 5ILUA 4O6JA 1XGSA 4AWXB 4O3MA 4A6DA 2KKOA 1IAWA 1MJ9A 4P96A 1J9IA 3J81Z 2FEZA 2L02A 3Q9VA 4IF4A 3R60A 1P2FA 4HQEA 4LLNA 1H0MA 1HW5A 3HOTA 5BQTA 1P4WA 3HOSA 4WX9A 5D8LB 1WKMA 1K78A 2EFQA 2F5DA 3GX4X 3ABUA 2P7VB 3EQLF 4FX0A 2OZ6A 1Q1HA 2LKPA 4MHGA 3RKYA 2V9VA 2F2EA 3T8TA 5D8KB 5J8CA 1SAXA 3FXRA 3E6CC 5IT9Z 4LJZF 3TQNA 4CYDA 1KQ8A 1G3YA 4A0ZA 1XDSA 3ML6A 1BIAA 5E18F 4RB3C 2FNAA 4HLXA 1SMYF 3IWFA 1EH6A 4HF1A 1G3WA 2QQ9A 4PGHA 3L00A 5H6RA 2M30A 4Z2YA 3CUQB 4FX4A 4AVPA 2O8XA 2Y0MA 2D1VA 3I58A 3BJOA 2Q8KA 1SD7A 1JXSA 1FWZA 1DPUA 3KZYA 3ZN1A 2W57A 4WXDA 2CO5A 1J59A 4M6XA 3FHZA 5IT9K 3HRTA 3CTAA 2M8EA 1ZG3A 3K0LA 4AIHA 1IF1A 1RUNA 5E17F 4EJVA 2GXBA 3ZMTA 6PAXA 5CVRA 2VT2A 1ON1A 4IJAA 4LB6B 4PCQA 2OA4A 3VODA 3ZMVA 2BGCA 2FU4A 3ZMUA 4LFUA 2MC3A 1ZG5A 1R1VA 2W85A 2NNYA 4KUMA 2XUBA 4FHTA 2VBYA 1TQIA 2ESNA 3E6DA 2VBWA 5FFXA 1IXCA 3ROUA 1RUOA 3L09A 1HXDA 2WV0A 1ZRFA 4GYIA 2ACJA 3QRFF 3F8BA 2L4AA 5FLXZ 1YLFA 3NRVA 4HZFA 2DK5A 5FFZA 4YFNF 2HFHA 2HGCA 2HQNA 3H3ZA 3SZPA 1ZRDA 4S05A 4QWQA 2D1HA 2STTA 2RV8A 3JAMK 4XBFA 1QPMA 4B09A 4K2EA 4KIBA 3K1PA 1X3UA 3FF5A 4U0WA 3U9GA 4MQVA 1ZG1A 2RGVA 3BP8A 3OOPA 3ZMSA 5IT3A 3HHHA 4HX4A 2EV6A 2YPRA 3M8FA 4RB1A 3J80K 4EJTA 5D4SA 5HLIA 1QBJA 5K1YA 2FF4A 3N4MA 2DBBA 5HDGA 2XHKA 1FYKA 1XSDA 4KICA 3PQKA 3DV8A 2G9WA 1GXQA 1CF7A 1IN7A 4UV8A 2YX7A 3I71A 2Z9OA 1HKQA 4Q48A 3F22A 2OU2A 4KIFA 5D6EA 3T8RA 1BI3A 2DLLA 3C3WA 1W7PB 1BC8C 5AIPA 5DV5A 4HLYA 3E97A 4KT5C 1R36A 2VC0A 2XKOA 2VBXA 1E17A 1IN5A 1D8KA 2OQGA 2M1BA 3ZMZA 3TO6A 2L54A 5ICCA 4I0BA 4ESFA 3HSRA 1MGTA 2GA1A 4OINF 4DNCA 2Z99A 5CJ9A 5J8FA 2QENA 4HA8A 3KEQA 1YW8A 1C0WA 2HYFA 1I5ZA 2FBIA 1U5TB 3ECHA 5ED4A 5H20A 3HTUA 3WTSC 2FBKA 3K69A 2GZWA 3B02A 3WGGA 3P9CA 3F3XA 2A61A 3KETA 3O6BB 2RDPA 4GYGA 4JQFA 2QZ8A 1YS7A 4Q4ZF 4KNYA 2VODA 1P4XA 1R5GA 2V1UA 4IRHA 1PDNC 3KP6A 2QBYB 3I59B 3MQ0A 2KIMA 1KQ9A 2XRNA 2FMLA 3BPXA 1F4KA 1QGPA 3JW4A 2ZJ2A 2AXLA 3QP5A 1FY7A 2BEOA 3RI4A 3KE2A 2VONA 2WTEA 1Z1DA 3KP2A 1TLHB 1UFMA 2V1DA 2K02A 1KU7A 3F8FA 2CG4A 3QPHA 3WTWC 1MDMB 1V3FA 3F72A 4RGUA 2M5WA 1J7KA 3V7RA 4UHTA 4LLGF 4I01A 1JE8A 1SD6A 4A12A 4G7OF 1LJ9A 2FOKA 3GEZA 3L2CA 1TNTA 3TO9A 5JR3A 5LGNA 4L9VA 1HW1A 4BXUA 2QQBA 1FX7A 5LHHA 1TNSA 2RNJA 5JVTA 1YQAA 2QBYA 3I59A 2JT1A 1B4AA 3ZQ7A 3D5LA 3DEUA 3LA7A 3CUQC 2LF7A 2ETHA 5CYVA 4WXCA 5L3DA 2OZUA 5JHUA 1CGPA 3LWFA 1RI7A 3LQQA 4L5IA 1FNNA 1MDMA 1H9TA 2F5EA 3F6VA 3LA2A 1BC7C 2IT0A 3Q5FA 3RDIA 4ZZLA 1R23A 4R1HA 1WI9A 2A3SA 3SZTA 2PMUA 2Q2EA 5DUKA 2H27A 2XAFA 1TQMA 1ONVA 3H3UA 2WWYA 1V4RA 1L3LA 1HBXG 3BOQA 1AOYA 1R5HA 2EFOA 2DQRA 2NNNA 4ENNA 4EM2A 3I64A 1FBSA 4CO8A 2ZNYA 2ZBKA 2KRFA 3WTZA 5DD8A 4M72A 1B9MA 2DW4A 1QO0D 1YTYA 1W5SA 4M74A 1O7FA 3BJ6A 1DP7P 3KLNA 1MJAA 2P5LC 2A68F 2OQRA 2JPCA 1BJAA 3K1NA 3QU3A 5CVUA 4EJUA 2EFNA 2ZNZA 3H92A 4BNCA 3DQVC 2CFXA 2PQ8A 4I09A 2P6SA 1D3YA 1LEAA 3GLXA 2RVCA 2F5FA 3V4GA 3O2PE 4AIJA 1EH8A 1JHHA 1KU3A 1STZA 3WE2A 2LNBA 5HS8A 2R7FA 2EFPA 2MBFA 1O3TA 4UV9A 1U8RA 2HQRA 1XCBA 4LK1F 5DCFA 3ZMDA 2O03A 4UUVA 2HR3A 2AS5F 3C1DA 1DUXC 2VE8A 1USSA 3RPQA 4D0PA 1G6NA 2BBYA 3ZP5A 3HUGA 3I54A 2FMYA 4NQWA 4MTDA 1KU9A 3ELKA 1R22A 5HLGA 2D45A 2MLGA 3BZ6A 1ZYRF 2DAOA 5FB2A 3MAJA 1ZN2A 3LFKA 1R00A 3R6SA 1BN5A 2BV6A 4M9ZA 5AIQA 4YFKF 5CLSA 5A2QK 2XROA 1FPQA 1OPCA 1MJBA 1XSXA 3SFZA 3SQNA 1B9NA 2HKOA 5ERIA 5CVJA 3M9AA 3AAFA 1S3JA 3FMSA 3IC7A 2Q0OA 1R1TA 3RJPA 2LF8A 3VOEA 4L9TA 3E6BA 4ESBA 1ZREA 4UVCA 1KU2A 1LDDA 1IN6A 4B8XA 4MQ9F 1VTNC 2DU9A 3CUOA 1HSTA 3REOA 5DD4A 1PUEE 3W6KB 2Z3YA 4GO1A 3JAMZ 4HOBA 4IXAA 3TO7A 4BHCA 1LB2A 2FNPA 3GO5A 2DPUA 3CUQA 3U1DA 1F5TA 2L3DA 4U7DA 1U5TC 2K86A 1OYIA 2JRTA 4IRGA 2LSOA 4ENJA 4O5VA 2J5OA 3FWEA 3S2WA 1W5TA 4LD5A 3F8MA 4ASNA 1GHCA 3T1BA 4ZYDA 1T38A 1PP7U 1KYZA 3IRQA 3J80Z 3L7WA 3COAC 2K4BA 1SD5A 4LGWA 1XGNA 2IVMA 2JPBA 3LQRA 2FRHA 3RYRA 2NYXA 2E1NA 2RC4A 2NRAC 4Q5SF 5TJJA 3QU6A 5FO5A 5ICEA 4G7ZF 3TKYA 3WTXC 4Y15A 2O0YA 3MEXA 3JTGA 2GWRA 5DCMB 4U7BA 4OIOF 4ZYGA 4HX7A 3VFZA 1OMIA 1YYVA 2GQQA 3E6MA 3G3ZA 2VT3A 2CQKA 2P7CB 2VN2A 1FBQA 2XGXA 4L5JA 4LG0B 2Z33A 1IRFA 2FXAA 4HX8A 5F6FA 2V79A 4M9XA 3WTVC 2C6YA 5DYMA 4ENMA 2STWA 3M1EA 2IPQX 1NHAA 1I6XA 1FLIA 1P4AA 2IP2A 2P5VA 4L9NA 4PGGA 3ERED 2Y75A 3MCZA 1SFUA 4I2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWW A;  2TDX A;  3V7S A;  3FXQ A;  4L0Y B;  3WU0 A;  5DCM A;  2XVC A;  1XDU A;  2ZXJ A;  3LAJ A;  4M71 A;  1FP2 A;  2ISZ A;  1MZB A;  4LG0 A;  1BOA A;  1U6G A;  2A07 F;  1U3E M;  1FYL A;  5HLH A;  3F8N A;  4EM1 A;  4LK0 F;  3GUD A;  3FX3 A;  3KP7 A;  4XSZ F;  2PG4 A;  4A0Y A;  5LHI A;  1ODD A;  4KN4 X;  2G7U A;  2EWN A;  3MWM A;  4G8X A;  1BI2 A;  2X4H A;  5E20 A;  5D5W B;  1ZH5 A;  1S29 A;  1P92 A;  4A0X A;  1ZGJ A;  1HQC A;  4N9H A;  4WF2 A;  5F1R A;  1XD7 A;  2LDU A;  4MEY F;  3R61 A;  5E8G A;  5LRR A;  3KFW X;  3LA3 A;  1W7P A;  4MGR A;  2R7D A;  2EA2 A;  3E5Q A;  3JSO A;  4EVI A;  4HDV A;  1E2X A;  1XGO A;  4G6D A;  3ULQ B;  2DT5 A;  4N9I A;  3EYY A;  1W7P D;  2QQA A;  2H09 A;  1O57 A;  3N97 A;  4KYW A;  4ZYH A;  2OD5 A;  3KLO A;  3T0Y A;  1FT9 A;  3GW2 A;  3DFG A;  1IRG A;  2FSW A;  4M6Y A;  4OOI A;  3WGI A;  1F9N A;  2EK5 A;  1R7J A;  3P7N A;  3R4K A;  3JTH A;  1LDJ A;  3K1M A;  5J6X A;  5ILV A;  2DFI A;  2D2W A;  4KMF A;  3HRM A;  1U5T A;  3GZ6 A;  1LNW A;  4EJO A;  2Z5U A;  4RAY A;  3KEO A;  3MFK A;  4CHU A;  2V6C A;  4DQ2 A;  5DUI A;  2HTS A;  4HF0 A;  3HRU A;  3JSP A;  1KQ0 A;  5D5X B;  4RS8 A;  2O61 A;  4JK1 X;  1A04 A;  2XAH A;  3CDH A;  1LDK B;  4Y17 A;  2VOP A;  1YW7 A;  3W6J B;  2UXN A;  2X0L A;  5D4R A;  3ECO A;  4EGZ A;  3P9K A;  4CIC A;  3SXY A;  4U0Y A;  3WTY C;  2YSR A;  5CVI A;  3BY6 A;  5L3F A;  3GF2 A;  1FSE A;  1FP1 D;  1F1Z A;  4YG2 F;  1KGS A;  3MZY A;  4HBL A;  2GIV A;  4A2U A;  2XAQ A;  4IHT A;  4L9J A;  3EET A;  5EEH A;  4HYE A;  3U2R A;  3E5U A;  1RNL A;  4KFC A;  3BDD A;  2A6H F;  3R0J A;  5K5Q A;  4IRI A;  2O6G E;  3HIF A;  2VC1 A;  5L3G A;  4MTE A;  1WQ2 A;  3Q9S A;  3KP3 A;  4F7Z A;  1I1S A;  1FSH A;  1SFX A;  3PQJ A;  1BI1 A;  1H9G A;  3VB2 A;  3TDZ C;  4ZH4 F;  1G3S A;  2CSO A;  1R58 A;  1T98 A;  2EV0 A;  3HSF A;  4XSX F;  3HTS B;  1YW9 A;  2HTJ A;  2MD5 A;  4P9U A;  2W25 A;  3GYH X;  3QP6 A;  4G9Y A;  3OV8 A;  3I0T A;  1LVA A;  2EA4 A;  1UCR A;  3KZZ A;  3LAP A;  3CLO A;  2ADU A;  4G6Q A;  3EDP A;  3NQO A;  2JZY A;  1FOK A;  2RN7 A;  2PN6 A;  5LRS A;  3DP7 A;  2MLK A;  5ICG A;  3BJA A;  4L18 B;  3T5X A;  3QOP A;  1ZRC A;  5HDN A;  3IKV A;  1MKM A;  4ON0 A;  2XKP A;  3B73 A;  2P5K A;  1ZGA A;  4OIQ F;  4RGS A;  5KVR A;  4FT8 A;  4GCV A;  1TW3 A;  4Y13 A;  4AIK A;  2QM3 A;  3CJN A;  2ELH A;  2IJL A;  4BHP A;  3F6O A;  3GFJ A;  4PDK A;  1Z9C A;  1TW2 A;  3ZPL A;  1PP8 F;  3FXU A;  2EJR A;  4P5O A;  4ETS A;  1SD4 A;  4EJW A;  2HKX A;  2HDC A;  4E70 A;  4ZYE A;  1S7A A;  1T6S A;  5KK1 A;  3E3V A;  4UNO A;  2UWM A;  4HW0 A;  1D5V A;  4YIF A;  3WTT C;  5BPD A;  4HF2 A;  4EV0 A;  3TDU C;  3GXO A;  5A2Q Z;  1ZLK A;  2CW0 F;  3HHG A;  4NHJ A;  3C18 A;  5H6Q A;  5FD5 A;  2YX4 A;  3BWG A;  2F5C A;  2PJP A;  4Q47 A;  1JGS A;  4ENK A;  2DPD A;  4RAZ A;  1Z7U A;  4JBA A;  2FE3 A;  1FYM A;  4HV5 A;  3PFI A;  1XMA A;  4KA4 A;  5BPI A;  3IKT A;  4WK8 F;  2DI3 A;  3J81 K;  5K5R A;  4R8H A;  2IA0 A;  3RKW A;  3GWZ A;  2XIG A;  4HV6 A;  1B1B A;  4P9F A;  3RIR A;  2VE9 A;  3LST A;  5LEK A;  2P8T A;  3I4P A;  3IRR A;  4ZZD A;  2MA3 A;  2DQL A;  2MH9 A;  2MH2 A;  1OKR A;  5JFR A;  5BOX A;  2H94 A;  4ESJ A;  2DO7 A;  3TOA A;  1XMK A;  3DKW A;  2YU3 A;  2BYV E;  3RTR A;  2UXX A;  3ISP A;  5TRD A;  4MNU A;  5F64 A;  5HS9 A;  2PBI A;  2P4W A;  2P6T A;  4WXH A;  2QYO A;  3FM3 A;  1G3T A;  2EFW A;  1S7O A;  4KDP A;  2H6C A;  2XAJ A;  4EM0 B;  1I1G A;  3K2Z A;  4BH9 A;  5E8I A;  4H0E A;  4MEX F;  1J2X A;  1S8N A;  2K27 A;  1IW7 F;  1KYW A;  2QVO A;  2EB7 A;  3FMQ A;  1HKS A;  1L0O C;  1MD0 A;  4PZJ A;  2OAZ A;  4KIG A;  4I7H A;  3TGN A;  5DEQ A;  4EMS A;  1UHM A;  3EYI A;  4L0Z B;  3QAH A;  5CVV A;  2JSC A;  2RKH A;  2GXG A;  1XN7 A;  2G7H A;  2WC2 A;  1O3R A;  4OU0 A;  5E1W A;  1BBY A;  1O3S A;  5FD6 A;  1ZAO A;  2FBH A;  1HKT A;  4TV7 A;  1ULY A;  3O3K A;  1I27 A;  4XLN F;  4KN7 X;  5AON A;  2W24 A;  2GA2 A;  3D0S A;  3G73 A;  1IN8 A;  4I98 B;  1TBX A;  2HZT A;  1K6O A;  3IHU A;  3F23 A;  3E5X A;  4WCG A;  1YIO A;  3RYP A;  1IXR C;  1CF7 B;  5ILS A;  4KMU X;  4LB5 A;  3QPT A;  1UHW A;  3P9I A;  2ZFW A;  2KJB A;  2RQP A;  4BHB A;  1AWC A;  5FGM A;  1QQI A;  2ZCW A;  1TTY A;  1YFH A;  3V7C A;  3NEU A;  3DXJ F;  1YO5 C;  5FLX K;  1Z05 A;  1OR7 A;  4LLL A;  5LBQ A;  5L3B A;  5BMZ A;  5HOO A;  4S04 A;  1T2K A;  1EH7 A;  2W84 A;  1IUY A;  3ZN0 A;  1WRJ A;  1FBU A;  1Z91 A;  1B59 A;  3GFL A;  1T39 A;  4XRF A;  3WE3 A;  1O3Q A;  1D8J A;  2IRF G;  2YR2 A;  4UXN A;  2XAS A;  5E1X A;  1REP C;  3V8K A;  1WWX A;  5LHG A;  2M45 A;  3M8E A;  4RGR A;  2K7L A;  5D6F A;  1BM9 A;  3EUH A;  2FA5 A;  1U78 A;  2R3S A;  2IA1 A;  2ZKZ A;  3GFI A;  3I5U A;  4A6E A;  4CXF A;  2PEX A;  3GZ5 A;  1FZP B;  4YII A;  3ABT A;  2PI0 A;  1XSV A;  1QZY A;  2KIU A;  4IVN A;  3BRO A;  3RKX A;  1IXS B;  3V8L A;  2IW5 A;  3DPL C;  4G94 A;  3F21 A;  2ESH A;  5LGT A;  1LQ1 A;  2XAG A;  2PLY A;  2BE5 F;  3DF8 A;  2VXZ A;  2ISY A;  2HS5 A;  3FZV A;  1UST A;  1J5Y A;  3KP5 A;  5K5O A;  1QNT A;  4RB0 A;  3KCC A;  5EEG A;  1YG2 A;  1XGM A;  3K9T A;  4I0A A;  3TOB A;  2NAZ A;  1KA8 A;  2HEO A;  3GVA A;  2KJC A;  4IHS A;  5D5V B;  5HS7 A;  1DPR A;  1SMT A;  1Z6R A;  2FQ3 A;  4EGY A;  1ON2 A;  1EV7 A;  4A5M A;  2CYY A;  4AD9 A;  2HYG D;  3CO6 C;  4OIR F;  3RPU A;  2L4M A;  1ZLJ A;  1DDN A;  4UVA A;  2A69 F;  1BIB A;  1RZ4 A;  1W4M A;  1GXP A;  1J75 A;  1QZZ A;  1HSJ A;  3DPT A;  2XV4 S;  1GVJ A;  4P55 A;  3L9F A;  1RIO H;  2O3F A;  4HDU A;  1YS6 A;  2V1X A;  3KP4 A;  2IA2 A;  2M87 A;  2HWV A;  3GFM A;  4LMY A;  3FMR A;  1R1U A;  2COM A;  1BI0 A;  3BPV A;  2E1C A;  2UZK A;  1WSU A;  4IPA A;  3VEP A;  5HVQ C;  2DK8 A;  2KIF A;  1B6A A;  5BS6 A;  2K4J A;  2ZME B;  1U2W A;  3R0A A;  4QLC U;  1OYY A;  2A5Y B;  2J5P A;  1S6L A;  1J0R A;  5LGU A;  2E7X A;  3F8C A;  3CO7 C;  1XB4 A;  5JI6 A;  2VOO A;  4G7H F;  5L3E A;  2QUF A;  2CGP A;  2EV5 A;  4OIP F;  3FM5 A;  1Y0U A;  2ZO4 A;  4XLP F;  3I53 A;  1UB9 A;  1IN4 A;  4GGG A;  4I02 A;  2E7W A;  2PFB A;  4A5N A;  3J7A O;  3HRS A;  1T0F A;  2DTR A;  3WOD F;  5HDK A;  3HSE A;  4GXO A;  4YFX F;  1G4D A;  4HAM A;  4NB5 A;  1SFE A;  1FC3 A;  4UVB A;  5D5U B;  4RB2 C;  3HYI A;  2PMH A;  4EQQ A;  4CDG A;  4BQA A;  1JHF A;  2A6E F;  1ZHF A;  2B0L A;  3M7G A;  3WTU C;  3MZH A;  2H6B A;  3IL2 A;  4BAY A;  2ZME A;  3WU1 B;  4M73 A;  4CGZ A;  1LEB A;  1TQP A;  5ICF A;  2NS0 A;  1IZ1 A;  4OMZ A;  1K79 A;  3C7J A;  5LEJ A;  3IWZ A;  4WWC A;  4BYY A;  1K7A A;  2Y48 A;  2QLZ A;  3SHF A;  4R79 A;  1Z6T A;  3WG9 A;  4RGX A;  1HW2 A;  1K78 B;  4M9S A;  5DDG A;  2HOE A;  4OMY A;  1OYW A;  1XCV A;  2JTV A;  4N0B A;  4U0V A;  2OBP A;  5E1Z B;  4HQM A;  5L3C A;  4U88 A;  3V8J A;  2L01 A;  1ZAR A;  3WGH A;  2CWE A;  2GAU A;  2VBZ A;  5LLQ A;  4CZZ A;  1O7L A;  1P6R A;  5ILU A;  4O6J A;  1XGS A;  4AWX B;  4O3M A;  4A6D A;  2KKO A;  1IAW A;  1MJ9 A;  4P96 A;  1J9I A;  3J81 Z;  2FEZ A;  2L02 A;  3Q9V A;  4IF4 A;  3R60 A;  1P2F A;  4HQE A;  4LLN A;  1H0M A;  1HW5 A;  3HOT A;  5BQT A;  1P4W A;  3HOS A;  4WX9 A;  5D8L B;  1WKM A;  1K78 A;  2EFQ A;  2F5D A;  3GX4 X;  3ABU A;  2P7V B;  3EQL F;  4FX0 A;  2OZ6 A;  1Q1H A;  2LKP A;  4MHG A;  3RKY A;  2V9V A;  2F2E A;  3T8T A;  5D8K B;  5J8C A;  1SAX A;  3FXR A;  3E6C C;  5IT9 Z;  4LJZ F;  3TQN A;  4CYD A;  1KQ8 A;  1G3Y A;  4A0Z A;  1XDS A;  3ML6 A;  1BIA A;  5E18 F;  4RB3 C;  2FNA A;  4HLX A;  1SMY F;  3IWF A;  1EH6 A;  4HF1 A;  1G3W A;  2QQ9 A;  4PGH A;  3L00 A;  5H6R A;  2M30 A;  4Z2Y A;  3CUQ B;  4FX4 A;  4AVP A;  2O8X A;  2Y0M A;  2D1V A;  3I58 A;  3BJO A;  2Q8K A;  1SD7 A;  1JXS A;  1FWZ A;  1DPU A;  3KZY A;  3ZN1 A;  2W57 A;  4WXD A;  2CO5 A;  1J59 A;  4M6X A;  3FHZ A;  5IT9 K;  3HRT A;  3CTA A;  2M8E A;  1ZG3 A;  3K0L A;  4AIH A;  1IF1 A;  1RUN A;  5E17 F;  4EJV A;  2GXB A;  3ZMT A;  6PAX A;  5CVR A;  2VT2 A;  1ON1 A;  4IJA A;  4LB6 B;  4PCQ A;  2OA4 A;  3VOD A;  3ZMV A;  2BGC A;  2FU4 A;  3ZMU A;  4LFU A;  2MC3 A;  1ZG5 A;  1R1V A;  2W85 A;  2NNY A;  4KUM A;  2XUB A;  4FHT A;  2VBY A;  1TQI A;  2ESN A;  3E6D A;  2VBW A;  5FFX A;  1IXC A;  3ROU A;  1RUO A;  3L09 A;  1HXD A;  2WV0 A;  1ZRF A;  4GYI A;  2ACJ A;  3QRF F;  3F8B A;  2L4A A;  5FLX Z;  1YLF A;  3NRV A;  4HZF A;  2DK5 A;  5FFZ A;  4YFN F;  2HFH A;  2HGC A;  2HQN A;  3H3Z A;  3SZP A;  1ZRD A;  4S05 A;  4QWQ A;  2D1H A;  2STT A;  2RV8 A;  3JAM K;  4XBF A;  1QPM A;  4B09 A;  4K2E A;  4KIB A;  3K1P A;  1X3U A;  3FF5 A;  4U0W A;  3U9G A;  4MQV A;  1ZG1 A;  2RGV A;  3BP8 A;  3OOP A;  3ZMS A;  5IT3 A;  3HHH A;  4HX4 A;  2EV6 A;  2YPR A;  3M8F A;  4RB1 A;  3J80 K;  4EJT A;  5D4S A;  5HLI A;  1QBJ A;  5K1Y A;  2FF4 A;  3N4M A;  2DBB A;  5HDG A;  2XHK A;  1FYK A;  1XSD A;  4KIC A;  3PQK A;  3DV8 A;  2G9W A;  1GXQ A;  1CF7 A;  1IN7 A;  4UV8 A;  2YX7 A;  3I71 A;  2Z9O A;  1HKQ A;  4Q48 A;  3F22 A;  2OU2 A;  4KIF A;  5D6E A;  3T8R A;  1BI3 A;  2DLL A;  3C3W A;  1W7P B;  1BC8 C;  5AIP A;  5DV5 A;  4HLY A;  3E97 A;  4KT5 C;  1R36 A;  2VC0 A;  2XKO A;  2VBX A;  1E17 A;  1IN5 A;  1D8K A;  2OQG A;  2M1B A;  3ZMZ A;  3TO6 A;  2L54 A;  5ICC A;  4I0B A;  4ESF A;  3HSR A;  1MGT A;  2GA1 A;  4OIN F;  4DNC A;  2Z99 A;  5CJ9 A;  5J8F A;  2QEN A;  4HA8 A;  3KEQ A;  1YW8 A;  1C0W A;  2HYF A;  1I5Z A;  2FBI A;  1U5T B;  3ECH A;  5ED4 A;  5H20 A;  3HTU A;  3WTS C;  2FBK A;  3K69 A;  2GZW A;  3B02 A;  3WGG A;  3P9C A;  3F3X A;  2A61 A;  3KET A;  3O6B B;  2RDP A;  4GYG A;  4JQF A;  2QZ8 A;  1YS7 A;  4Q4Z F;  4KNY A;  2VOD A;  1P4X A;  1R5G A;  2V1U A;  4IRH A;  1PDN C;  3KP6 A;  2QBY B;  3I59 B;  3MQ0 A;  2KIM A;  1KQ9 A;  2XRN A;  2FML A;  3BPX A;  1F4K A;  1QGP A;  3JW4 A;  2ZJ2 A;  2AXL A;  3QP5 A;  1FY7 A;  2BEO A;  3RI4 A;  3KE2 A;  2VON A;  2WTE A;  1Z1D A;  3KP2 A;  1TLH B;  1UFM A;  2V1D A;  2K02 A;  1KU7 A;  3F8F A;  2CG4 A;  3QPH A;  3WTW C;  1MDM B;  1V3F A;  3F72 A;  4RGU A;  2M5W A;  1J7K A;  3V7R A;  4UHT A;  4LLG F;  4I01 A;  1JE8 A;  1SD6 A;  4A12 A;  4G7O F;  1LJ9 A;  2FOK A;  3GEZ A;  3L2C A;  1TNT A;  3TO9 A;  5JR3 A;  5LGN A;  4L9V A;  1HW1 A;  4BXU A;  2QQB A;  1FX7 A;  5LHH A;  1TNS A;  2RNJ A;  5JVT A;  1YQA A;  2QBY A;  3I59 A;  2JT1 A;  1B4A A;  3ZQ7 A;  3D5L A;  3DEU A;  3LA7 A;  3CUQ C;  2LF7 A;  2ETH A;  5CYV A;  4WXC A;  5L3D A;  2OZU A;  5JHU A;  1CGP A;  3LWF A;  1RI7 A;  3LQQ A;  4L5I A;  1FNN A;  1MDM A;  1H9T A;  2F5E A;  3F6V A;  3LA2 A;  1BC7 C;  2IT0 A;  3Q5F A;  3RDI A;  4ZZL A;  1R23 A;  4R1H A;  1WI9 A;  2A3S A;  3SZT A;  2PMU A;  2Q2E A;  5DUK A;  2H27 A;  2XAF A;  1TQM A;  1ONV A;  3H3U A;  2WWY A;  1V4R A;  1L3L A;  1HBX G;  3BOQ A;  1AOY A;  1R5H A;  2EFO A;  2DQR A;  2NNN A;  4ENN A;  4EM2 A;  3I64 A;  1FBS A;  4CO8 A;  2ZNY A;  2ZBK A;  2KRF A;  3WTZ A;  5DD8 A;  4M72 A;  1B9M A;  2DW4 A;  1QO0 D;  1YTY A;  1W5S A;  4M74 A;  1O7F A;  3BJ6 A;  1DP7 P;  3KLN A;  1MJA A;  2P5L C;  2A68 F;  2OQR A;  2JPC A;  1BJA A;  3K1N A;  3QU3 A;  5CVU A;  4EJU A;  2EFN A;  2ZNZ A;  3H92 A;  4BNC A;  3DQV C;  2CFX A;  2PQ8 A;  4I09 A;  2P6S A;  1D3Y A;  1LEA A;  3GLX A;  2RVC A;  2F5F A;  3V4G A;  3O2P E;  4AIJ A;  1EH8 A;  1JHH A;  1KU3 A;  1STZ A;  3WE2 A;  2LNB A;  5HS8 A;  2R7F A;  2EFP A;  2MBF A;  1O3T A;  4UV9 A;  1U8R A;  2HQR A;  1XCB A;  4LK1 F;  5DCF A;  3ZMD A;  2O03 A;  4UUV A;  2HR3 A;  2AS5 F;  3C1D A;  1DUX C;  2VE8 A;  1USS A;  3RPQ A;  4D0P A;  1G6N A;  2BBY A;  3ZP5 A;  3HUG A;  3I54 A;  2FMY A;  4NQW A;  4MTD A;  1KU9 A;  3ELK A;  1R22 A;  5HLG A;  2D45 A;  2MLG A;  3BZ6 A;  1ZYR F;  2DAO A;  5FB2 A;  3MAJ A;  1ZN2 A;  3LFK A;  1R00 A;  3R6S A;  1BN5 A;  2BV6 A;  4M9Z A;  5AIQ A;  4YFK F;  5CLS A;  5A2Q K;  2XRO A;  1FPQ A;  1OPC A;  1MJB A;  1XSX A;  3SFZ A;  3SQN A;  1B9N A;  2HKO A;  5ERI A;  5CVJ A;  3M9A A;  3AAF A;  1S3J A;  3FMS A;  3IC7 A;  2Q0O A;  1R1T A;  3RJP A;  2LF8 A;  3VOE A;  4L9T A;  3E6B A;  4ESB A;  1ZRE A;  4UVC A;  1KU2 A;  1LDD A;  1IN6 A;  4B8X A;  4MQ9 F;  1VTN C;  2DU9 A;  3CUO A;  1HST A;  3REO A;  5DD4 A;  1PUE E;  3W6K B;  2Z3Y A;  4GO1 A;  3JAM Z;  4HOB A;  4IXA A;  3TO7 A;  4BHC A;  1LB2 A;  2FNP A;  3GO5 A;  2DPU A;  3CUQ A;  3U1D A;  1F5T A;  2L3D A;  4U7D A;  1U5T C;  2K86 A;  1OYI A;  2JRT A;  4IRG A;  2LSO A;  4ENJ A;  4O5V A;  2J5O A;  3FWE A;  3S2W A;  1W5T A;  4LD5 A;  3F8M A;  4ASN A;  1GHC A;  3T1B A;  4ZYD A;  1T38 A;  1PP7 U;  1KYZ A;  3IRQ A;  3J80 Z;  3L7W A;  3COA C;  2K4B A;  1SD5 A;  4LGW A;  1XGN A;  2IVM A;  2JPB A;  3LQR A;  2FRH A;  3RYR A;  2NYX A;  2E1N A;  2RC4 A;  2NRA C;  4Q5S F;  5TJJ A;  3QU6 A;  5FO5 A;  5ICE A;  4G7Z F;  3TKY A;  3WTX C;  4Y15 A;  2O0Y A;  3MEX A;  3JTG A;  2GWR A;  5DCM B;  4U7B A;  4OIO F;  4ZYG A;  4HX7 A;  3VFZ A;  1OMI A;  1YYV A;  2GQQ A;  3E6M A;  3G3Z A;  2VT3 A;  2CQK A;  2P7C B;  2VN2 A;  1FBQ A;  2XGX A;  4L5J A;  4LG0 B;  2Z33 A;  1IRF A;  2FXA A;  4HX8 A;  5F6F A;  2V79 A;  4M9X A;  3WTV C;  2C6Y A;  5DYM A;  4ENM A;  2STW A;  3M1E A;  2IPQ X;  1NHA A;  1I6X A;  1FLI A;  1P4A A;  2IP2 A;  2P5V A;  4L9N A;  4PGG A;  3ERE D;  2Y75 A;  3MCZ A;  1SFU A;  4I2O A; 
#chains in the Genus database with same CATH topology
 2HU9 A;  2QWW A;  1U9O A;  3BR2 A;  2TDX A;  1DGR M;  3V7S A;  1RET A;  1TWG J;  4XN3 A;  1YJN I;  3OYA A;  4XK4 A;  3BLY A;  4UY8 I;  3FXQ A;  4L0Y B;  3WU0 A;  3AL0 B;  1FOY A;  5DCM A;  3BG6 A;  2XVC A;  1LVK A;  1XDU A;  2ZXJ A;  1UZC A;  2F6C A;  3HKZ A;  3LAJ A;  1V54 H;  4F52 A;  4M71 A;  1FP2 A;  2ISZ A;  1VQ6 I;  1MZB A;  4LG0 A;  2K3F A;  4XRM A;  1BOA A;  1U6G A;  2CW7 A;  2A07 F;  3S3O A;  1U3E M;  1FYL A;  1MNM C;  5HLH A;  4Y7N J;  3F8N A;  1VFC A;  4ITV A;  1X1B A;  4EM1 A;  2VKH A;  4LK0 F;  2LD5 A;  3GUD A;  2XPV A;  3HGY A;  3FX3 A;  3K2A A;  3KP7 A;  2P0W A;  4DZP A;  2ZJP F;  3A1Y A;  2DJI A;  1JKQ C;  4XSZ F;  2PG4 A;  4A0Y A;  5LHI A;  1JJ8 C;  1ODD A;  1HC8 A;  5IOZ A;  4KN4 X;  4IOA F;  2G7U A;  3A0B C;  1S72 I;  2EWN A;  3MWM A;  4G8X A;  1BR1 A;  1BI2 A;  1YOV B;  2R7Q A;  3CC4 I;  2B63 J;  1R5I D;  2X4H A;  1VI0 A;  2VJ5 A;  3D5R C;  2PMZ N;  5E20 A;  2XB0 X;  5D5W B;  1ZH5 A;  1S29 A;  1P92 A;  3DCF A;  4A0X A;  1ZGJ A;  2H8W A;  3HOU J;  1HQC A;  4A3J J;  4N9H A;  4WF2 A;  3BR1 A;  1V55 H;  4DW6 A;  3FBI B;  5F1R A;  1XD7 A;  2LDU A;  4MEY F;  2R7T A;  3R61 A;  5E8G A;  3K4K A;  2M3A A;  3QOE A;  4X6A J;  5LRR A;  3KFW X;  3LA3 A;  1W7P A;  1VZ0 A;  2X1C A;  2V9K A;  4MGR A;  2R7D A;  1U0J A;  2EA2 A;  3E5Q A;  3DEW A;  4BQO A;  3S2D J;  3JSO A;  2L9V A;  4EVI A;  3OYH A;  4HDV A;  1E2X A;  3S3M A;  3ZQQ A;  2WAQ A;  1ETX A;  2NS8 A;  4FE4 A;  1XGO A;  3BR6 A;  4G6D A;  3ULQ B;  5FRO A;  2DT5 A;  3CJR B;  4LIT A;  2V26 A;  4N9I A;  3EYY A;  2MD0 A;  3H36 A;  1W7P D;  2VJ4 A;  2QQA A;  2H09 A;  1O57 A;  2L7K A;  4A3E J;  4I99 C;  2DFF A;  5J1R A;  3N97 A;  4ZYH A;  3OS2 A;  4KYW A;  2OD5 A;  2UV1 A;  5B1A H;  1X58 A;  2LY9 A;  3KLO A;  3T0Y A;  1QZE A;  4IHX A;  1FT9 A;  1V5G A;  1Y0N A;  2KP6 A;  3GW2 A;  3DFG A;  1IRG A;  3FXL A;  2FSW A;  4M6Y A;  4OOI A;  3WGI A;  2E1M B;  1F9N A;  2A5W A;  2EK5 A;  3HPG A;  1R7J A;  3P7N A;  3R4K A;  4XR6 A;  3A02 A;  2RRE A;  3JTH A;  4PK4 A;  2MSY A;  1LDJ A;  3K1M A;  1F36 A;  5J6X A;  3GBG A;  5ILV A;  4BJ6 C;  2DFI A;  3SJM A;  1FEX A;  2D2W A;  4KMF A;  1X4O A;  3HRM A;  1U5T A;  3GZ6 A;  1LNW A;  4EJO A;  2ZB9 A;  3BC8 A;  1PVE A;  3BTJ A;  2Z5U A;  4RAY A;  1X1C A;  3KEO A;  3MFK A;  4ZDL A;  1BL0 A;  4CHU A;  2V6C A;  1MBJ A;  4DQ2 A;  1JUS A;  2E5Z A;  5DUI A;  2HTS A;  4HF0 A;  4PJJ A;  3MKZ A;  3HRU A;  3JSP A;  1KQ0 A;  3PSF A;  5D5X B;  2ECC A;  4JP0 A;  4M3B A;  4RS8 A;  2O61 A;  1D1B A;  4JK1 X;  2ME0 A;  3G6E I;  1G59 A;  1A04 A;  2XAH A;  3CDH A;  2XGE A;  3K4M A;  1LDK B;  4Y17 A;  2VOP A;  4XON A;  4HPQ A;  1YW7 A;  2XF6 A;  5IYD J;  3JRC A;  3W6J B;  2UXN A;  4D5C A;  4BY1 J;  2X0L A;  4DBQ A;  4FIS A;  5D4R A;  1JUM A;  3ECO A;  4EGZ A;  1YIJ I;  3P9K A;  2KZG A;  4DGW B;  1XS9 A;  2JK3 A;  3RZO J;  4CIC A;  3SXY A;  4U0Y A;  2VUM J;  3WTY C;  2JA2 A;  2YSR A;  4BDY A;  5CVI A;  3BY6 A;  5L3F A;  3D1N I;  3BQY A;  3GF2 A;  1FSE A;  1MSE C;  5CPR B;  1FP1 D;  1F1Z A;  2A05 A;  1MMN A;  2BY1 A;  4YG2 F;  1KGS A;  3MZY A;  4HBL A;  2GIV A;  4A2U A;  2CJJ A;  1JKO C;  2XAQ A;  3LSG A;  2EIL H;  2LYC A;  4L9J A;  3EET A;  4IHT A;  5EEH A;  1A35 A;  4HYE A;  3U2R A;  1IO2 A;  3E5U A;  1RNL A;  4KFC A;  3BDD A;  4GDF A;  1GV5 A;  2A6H F;  3R0J A;  5K5Q A;  3K4L A;  4IRI A;  2IS4 A;  2O6G E;  3HIF A;  2VC1 A;  3HOV J;  3A03 A;  2JRM A;  1W36 C;  5L3G A;  5GP9 A;  1T08 B;  4MTE A;  3CCM I;  2LP0 A;  4E7L A;  4UB6 C;  2K40 A;  1FOX A;  4V19 K;  1WQ2 A;  1N78 A;  3Q9S A;  3KP3 A;  4F7Z A;  5B66 C;  2I5U A;  1I1S A;  1FSH A;  1SFX A;  3PQJ A;  1BI1 A;  1QVU A;  1H9G A;  2IXS A;  3TDZ C;  3VB2 A;  4I76 A;  2EZH A;  1IGN A;  1AHD P;  4ZH4 F;  1G3S A;  2CSO A;  1R58 A;  1T98 A;  2EV0 A;  1UMQ A;  3HSF A;  4XSX F;  4KIT B;  3HTS B;  1YW9 A;  4XM3 A;  2HTJ A;  2MD5 A;  3C2B A;  4P9U A;  5M5Y J;  3J7A Y;  2W25 A;  3SDG A;  1OFC X;  1SAN A;  3GYH X;  3QP6 A;  4G9Y A;  1A36 A;  3H5A A;  3OV8 A;  2CW8 A;  3I0T A;  1LVA A;  3K4C A;  2EA4 A;  4AID A;  1OJL A;  4QSH A;  3DKX A;  3LSM A;  3PNY A;  1X2M A;  1UCR A;  3KZZ A;  3LAP A;  3CLO A;  2ADU A;  4G6Q A;  3EDP A;  3NQO A;  2KL4 A;  2VKV A;  3CMA I;  2JZY A;  1M1E B;  1FOK A;  1FMW A;  1WJE A;  4RA2 A;  4J00 A;  2RN7 A;  2PN6 A;  5LRS A;  3DP7 A;  2MLK A;  1TZL A;  3OIP A;  1VQ4 I;  5ICG A;  3BJA A;  4L18 B;  1AU7 A;  1KON A;  3T5X A;  3QOP A;  1ZRC A;  3A4C A;  3W2V A;  5HDN A;  3IKV A;  3TL4 X;  3HBL A;  1MKM A;  4ON0 A;  2XKP A;  3B73 A;  3OSF A;  4II2 A;  1OR7 C;  2P5K A;  1VQ9 I;  2R7X A;  4B47 A;  1ZGA A;  2XB5 A;  2WB1 A;  3I56 I;  4OIQ F;  2KMU A;  3QPS A;  3GTM J;  2DOA A;  1SVO A;  3AFH A;  4RGS A;  3WG7 H;  1HF0 A;  5KVR A;  4FT8 A;  4A3L J;  5C4J J;  4BXX J;  4GCV A;  2FJ1 A;  2EZL A;  1RKW A;  1TW3 A;  4Y13 A;  2ZSH B;  3K70 C;  4AIK A;  3S3N A;  2Y31 A;  4BEH B;  2QM3 A;  3CJN A;  3IP4 B;  2AHQ A;  1JTX A;  2ELH A;  2IJL A;  4BHP A;  4XOT A;  3F6O A;  3GFJ A;  4PDK A;  5HOD A;  1Z9C A;  1RRJ A;  4E7J A;  2IGN A;  3DTE A;  3ERM A;  2CU7 A;  1TW2 A;  3ZPL A;  2HPI A;  4YEL A;  1PP8 F;  3FXU A;  2EJR A;  1APL C;  4P5O A;  4ETS A;  3BR5 A;  2B7E A;  3OL4 A;  1SD4 A;  1NK2 P;  2DT7 B;  3S1R J;  1V5F A;  4EJW A;  2HKX A;  4UB8 C;  2HDC A;  1K4T A;  3DU5 A;  4E70 A;  2R7Z J;  2MG4 A;  3P5J A;  2VQC A;  1TT5 B;  1S7A A;  1T6S A;  5KK1 A;  3E3V A;  2VJI A;  4ZYE A;  2BW3 B;  4UNO A;  2UWM A;  4HW0 A;  4RBO A;  4YIF A;  1D5V A;  3WTT C;  5BPD A;  5HNF A;  4HF2 A;  4EV0 A;  3EUH C;  3TDU C;  4CH7 A;  3HKZ N;  4FCY A;  3GXO A;  1IUF A;  5A2Q Z;  1XC5 A;  3DBR B;  2NS7 A;  2QKL B;  1ZLK A;  2CW0 F;  3H35 A;  3HHG A;  3OYF A;  4NHJ A;  3I55 I;  3C18 A;  5H6Q A;  3C2H A;  5FD5 A;  4Y33 A;  3LSR A;  1IRZ A;  2YX4 A;  3BWG A;  2F5C A;  2HOA A;  5EF6 A;  2PJP A;  4Q47 A;  1JGS A;  3FXJ A;  1MMA A;  4ENK A;  2DPD A;  3OR1 C;  1SAU A;  4RAZ A;  2CV1 A;  1Z7U A;  4JBA A;  2FE3 A;  1FYM A;  4HV5 A;  3PFI A;  3LOC A;  1IV6 A;  4FTH A;  1XMA A;  4PJM A;  2HXO A;  4BEH A;  4RMN A;  4KA4 A;  1JT6 A;  4WK8 F;  3IKT A;  5BPI A;  1TL8 A;  4A3G J;  2KHM A;  2DI3 A;  4C3I J;  1MSF C;  4XRS G;  2X48 A;  3J81 K;  2DA2 A;  2MC4 A;  5K5R A;  4R8H A;  2R7O A;  3CJQ B;  5FRM A;  2IA0 A;  3RKW A;  1WFX A;  2XIG A;  3GWZ A;  2X85 A;  2V7F A;  4HV6 A;  3ESW B;  1B1B A;  4P9F A;  3RIR A;  4LG3 A;  1PUF B;  2VE9 A;  3NWS A;  3LST A;  3SDB A;  1R9T J;  5LEK A;  3AL0 C;  3C2G A;  3DLA A;  2E34 A;  2P8T A;  3I4P A;  1J09 A;  2KT0 A;  3EUK L;  3IRR A;  4ZZD A;  1Z7L A;  2MA3 A;  3DPU A;  4PSW A;  3OYB A;  2DQL A;  2MH9 A;  2Y30 A;  2MH2 A;  4E7I A;  1OKR A;  5JFR A;  5EG0 B;  5BOX A;  2BW3 A;  2H94 A;  3PUF A;  4ESJ A;  3MVP A;  2DO7 A;  1YX5 A;  1A6I A;  4BE2 A;  3TOA A;  1XMK A;  4E6K G;  2V1N A;  3DKW A;  2ZC2 A;  4D9J A;  5CQG A;  2YU3 A;  3J7Z I;  4BJT A;  2BYV E;  3RTR A;  2M0C A;  2UXX A;  2WAQ N;  3HOW J;  2JSP A;  3ISP A;  5TRD A;  4MNU A;  5F64 A;  2V6E A;  3CMY A;  4NC8 A;  3PL8 A;  5HS9 A;  3L2Q A;  1HDD C;  5GAH J;  2PBI A;  2P4W A;  2P6T A;  3A01 B;  4WXH A;  4ZC3 A;  1OCT C;  2QYO A;  3FM3 A;  1SVL A;  1G3T A;  3CCU I;  1XG1 A;  1XMX A;  2EFW A;  1S7O A;  4KDP A;  3BZC A;  2K9Q A;  2H6C A;  1LFP A;  2XAJ A;  4M3F A;  3HGG A;  3H9G A;  4EM0 B;  1I1G A;  3K2Z A;  4BH9 A;  2DYS H;  4E7K A;  3G1L A;  1DP3 A;  4XKB A;  5E8I A;  4H0E A;  4D7N A;  2COB A;  1H8A C;  4W1U A;  3FK6 A;  2ZFU A;  4MEX F;  1J2X A;  3HC7 A;  1PUF A;  2E2H J;  1S8N A;  2K27 A;  3KZI C;  1IW7 F;  1ETY A;  3I4N J;  3QWL A;  2GLO A;  1X1A A;  2Y2Z A;  1KYW A;  3TBI A;  1SFK A;  4XID A;  1UHS A;  2QVO A;  1Z67 A;  2LR8 A;  2LBF B;  2EB7 A;  5EG0 A;  5JVG F;  3FMQ A;  4ABZ A;  4HRI A;  4CCL A;  4RAG A;  1MMS A;  1HKS A;  1L0O C;  1MD0 A;  4PZJ A;  2W4S A;  2OAZ A;  4KIG A;  3ASN H;  1D0Y A;  4I7H A;  5DEQ A;  3TGN A;  1VQ7 I;  5GAG J;  4EMS A;  2K9S A;  3TMO A;  5GPA A;  1UHM A;  3EYI A;  4L0Z B;  3QAH A;  5CVV A;  2JSC A;  2RKH A;  4BDZ A;  2GXG A;  1XN7 A;  3LSP A;  3BT9 A;  2G7H A;  2WC2 A;  4M3G A;  4OU0 A;  1O3R A;  5E1W A;  1BBY A;  1O3S A;  3BTL A;  5FD6 A;  5EGO B;  1ZAO A;  5JHF A;  2WY8 Q;  1POG A;  1T8I A;  2CQN A;  2FBH A;  5E3O A;  3EPZ A;  1HKT A;  4TV7 A;  3BTC A;  1ULY A;  3O3K A;  3OWT A;  1I27 A;  1W1W E;  4XLN F;  4IO9 F;  4KN7 X;  5AON A;  2W24 A;  1D0X A;  1ITY A;  2GA2 A;  3D0S A;  4XOR A;  3G73 A;  2E1M C;  4G12 A;  2W82 A;  2R5Z B;  1IN8 A;  4I98 B;  1OCP A;  5IYB J;  1TBX A;  2HZT A;  1RKT A;  1K6O A;  5JLW A;  5F1J A;  3IHU A;  1LPQ A;  1UJ8 A;  3JRG A;  1G2H A;  3W2A A;  3F23 A;  3E5X A;  3FXM A;  2Y0S A;  2EIK H;  5H2F C;  3CC2 I;  2HXI A;  2E19 A;  4JX4 A;  3RQ4 A;  1ENH A;  3FIS A;  4WCG A;  1YIO A;  3RYP A;  1IXR C;  5HLT A;  3E1S A;  4BJ5 C;  2BXZ A;  1CF7 B;  1T0F C;  2WA0 A;  2ID6 A;  5ILS A;  2DA7 A;  4KMU X;  2QGU A;  2VKE A;  2AXT C;  4LB5 A;  2JA5 J;  2Z1D A;  1LFU P;  3QPT A;  1UHW A;  2LBF A;  2XDV A;  1WJC A;  3P9I A;  2DA4 A;  2KIQ A;  2WV1 A;  2ZFW A;  2KJB A;  2RQP A;  4BHB A;  1AWC A;  3PNV A;  1WPK A;  2M7B A;  2OPT A;  3GTJ J;  1DGW Y;  3RCO A;  5FGM A;  1QQI A;  4E4H A;  3JRA A;  1WZ2 A;  2ZCW A;  1VF9 A;  4BKX A;  1TTY A;  3S17 J;  2QA4 I;  1YFH A;  3CZ6 A;  3V7C A;  3VYT B;  2R5Y B;  3OSG A;  3FK7 A;  3NEU A;  2DT6 A;  3DXJ F;  4CCK A;  1YO5 C;  4YRV A;  4IZZ A;  5FLX K;  1Z05 A;  1E3P A;  1OR7 A;  1LUJ B;  2DXI A;  2WY7 Q;  2DJN A;  4NDL A;  4DIQ A;  1OCR H;  4LLL A;  5LBQ A;  5L3B A;  1ZGW A;  2KFD A;  5BMZ A;  2WAF A;  5HOO A;  2ZXH A;  2L5Q A;  1YJ9 I;  2LKS A;  2ZME C;  4CCO A;  4S04 A;  1T2K A;  1EH7 A;  1Z3Y A;  2R7V A;  2W84 A;  1MBH A;  1IUY A;  5K7H A;  3ZN0 A;  1WRJ A;  3ZCO A;  1FBU A;  1Z91 A;  1B59 A;  3HG9 A;  4CYC B;  2R5Z A;  3GFL A;  4BY7 J;  1ZEL A;  3VPR A;  1A31 A;  1T39 A;  4BBR J;  1TC3 C;  4XRF A;  1GT0 C;  3WE3 A;  1O3Q A;  1D8J A;  1FIP A;  2OCC H;  2EZI A;  2JVG A;  2IRF G;  1GLN A;  1HCR A;  2L9R A;  2YR2 A;  2XAS A;  4UXN A;  5E1X A;  2HI3 A;  4AYB A;  3OS1 A;  1REP C;  3L1P A;  3B6C A;  1X4P A;  3V8K A;  3BG5 A;  4C3J J;  1WWX A;  5LHG A;  3S1M J;  2DA5 A;  1A6Q A;  1X19 A;  3LSJ A;  2M45 A;  3M8E A;  5B1B H;  4RGR A;  4XLH A;  3AG3 H;  2K7L A;  3V42 A;  3G1M A;  4XNF A;  1BM9 A;  5D6F A;  3OIO A;  3EUH A;  2FA5 A;  1U78 A;  2R3S A;  2IA1 A;  2ZKZ A;  1Y6I A;  2Y69 H;  1MIJ A;  1V5E A;  3GFI A;  1VQN I;  2ICW G;  3ABL H;  3I5U A;  3HOZ J;  1ZR2 A;  4A6E A;  2WB1 N;  4CXF A;  2PEX A;  1Z77 A;  2CUF A;  3DWL E;  3GZ5 A;  1FZP B;  4YII A;  3ABT A;  4IX7 A;  5FKM A;  2MAB A;  3ZQH A;  1P7J A;  2NOG A;  2PI0 A;  1WJF A;  1XSV A;  1QZY A;  3JCU C;  5KAI C;  2KIU A;  4IVN A;  3BRO A;  3ZR8 X;  4CYC A;  3RKX A;  1IXS B;  4QTR A;  3PIO F;  4RM2 A;  3V8L A;  3VYS B;  3OS0 A;  2IW5 A;  3TP3 A;  3DPL C;  4G94 A;  5BNG A;  2ESH A;  2TCT A;  5LGT A;  4ZYA A;  3F21 A;  1R49 A;  2M7A A;  1LQ1 A;  2XAG A;  2PLY A;  2BE5 F;  3ZQF A;  2F48 A;  3GME A;  1RPW A;  4F93 B;  3DF8 A;  3CME I;  3NWT A;  3CD6 I;  1JKP C;  2VXZ A;  2LC2 A;  3BG9 A;  5KCM A;  2ISY A;  2HOS A;  2KDO A;  2IS6 A;  3BG3 A;  2HS5 A;  3FZV A;  5B5E C;  1UST A;  1J5Y A;  3KP5 A;  5K5O A;  1QNT A;  4RB0 A;  4A93 J;  3LNQ A;  3KCC A;  2ELK A;  5EEG A;  1YG2 A;  1XGM A;  3K9T A;  1YHQ I;  2PX9 A;  4I0A A;  3TOB A;  3GTG J;  1OQY A;  2JA7 J;  1QHG A;  2NAZ A;  1KA8 A;  2HEO A;  3GVA A;  4II3 A;  2KJC A;  4RAF A;  4IHS A;  2EBI A;  5D5V B;  5HS7 A;  1DPR A;  1SMT A;  1T56 A;  1Z6R A;  1OLT A;  2FQ3 A;  2HDW A;  4M3E A;  1ON2 A;  3KYC B;  4EGY A;  4KIS A;  3HDD A;  3AKZ A;  1EV7 A;  4JOM A;  2F4O B;  1JT0 A;  3HXL A;  4A5M A;  2CYY A;  4AD9 A;  1CQT A;  3M4O J;  1QU3 A;  2K85 A;  2HYG D;  5DM7 F;  3CO6 C;  4OIR F;  3RPU A;  1B72 B;  2L4M A;  1ZLJ A;  1DDN A;  4UVA A;  2A69 F;  5GTH C;  1BIB A;  1RZ4 A;  1W4M A;  1DQU A;  2BHY A;  1GXP A;  3JRI A;  1J75 A;  1QZZ A;  2YUS A;  2Y9Z A;  1HSJ A;  4J01 A;  2F5V A;  2ZJQ F;  3M8J A;  3DPT A;  1R71 A;  3Q0U A;  3GTQ J;  2BHZ A;  2XV4 S;  1VND A;  1R4M B;  1GVJ A;  5EYR A;  4P55 A;  3J7Y J;  2MW8 A;  3OYG A;  1MH3 A;  3L2W A;  3L9F A;  4MO7 A;  1MBF A;  2KQR A;  1I3Q J;  2ELJ A;  2PJR B;  1RIO H;  2O3F A;  4HDU A;  5GTI C;  3W6V A;  1YS6 A;  5EZH A;  4CCM A;  2V1X A;  3KP4 A;  3DEE A;  2Y9Y A;  2IA2 A;  2M87 A;  3WU2 C;  2M4K A;  2HWV A;  4IHY A;  3GFM A;  4LMY A;  3FMR A;  1R1U A;  2COM A;  5LD2 C;  1BI0 A;  2BXY A;  3FKJ A;  3BPV A;  2E1C A;  2UZK A;  1WSU A;  4IPA A;  3VEP A;  2HOT A;  4BE1 A;  3GTL J;  5HVQ C;  4B43 A;  3VDX A;  4IL6 C;  3QOD A;  2DK8 A;  2KIF A;  2CV2 A;  1B6A A;  5BS6 A;  2K4J A;  1RES A;  1U2W A;  2ZME B;  3R0A A;  2KDZ A;  1Y8Q B;  2JN6 A;  4QLC U;  1OYY A;  2A5Y B;  2L0K A;  4F91 B;  1MH4 A;  2J5P A;  1S6L A;  4MIM A;  1BW6 A;  1J0R A;  5LGU A;  2E7X A;  3F8C A;  3CO7 C;  1B72 A;  1XB4 A;  3MKY B;  5JI6 A;  2M4G A;  2VOO A;  4Y3O A;  4G7H F;  5L3E A;  2QUF A;  1IG7 A;  2EV5 A;  1ETQ A;  2CGP A;  4OIP F;  3FM5 A;  4F92 B;  1Y0U A;  2ZO4 A;  1QVT A;  3Q0V A;  4XLP F;  3CCR I;  2NXN B;  1UB9 A;  3I53 A;  1IN4 A;  1FMV A;  2XAU A;  2FD5 A;  4GGG A;  2E7W A;  2PFB A;  4I02 A;  3BG7 A;  4A5N A;  3HRS A;  3GTO J;  3J7A O;  1SVM A;  1T0F A;  1ETO A;  2DTR A;  2MGQ A;  3WOD F;  5HDK A;  4XMY A;  3HSE A;  3A0H C;  2GOX B;  2EZK A;  4GXO A;  2DA1 A;  2PJR A;  1WH5 A;  4YFX F;  4BBS J;  4HST A;  1G4D A;  2IEK A;  4HAM A;  2BY0 A;  4NB5 A;  1SFE A;  1FC3 A;  1MW7 A;  4UVB A;  5D5U B;  4RB2 C;  1X2N A;  3HYI A;  1TWH J;  2LH9 A;  2PMH A;  4EQQ A;  4CDG A;  4BQA A;  5F0H A;  1SFO J;  1JHF A;  2A6E F;  1ZHF A;  2B0L A;  5J40 A;  2DMT A;  3M7G A;  3WTU C;  3MZH A;  2VPL A;  4X0G A;  2H6B A;  2VQH A;  2DOF A;  3IL2 A;  2M9H A;  2ZME A;  4BAY A;  3WU1 B;  4M73 A;  3U21 A;  5IPA A;  4CGZ A;  1LEB A;  4PSX A;  1LKX A;  1TQP A;  5ICF A;  2NS0 A;  3L2V A;  1IZ1 A;  4OMZ A;  1K79 A;  3C7J A;  5LEJ A;  4XLA A;  4YEJ A;  2Y0S N;  4F3Q A;  3IWZ A;  5LFA A;  4WWC A;  4BYY A;  1K7A A;  1JI8 A;  1YI2 I;  1Y1W J;  2DCE A;  2FUG 2;  2Y48 A;  5J4Y A;  2QLZ A;  3SHF A;  3S93 A;  4R79 A;  2VQL A;  4B3X A;  4A3I J;  1Z6T A;  3BCA A;  4AVZ A;  3IH4 A;  2K9N A;  3KYL A;  3CP2 A;  3L2U A;  4ZTJ A;  3WG9 A;  4RGX A;  1HW2 A;  1K78 B;  4M9S A;  1WH7 A;  5DDG A;  2HOE A;  1YJW I;  1FTZ A;  2EPF A;  4OMY A;  1OYW A;  1XCV A;  2JTV A;  4N0B A;  4U0V A;  2OBP A;  5E1Z B;  4HQM A;  2AQF A;  4U88 A;  5L3C A;  2JJ7 A;  4DZJ A;  3V8J A;  2L01 A;  2QEX I;  5E3L A;  1ZAR A;  3WGH A;  2NVX J;  3JR9 A;  2CWE A;  3DU6 A;  4NC6 A;  2GAU A;  2DDB A;  2QCO A;  2VBZ A;  2V4J C;  5FLV A;  1DU6 A;  5LLQ A;  4UUT A;  4CZZ A;  2X6W A;  3OYD A;  1HDP A;  1O7L A;  1P6R A;  2L9S A;  5ILU A;  4O6J A;  3PJR A;  1XGS A;  2KZV A;  3PIP F;  2L7M P;  3GZN B;  4AWX B;  1VQP I;  4O3M A;  2W7N A;  4A6D A;  2KKO A;  3NAR A;  2MYS A;  1MJ9 A;  2VXD A;  4P96 A;  1IAW A;  1J9I A;  3J81 Z;  1TP4 A;  2FEZ A;  2L02 A;  3Q9V A;  5KAF C;  4IF4 A;  3R60 A;  1P2F A;  3ABK H;  4HQE A;  4AYB N;  5C3E J;  2XGD A;  2BVM A;  2QQ8 A;  4NC7 A;  4LLN A;  1H0M A;  1HW5 A;  3HOT A;  2X1E A;  3OOU A;  5BQT A;  1P4W A;  4ZDP A;  3HOS A;  4WX9 A;  2QSH X;  5D8L B;  2OF7 A;  2LK2 A;  1UG2 A;  3LFU A;  1WKM A;  2I8D A;  1EJ9 A;  1K78 A;  2EFQ A;  2F5D A;  3HJE A;  1O4X A;  3GX4 X;  2QF7 A;  3ABU A;  2P7V B;  1RR7 A;  3EQL F;  4FX0 A;  2OZ6 A;  1XTA A;  1OIS A;  1Q1H A;  2LKP A;  2RQQ A;  3BR0 A;  4MHG A;  3RKY A;  5B3S H;  3AG1 H;  2V9V A;  1GV2 A;  2F2E A;  3T8T A;  2VKD A;  1N77 A;  2KRC A;  1BR2 A;  1U9N A;  2VLA A;  2IGM A;  5D8K B;  2E60 A;  5J8C A;  3FXR A;  1SAX A;  4CUG A;  4CCN A;  4U87 A;  3E6C C;  5IT9 Z;  2IS2 A;  2WAE A;  4LJZ F;  3TQN A;  2XF7 A;  4CYD A;  1JUP A;  1UAA A;  3ZQL A;  1KQ8 A;  4HNV A;  1LE8 B;  1G3Y A;  1K83 J;  2H8R A;  4DOZ A;  4A0Z A;  4A3C J;  1XDS A;  3ML6 A;  1BIA A;  3G71 I;  1JJ6 C;  2VQG A;  3M1C A;  5E18 F;  4RB3 C;  4B3A A;  3VYR B;  2FNA A;  3JRF A;  4HLX A;  1SMY F;  3IWF A;  1EH6 A;  3IAS 2;  1ZQ3 P;  4IQJ A;  2LRE A;  1WJB A;  4HF1 A;  2EQR A;  1G3W A;  2QQ9 A;  4PGH A;  2BOL A;  2XPW A;  3L00 A;  5H6R A;  3IV5 A;  2M30 A;  4Z2Y A;  2XF5 A;  3S8P A;  2CQX A;  1GVD A;  4V2G A;  3CUQ B;  4FX4 A;  4AVP A;  2O8X A;  3D5S C;  2WBM A;  2Y0M A;  2D1V A;  3I58 A;  4XOP A;  3CCS I;  3BJO A;  2Q8K A;  1JTY A;  1WI3 A;  1SD7 A;  3H9J A;  5GAD J;  1IDZ A;  1JXS A;  1FWZ A;  4HNT A;  4HG2 A;  1DPU A;  2GIZ A;  3KZY A;  4MFE A;  3ZN1 A;  2W57 A;  1NH3 A;  4WXD A;  1K6Y A;  3JRE A;  2CO5 A;  3CF5 F;  3S16 J;  1J59 A;  4M6X A;  3FHZ A;  5IT9 K;  5FRN A;  1R6R A;  3G4S I;  2O8K A;  2R7W A;  3HRT A;  2LKX A;  2ME6 A;  3CTA A;  1D1A A;  3K4N A;  2M8E A;  1ZG3 A;  2ECB A;  3SEZ A;  3K0L A;  3TED A;  4AIH A;  3RSN A;  3S1N J;  1WVR A;  1IF1 A;  1RUN A;  1LE8 A;  1AKH B;  4EJV A;  4C2T A;  2GXB A;  3IH2 A;  4N4N B;  3ZMT A;  6PAX A;  2ZXW H;  5E17 F;  2HVS A;  1D5Y A;  2EIN H;  5CVR A;  1I6H J;  2VT2 A;  1ON1 A;  4IJA A;  1YRN B;  4LB6 B;  2RAE A;  4PCQ A;  3NAU A;  3OMY A;  2OA4 A;  3VOD A;  5IP6 A;  3ZMV A;  3CQZ J;  2OUM A;  2BGC A;  2FU4 A;  2L9N A;  3CCL I;  3ZMU A;  2VJJ A;  4LFU A;  3FXO A;  2MC3 A;  1ZG5 A;  1R1V A;  4BUP A;  2W85 A;  1HOM A;  3OYE A;  2NNY A;  1GUU A;  2DOE A;  3MKL A;  4JX5 A;  5IYC J;  2VL8 A;  4KUM A;  4AUX A;  2XUB A;  2BY2 A;  2HQ5 A;  2KRH A;  4FHT A;  2KPM A;  2VBY A;  1TQI A;  1N25 A;  2DA6 A;  2ESN A;  3E6D A;  1X1D A;  1S7E A;  4H4K C;  2VBW A;  4YIR X;  5FFX A;  1IXC A;  3ROU A;  1RUO A;  3L09 A;  1HXD A;  2WV0 A;  2NVQ J;  4RM3 A;  3ZGK A;  1ZK8 A;  2HYJ A;  3CLQ A;  1D0Z A;  1E3H A;  1ZRF A;  3RKQ A;  2VIX A;  4GYI A;  2ACJ A;  4KJZ A;  2IGK A;  5M3M J;  3A01 A;  3QRF F;  3F8B A;  2L4A A;  4QIW N;  5FLX Z;  2E36 A;  1YLF A;  3NRV A;  4HZF A;  1WJ5 A;  2DK5 A;  1W36 D;  3H3V K;  5FFZ A;  4YFN F;  3DKY A;  2HFH A;  2LG4 A;  5IP7 J;  1ZR4 A;  1SEU A;  1AKH A;  2HGC A;  1FOW A;  2OTL I;  3TP0 A;  1RR8 C;  4XRS A;  2X6O A;  2HQN A;  4IEJ A;  1E0E A;  1G8X A;  3H3Z A;  3SZP A;  3W2W A;  3Q3S A;  1D1C A;  4QWQ A;  4C30 A;  4S05 A;  1YRN A;  1ZRD A;  2D1H A;  5F0F A;  5GAE J;  2STT A;  4B1R A;  5M5X J;  2RV8 A;  3JAM K;  4XBF A;  1QPM A;  4IKF A;  2R4G A;  5GPC A;  2DA3 A;  4B09 A;  2DYR H;  3BZK A;  1B8I B;  4K2E A;  4XLE A;  4KIB A;  2XC7 A;  1NG6 A;  4S0H B;  3K1P A;  1X3U A;  2HQA A;  3OY9 A;  3FF5 A;  4U0W A;  4X1E A;  2E5N A;  3U9G A;  1IV8 A;  4MQV A;  1ZG1 A;  2RGV A;  4XKC A;  3BP8 A;  3OOP A;  3ZMS A;  1QA6 A;  5IT3 A;  3K6G A;  3CF2 A;  2F4M B;  3DBH B;  4IHW A;  2E71 A;  2X6X A;  1BA5 A;  4CA0 A;  3HHH A;  4HX4 A;  1VQ8 I;  5EGO A;  1XX5 A;  2ZJR F;  2DN0 A;  2I10 A;  1NG7 A;  2EV6 A;  4D5F A;  2YPR A;  3K7A J;  3M8F A;  4L5E A;  1A5J A;  4RB1 A;  3J80 K;  2DMN A;  2NVU B;  1X3Z B;  4DYC A;  1IJW C;  3OR2 C;  4EJT A;  1Z3X A;  5D4S A;  5HLI A;  1QBJ A;  5K1Y A;  2FF4 A;  4MFD A;  3MD2 A;  3N4M A;  2DBB A;  3HM5 A;  3HPH A;  4CSW A;  3CCJ I;  5HDG A;  2VI6 A;  2XHK A;  3PO3 J;  1FYK A;  2HNH A;  1XSD A;  3M07 A;  1H88 C;  1WJA A;  4KIC A;  3DTK A;  3PQK A;  3DV8 A;  1DU0 A;  2L2O A;  1T33 A;  3K70 D;  2G9W A;  1H89 C;  1GXQ A;  4C3H J;  4FE7 A;  5CQE A;  1IN7 A;  1CF7 A;  1NK3 P;  1MBE A;  3CP8 A;  1QRY A;  1B8I A;  3ONQ A;  4UV8 A;  2JWT A;  2YX7 A;  1UEL B;  3K4J A;  4DBR A;  1XPX A;  2JQ7 A;  3I71 A;  1OCC H;  2Z9O A;  1HKQ A;  1Y8R B;  4Q48 A;  4V2F A;  3F22 A;  2OU2 A;  4I6Z A;  1W0T A;  4KIF A;  1X1P A;  5D6E A;  3T8R A;  4XLC A;  1BI3 A;  1PYV A;  2DLL A;  3C3W A;  4Z6Y A;  4XKW A;  4JX6 A;  5EEA A;  4RLF A;  1BOB A;  2R5Y A;  1W7P B;  3G1O A;  3SEQ A;  1BC8 C;  1FJL A;  3MN2 A;  5AIP A;  5DV5 A;  5KNL A;  4HLY A;  2JUG A;  1N75 A;  2L7F P;  3E97 A;  4BQN A;  4KT5 C;  4J19 A;  3IUO A;  1R36 A;  2CV0 A;  3CCV I;  4IHV A;  2VC0 A;  3PNT A;  3UKG A;  2XKO A;  1QPI A;  2VBX A;  1E17 A;  1IN5 A;  1D8K A;  4BAC A;  2FQ4 A;  2OQG A;  2M1B A;  3HEF A;  2V9P A;  3ZMZ A;  2YU9 J;  2BVL A;  1TWA J;  9ANT A;  3ZOB A;  2OCE A;  5HNH A;  3TO6 A;  2L54 A;  3VWB A;  5ICC A;  4NBQ A;  4I0B A;  4ESF A;  2FX0 A;  3HSR A;  1MGT A;  4XKV A;  1JKR C;  1VQL I;  2GA1 A;  4OIN F;  3ZQC A;  3BR3 A;  5FJ8 J;  4GRI A;  4DNC A;  2E2J J;  2Z99 A;  3KYD B;  3QQA A;  1W5C C;  5CJ9 A;  2IAI A;  5M5W J;  5J8F A;  2R92 J;  4DJA A;  2QEN A;  3QYF A;  4HA8 A;  3CES A;  3KEQ A;  3PM1 A;  4OAZ A;  5JLX A;  1YW8 A;  1C0W A;  4A3D J;  1MBK A;  2ZXI A;  5TGT A;  3F9K A;  2HYF A;  1I5Z A;  2FBI A;  4OWR B;  4D1Q A;  1U5T B;  3ECH A;  2HPM A;  3OYJ A;  3LMM A;  3LL7 A;  5ED4 A;  5H20 A;  3HTU A;  3SZG A;  3GCM A;  1U8B A;  3H1C A;  3WTS C;  4QPQ A;  2FBK A;  5DTD A;  3K69 A;  2IS1 A;  2GZW A;  2R7R A;  2IGO A;  3B02 A;  3GTP J;  3WGG A;  3UR3 C;  3P9C A;  3F3X A;  2A61 A;  4A69 C;  3KET A;  3O6B B;  3TW6 A;  2RDP A;  2AQE A;  4GYG A;  2LTP A;  4JQF A;  2QZ8 A;  1W0U A;  1ETW A;  3OL3 A;  4C2M J;  1YS7 A;  4Q4Z F;  4KNY A;  2VOD A;  2JUC A;  1P4X A;  5DS9 A;  2ZSI B;  1IRX A;  3HOX J;  1R5G A;  2LRD A;  2V1U A;  4IRH A;  1PDN C;  1TWC J;  5J1Y A;  3KP6 A;  2QBY B;  3I59 B;  3FHN A;  1YE9 A;  3MQ0 A;  4XL9 A;  2KIM A;  1KQ9 A;  2XRN A;  2FML A;  3BPX A;  1F4K A;  1QGP A;  3JW4 A;  2XSD C;  1WHU A;  2ZJ2 A;  2AXL A;  3QP5 A;  1FY7 A;  3I3L A;  4BQQ A;  2MFZ A;  2BEO A;  3VYU B;  3RPU D;  3RI4 A;  2FOW A;  3KE2 A;  4BU2 A;  2LY1 A;  2VON A;  2WTE A;  4AU7 A;  1Z1D A;  1E3O C;  3KP2 A;  1TLH B;  1UFM A;  3JRH A;  2V1D A;  2K02 A;  4FAS D;  1KU7 A;  3CMM A;  3LSH A;  3F8F A;  2Z16 A;  2CG4 A;  2DMP A;  1VQM I;  2X9D A;  3QPH A;  3WTW C;  1MDM B;  1V3F A;  4D7M A;  3F72 A;  3S32 A;  4RGU A;  2M5W A;  1J7K A;  3V7R A;  4UHT A;  4LLG F;  4HNU A;  5F04 A;  4I01 A;  5IP9 J;  1JE8 A;  1SD6 A;  2CRG A;  4A12 A;  4A3M J;  4G7O F;  1LJ9 A;  2FOK A;  3GEZ A;  3TW7 A;  3L2C A;  1TNT A;  3TO9 A;  5JR3 A;  4A3B J;  5LGN A;  4L9V A;  1ZTR A;  5FKL A;  1HA8 A;  1HW1 A;  1HLV A;  4BXU A;  4JYK A;  2QQB A;  4LIU A;  4BE0 A;  2Q2E B;  5J47 A;  5K7F A;  1FX7 A;  5LHH A;  1TNS A;  2RNJ A;  5JVT A;  1YQA A;  4ZTF A;  2QBY A;  3I59 A;  5TIS C;  2JT1 A;  1B4A A;  3ZQ7 A;  3FKI J;  3D5L A;  1WGX A;  1MMG A;  3DEU A;  3LA7 A;  2W1O A;  3ZRG A;  3X2Q H;  4PFP A;  3WHB A;  5J3L A;  2OTJ I;  3CUQ C;  2LLK A;  2LF7 A;  2ETH A;  5CYV A;  3SYT A;  4WXC A;  5L3D A;  2K9L A;  2OZU A;  2LVS A;  5JHU A;  4B48 A;  1CGP A;  3OYM A;  3LWF A;  2BZT A;  3HB9 A;  3GTK J;  3OYI A;  1SC7 A;  1RI7 A;  4XLF A;  3LQQ A;  3BTI A;  4L5I A;  5E79 C;  2CQ7 A;  1TWF J;  5F27 A;  1FNN A;  1MDM A;  4A3K J;  3F0C A;  3KX2 A;  2EIM H;  2L7Z A;  2X6Y A;  1H9T A;  2G0E A;  2F5E A;  3CDL A;  4EAT A;  1I3A A;  3F6V A;  2NVT J;  4GFB A;  3LA2 A;  3KEY A;  1BC7 C;  2IT0 A;  3Q5F A;  2EH3 A;  5EJC A;  3RDI A;  4ZZL A;  1R23 A;  4R1H A;  1WI9 A;  2A3S A;  2QKM B;  4W97 A;  4C2U A;  1R4N B;  1T95 A;  3SZT A;  1Y56 A;  2PMU A;  3S14 J;  1X3W B;  4AC0 A;  2Q2E A;  2CH0 A;  5DUK A;  2F4I A;  2H27 A;  2NOJ B;  2XAF A;  1EA3 A;  1TQM A;  1ONV A;  3H3U A;  2TRT A;  3DBL B;  2WWY A;  1V4R A;  2E1O A;  3H0G J;  1L3L A;  2EIJ H;  1NTC A;  1HBX G;  1Y1V J;  2XRL A;  3BOQ A;  1AOY A;  2DOD A;  1R5H A;  2EFO A;  2DQR A;  2BY3 A;  4AM3 A;  1VQK I;  3SFI A;  5CKT A;  5KHD A;  4XN0 A;  2NNN A;  3CCE I;  4ENN A;  2W48 A;  4EM2 A;  3I64 A;  5FLM J;  1FBS A;  3W3C A;  2DFH A;  4ZDO A;  4CO8 A;  3I4M J;  2ZNY A;  2K5C A;  4UUS B;  2ZBK A;  1UG0 A;  3FXK A;  3JRD A;  3CDI A;  3JRB A;  2O5R A;  1FIA A;  2KRF A;  5F0C A;  1BR4 A;  2H1K A;  4PJN A;  4A3F J;  3WTZ A;  5DD8 A;  4M72 A;  3HUG B;  3U1K A;  1B9M A;  2DW4 A;  3HL2 A;  1QO0 D;  2R7S A;  3CJT B;  1YTY A;  1W5S A;  4IOC F;  4M74 A;  4M3D A;  2CS3 A;  2XPU A;  4NQW B;  1O7F A;  3BJ6 A;  1ORK A;  1DP7 P;  2P81 A;  4RDU A;  3KLN A;  1MJA A;  2P5L C;  2A68 F;  3PO2 J;  2OQR A;  5J4V A;  1K4S A;  2HVQ A;  2JPC A;  2LMD A;  3G2B A;  3KPH A;  1BJA A;  3K1N A;  3QU3 A;  5FKO A;  4DYR A;  2VB6 A;  4NNJ A;  3MZ8 A;  5CVU A;  4EJU A;  4P1W A;  2EFN A;  2ZNZ A;  2OJE D;  3H5R A;  3H92 A;  4BNC A;  3DQV C;  2CFX A;  2PQ8 A;  3RZD J;  4I09 A;  2P6S A;  1D3Y A;  1LEA A;  3GLX A;  2RVC A;  2F5F A;  2XSJ C;  5F08 A;  3V4G A;  3O2P E;  4AIJ A;  1EH8 A;  2PMZ A;  1FTT A;  1JHH A;  1KU3 A;  1STZ A;  3WE2 A;  1S9H A;  1MMD A;  2LNB A;  2LOO A;  1ERD A;  1ETV A;  5HS8 A;  2R7F A;  5E3M A;  2EFP A;  2MBF A;  1O3T A;  2KLO A;  4UV9 A;  1U8R A;  3E7L A;  1F43 A;  1ACI A;  2HQR A;  5FKN A;  4DYQ A;  1IC8 A;  1XCB A;  1ZKG A;  4LK1 F;  2H1L A;  5DCF A;  2B9S A;  2DMU A;  3ZMD A;  2O03 A;  4UUV A;  5IY5 H;  5C44 J;  2HR3 A;  2DTZ A;  2AS5 F;  3OYC A;  2YS9 A;  3C1D A;  4UUS A;  2IBD A;  1DUX C;  2VE8 A;  4Y52 J;  3WHC A;  3FIW A;  3OIQ A;  1USS A;  4PJL A;  4B44 A;  3RPQ A;  2JVH A;  3N05 A;  4D0P A;  1G6N A;  2BBY A;  1Q1V A;  3HUG A;  3I54 A;  3ZP5 A;  1Z21 A;  3VSL A;  2FMY A;  2NVY J;  1IDY A;  4NQW A;  4IQ4 A;  4MTD A;  3HZJ A;  2GM4 A;  2DFE A;  1KU9 A;  4NUB A;  3ELK A;  3O8H A;  1R22 A;  2X1D A;  5HLG A;  1BJZ A;  2D45 A;  2HDD A;  2MLG A;  3B6A A;  1ZYR F;  3BZ6 A;  3FDY A;  4CZC A;  4LIV A;  3QPL A;  2DAO A;  5FB2 A;  4E7S A;  3MAJ A;  2M8G X;  1ETK A;  3RQI A;  1ZN2 A;  3LFK A;  1R00 A;  2M34 A;  2R93 J;  1RC9 A;  2CUE A;  3A2K A;  3R6S A;  4PUS A;  2Q1Z B;  4BXF A;  3DTI A;  4CCJ A;  1BN5 A;  2BV6 A;  2M2E A;  2JA8 J;  4RLQ A;  4M9Z A;  5E3N A;  4MLO A;  5AIQ A;  1I50 J;  2WAD A;  2XGC A;  4YFK F;  3QYE A;  3H5N A;  5CLS A;  2HVR A;  1MBG A;  3E0J B;  3K10 A;  5A2Q K;  2XRO A;  4E7H A;  5EZG A;  1FPQ A;  1OPC A;  1MJB A;  2M0M A;  3LSK A;  1XSX A;  3SFZ A;  1JGG A;  4F55 A;  3SQN A;  1B9N A;  2O7O A;  2HKO A;  5ERI A;  5CVJ A;  1Z0X A;  2VAS A;  3M9A A;  1S5L C;  3OYK A;  1VQO I;  3S1Q J;  3AG2 H;  3I9V 2;  3AAF A;  2CUJ A;  1S3J A;  3FMS A;  3H9Q A;  3AG4 H;  3IC7 A;  2Q0O A;  1R1T A;  3RJP A;  4ZJZ A;  2GOM A;  3QYB A;  4XIC A;  2LF8 A;  4OAY A;  3VOE A;  2AO9 A;  3KIO A;  4KT6 A;  4L9T A;  3E6B A;  2RNG A;  4ESB A;  2O9L A;  4BS9 A;  1ZRE A;  3S15 J;  4UVC A;  1KU2 A;  1LDD A;  3OYN A;  1IN6 A;  4B8X A;  4MQ9 F;  1QHH D;  2UUZ A;  1VTN C;  1EKE A;  4BL0 B;  4HSR A;  2W00 A;  2JMW A;  3ASO H;  1EF4 A;  2GBY A;  2DU9 A;  3IAM 2;  2QSG X;  3CUO A;  1HST A;  3O8G A;  5DD4 A;  3REO A;  2LY2 A;  1PUE E;  2R7U A;  1WCM J;  2LFB A;  2GXA A;  3W6K B;  2Z3Y A;  1WJD A;  4GO1 A;  4HOB A;  4IXA A;  1I39 A;  1PJR A;  3TO7 A;  3JAM Z;  4BHC A;  3MMY B;  4PFO A;  1LB2 A;  2FNP A;  3GO5 A;  2DPU A;  3OYL A;  2A6T A;  1GDT A;  3CUQ A;  3U1D A;  1F5T A;  2L3D A;  4U7D A;  2Z2S B;  4FET A;  5J1U A;  3L2R A;  1U5T C;  2K86 A;  2DMQ A;  3FBN B;  1OYI A;  1BW5 A;  2JRT A;  3Q0W A;  4IRG A;  2HZD A;  2CQQ A;  3ZQG A;  4XQF A;  2LSO A;  4ENJ A;  2N8G A;  4LOC A;  1KZH A;  4C9Y A;  4O5V A;  2J5O A;  3H0D A;  1TT0 A;  5C4X J;  3FWE A;  3LSI A;  1MNE A;  3S2W A;  2R0Q C;  1W5T A;  2CFO A;  3CCY A;  4LD5 A;  3F8M A;  4ASN A;  1GHC A;  3T1B A;  4ZYD A;  1T38 A;  4M6V A;  1PP7 U;  2ID3 A;  1Y39 A;  1KYZ A;  2CMP A;  3IRQ A;  5DM6 F;  3GLL A;  1P9Q C;  5FKK A;  3J80 Z;  2OV7 A;  3CC7 I;  2E35 A;  2X51 A;  3L7W A;  3COA C;  2K4B A;  2OC6 A;  1SD5 A;  3PSI A;  3K4B A;  4LGW A;  1XGN A;  1AA7 A;  2IVM A;  3ZXS A;  2JPB A;  3PUB A;  3LQR A;  4Y4R A;  2FRH A;  3RYR A;  2NYX A;  4G6T B;  2E1N A;  4FQG A;  2RC4 A;  4EEF G;  3PFY A;  2NRA C;  3HOY J;  1VQ5 I;  4Q5S F;  5TJJ A;  3QU6 A;  5FO5 A;  3ZQI A;  5ICE A;  4G7Z F;  3TKY A;  3WTX C;  4Y15 A;  1YIT I;  4E7Z A;  2O0Y A;  3MEX A;  2DDA A;  3JTG A;  3ABM H;  3MKW B;  2GWR A;  5DCM B;  4U7B A;  4OIO F;  4B4C A;  3DLL F;  2VPR A;  4ZYG A;  2KIS A;  4HX7 A;  3VFZ A;  1OMI A;  1YYV A;  3BQZ A;  2GQQ A;  3E6M A;  3G3Z A;  2QSF X;  2VT3 A;  2CQK A;  2P7C B;  2VN2 A;  1FBQ A;  2XGX A;  1OCZ H;  4L5J A;  4N4O B;  4LG0 B;  2K3P A;  4ANJ A;  3M3Y J;  2Z33 A;  1IRF A;  2D5V A;  2FXA A;  4HX8 A;  1K61 A;  3IH3 A;  4QPO A;  5F6F A;  2E2I J;  2V79 A;  1P7I A;  5EDN A;  4M9X A;  3WTV C;  1OCO H;  2C6Y A;  2CUZ A;  5DYM A;  3BCB A;  1YX3 A;  3UNG C;  4ENM A;  5M3F J;  3EUA A;  5IOY A;  3VSK A;  3S2H J;  1MND A;  2STW A;  2JA6 J;  3M1E A;  2IPQ X;  3CCQ I;  4BGD A;  1NHA A;  1I6X A;  4HEA 2;  1LFB A;  1P4A A;  2IP2 A;  2P5V A;  4L9N A;  5K7Z A;  1FLI A;  4PGG A;  3ERE D;  2Y75 A;  4PJ0 C;  2K9M A;  3MCZ A;  1SFU A;  4I2O A; 
#chains in the Genus database with same CATH homology
 2QWW A;  2TDX A;  3V7S A;  3FXQ A;  4L0Y B;  3WU0 A;  5DCM A;  2XVC A;  1XDU A;  2ZXJ A;  3LAJ A;  4M71 A;  1FP2 A;  2ISZ A;  1MZB A;  4LG0 A;  1BOA A;  1U6G A;  2A07 F;  1U3E M;  1FYL A;  5HLH A;  3F8N A;  4EM1 A;  4LK0 F;  3GUD A;  3FX3 A;  3KP7 A;  4XSZ F;  2PG4 A;  4A0Y A;  5LHI A;  1ODD A;  4KN4 X;  2G7U A;  2EWN A;  3MWM A;  4G8X A;  1BI2 A;  2X4H A;  5E20 A;  5D5W B;  1ZH5 A;  1S29 A;  1P92 A;  4A0X A;  1ZGJ A;  1HQC A;  4N9H A;  4WF2 A;  5F1R A;  1XD7 A;  2LDU A;  4MEY F;  3R61 A;  5E8G A;  5LRR A;  3KFW X;  3LA3 A;  1W7P A;  4MGR A;  2R7D A;  2EA2 A;  3E5Q A;  3JSO A;  4EVI A;  4HDV A;  1E2X A;  1XGO A;  4G6D A;  3ULQ B;  2DT5 A;  4N9I A;  3EYY A;  1W7P D;  2QQA A;  2H09 A;  1O57 A;  3N97 A;  4KYW A;  4ZYH A;  2OD5 A;  3KLO A;  3T0Y A;  1FT9 A;  3GW2 A;  3DFG A;  1IRG A;  2FSW A;  4M6Y A;  4OOI A;  3WGI A;  1F9N A;  2EK5 A;  1R7J A;  3P7N A;  3R4K A;  3JTH A;  1LDJ A;  3K1M A;  5J6X A;  5ILV A;  2DFI A;  2D2W A;  4KMF A;  3HRM A;  1U5T A;  3GZ6 A;  1LNW A;  4EJO A;  2Z5U A;  4RAY A;  3KEO A;  3MFK A;  4CHU A;  2V6C A;  4DQ2 A;  5DUI A;  2HTS A;  4HF0 A;  3HRU A;  3JSP A;  1KQ0 A;  5D5X B;  4RS8 A;  2O61 A;  4JK1 X;  1A04 A;  2XAH A;  3CDH A;  1LDK B;  4Y17 A;  2VOP A;  1YW7 A;  3W6J B;  2UXN A;  2X0L A;  5D4R A;  3ECO A;  4EGZ A;  3P9K A;  4CIC A;  3SXY A;  4U0Y A;  3WTY C;  2YSR A;  5CVI A;  3BY6 A;  5L3F A;  3GF2 A;  1FSE A;  1FP1 D;  1F1Z A;  4YG2 F;  1KGS A;  3MZY A;  4HBL A;  2GIV A;  4A2U A;  2XAQ A;  4IHT A;  4L9J A;  3EET A;  5EEH A;  4HYE A;  3U2R A;  3E5U A;  1RNL A;  4KFC A;  3BDD A;  2A6H F;  3R0J A;  5K5Q A;  4IRI A;  2O6G E;  3HIF A;  2VC1 A;  5L3G A;  4MTE A;  1WQ2 A;  3Q9S A;  3KP3 A;  4F7Z A;  1I1S A;  1FSH A;  1SFX A;  3PQJ A;  1BI1 A;  1H9G A;  3VB2 A;  3TDZ C;  4ZH4 F;  1G3S A;  2CSO A;  1R58 A;  1T98 A;  2EV0 A;  3HSF A;  4XSX F;  3HTS B;  1YW9 A;  2HTJ A;  2MD5 A;  4P9U A;  2W25 A;  3GYH X;  3QP6 A;  4G9Y A;  3OV8 A;  3I0T A;  1LVA A;  2EA4 A;  1UCR A;  3KZZ A;  3LAP A;  3CLO A;  2ADU A;  4G6Q A;  3EDP A;  3NQO A;  2JZY A;  1FOK A;  2RN7 A;  2PN6 A;  5LRS A;  3DP7 A;  2MLK A;  5ICG A;  3BJA A;  4L18 B;  3T5X A;  3QOP A;  1ZRC A;  5HDN A;  3IKV A;  1MKM A;  4ON0 A;  2XKP A;  3B73 A;  2P5K A;  1ZGA A;  4OIQ F;  4RGS A;  5KVR A;  4FT8 A;  4GCV A;  1TW3 A;  4Y13 A;  4AIK A;  2QM3 A;  3CJN A;  2ELH A;  2IJL A;  4BHP A;  3F6O A;  3GFJ A;  4PDK A;  1Z9C A;  1TW2 A;  3ZPL A;  1PP8 F;  3FXU A;  2EJR A;  4P5O A;  4ETS A;  1SD4 A;  4EJW A;  2HKX A;  2HDC A;  4E70 A;  4ZYE A;  1S7A A;  1T6S A;  5KK1 A;  3E3V A;  4UNO A;  2UWM A;  4HW0 A;  1D5V A;  4YIF A;  3WTT C;  5BPD A;  4HF2 A;  4EV0 A;  3TDU C;  3GXO A;  5A2Q Z;  1ZLK A;  2CW0 F;  3HHG A;  4NHJ A;  3C18 A;  5H6Q A;  5FD5 A;  2YX4 A;  3BWG A;  2F5C A;  2PJP A;  4Q47 A;  1JGS A;  4ENK A;  2DPD A;  4RAZ A;  1Z7U A;  4JBA A;  2FE3 A;  1FYM A;  4HV5 A;  3PFI A;  1XMA A;  4KA4 A;  5BPI A;  3IKT A;  4WK8 F;  2DI3 A;  3J81 K;  5K5R A;  4R8H A;  2IA0 A;  3RKW A;  3GWZ A;  2XIG A;  4HV6 A;  1B1B A;  4P9F A;  3RIR A;  2VE9 A;  3LST A;  5LEK A;  2P8T A;  3I4P A;  3IRR A;  4ZZD A;  2MA3 A;  2DQL A;  2MH9 A;  2MH2 A;  1OKR A;  5JFR A;  5BOX A;  2H94 A;  4ESJ A;  2DO7 A;  3TOA A;  1XMK A;  3DKW A;  2YU3 A;  2BYV E;  3RTR A;  2UXX A;  3ISP A;  5TRD A;  4MNU A;  5F64 A;  5HS9 A;  2PBI A;  2P4W A;  2P6T A;  4WXH A;  2QYO A;  3FM3 A;  1G3T A;  2EFW A;  1S7O A;  4KDP A;  2H6C A;  2XAJ A;  4EM0 B;  1I1G A;  3K2Z A;  4BH9 A;  5E8I A;  4H0E A;  4MEX F;  1J2X A;  1S8N A;  2K27 A;  1IW7 F;  1KYW A;  2QVO A;  2EB7 A;  3FMQ A;  1HKS A;  1L0O C;  1MD0 A;  4PZJ A;  2OAZ A;  4KIG A;  4I7H A;  3TGN A;  5DEQ A;  4EMS A;  1UHM A;  3EYI A;  4L0Z B;  3QAH A;  5CVV A;  2JSC A;  2RKH A;  2GXG A;  1XN7 A;  2G7H A;  2WC2 A;  1O3R A;  4OU0 A;  5E1W A;  1BBY A;  1O3S A;  5FD6 A;  1ZAO A;  2FBH A;  1HKT A;  4TV7 A;  1ULY A;  3O3K A;  1I27 A;  4XLN F;  4KN7 X;  5AON A;  2W24 A;  2GA2 A;  3D0S A;  3G73 A;  1IN8 A;  4I98 B;  1TBX A;  2HZT A;  1K6O A;  3IHU A;  3F23 A;  3E5X A;  4WCG A;  1YIO A;  3RYP A;  1IXR C;  1CF7 B;  5ILS A;  4KMU X;  4LB5 A;  3QPT A;  1UHW A;  3P9I A;  2ZFW A;  2KJB A;  2RQP A;  4BHB A;  1AWC A;  5FGM A;  1QQI A;  2ZCW A;  1TTY A;  1YFH A;  3V7C A;  3NEU A;  3DXJ F;  1YO5 C;  5FLX K;  1Z05 A;  1OR7 A;  4LLL A;  5LBQ A;  5L3B A;  5BMZ A;  5HOO A;  4S04 A;  1T2K A;  1EH7 A;  2W84 A;  1IUY A;  3ZN0 A;  1WRJ A;  1FBU A;  1Z91 A;  1B59 A;  3GFL A;  1T39 A;  4XRF A;  3WE3 A;  1O3Q A;  1D8J A;  2IRF G;  2YR2 A;  4UXN A;  2XAS A;  5E1X A;  1REP C;  3V8K A;  1WWX A;  5LHG A;  2M45 A;  3M8E A;  4RGR A;  2K7L A;  5D6F A;  1BM9 A;  3EUH A;  2FA5 A;  1U78 A;  2R3S A;  2IA1 A;  2ZKZ A;  3GFI A;  3I5U A;  4A6E A;  4CXF A;  2PEX A;  3GZ5 A;  1FZP B;  4YII A;  3ABT A;  2PI0 A;  1XSV A;  1QZY A;  2KIU A;  4IVN A;  3BRO A;  3RKX A;  1IXS B;  3V8L A;  2IW5 A;  3DPL C;  4G94 A;  3F21 A;  2ESH A;  5LGT A;  1LQ1 A;  2XAG A;  2PLY A;  2BE5 F;  3DF8 A;  2VXZ A;  2ISY A;  2HS5 A;  3FZV A;  1UST A;  1J5Y A;  3KP5 A;  5K5O A;  1QNT A;  4RB0 A;  3KCC A;  5EEG A;  1YG2 A;  1XGM A;  3K9T A;  4I0A A;  3TOB A;  2NAZ A;  1KA8 A;  2HEO A;  3GVA A;  2KJC A;  4IHS A;  5D5V B;  5HS7 A;  1DPR A;  1SMT A;  1Z6R A;  2FQ3 A;  4EGY A;  1ON2 A;  1EV7 A;  4A5M A;  2CYY A;  4AD9 A;  2HYG D;  3CO6 C;  4OIR F;  3RPU A;  2L4M A;  1ZLJ A;  1DDN A;  4UVA A;  2A69 F;  1BIB A;  1RZ4 A;  1W4M A;  1GXP A;  1J75 A;  1QZZ A;  1HSJ A;  3DPT A;  2XV4 S;  1GVJ A;  4P55 A;  3L9F A;  1RIO H;  2O3F A;  4HDU A;  1YS6 A;  2V1X A;  3KP4 A;  2IA2 A;  2M87 A;  2HWV A;  3GFM A;  4LMY A;  3FMR A;  1R1U A;  2COM A;  1BI0 A;  3BPV A;  2E1C A;  2UZK A;  1WSU A;  4IPA A;  3VEP A;  5HVQ C;  2DK8 A;  2KIF A;  1B6A A;  5BS6 A;  2K4J A;  2ZME B;  1U2W A;  3R0A A;  4QLC U;  1OYY A;  2A5Y B;  2J5P A;  1S6L A;  1J0R A;  5LGU A;  2E7X A;  3F8C A;  3CO7 C;  1XB4 A;  5JI6 A;  2VOO A;  4G7H F;  5L3E A;  2QUF A;  2CGP A;  2EV5 A;  4OIP F;  3FM5 A;  1Y0U A;  2ZO4 A;  4XLP F;  3I53 A;  1UB9 A;  1IN4 A;  4GGG A;  4I02 A;  2E7W A;  2PFB A;  4A5N A;  3J7A O;  3HRS A;  1T0F A;  2DTR A;  3WOD F;  5HDK A;  3HSE A;  4GXO A;  4YFX F;  1G4D A;  4HAM A;  4NB5 A;  1SFE A;  1FC3 A;  4UVB A;  5D5U B;  4RB2 C;  3HYI A;  2PMH A;  4EQQ A;  4CDG A;  4BQA A;  1JHF A;  2A6E F;  1ZHF A;  2B0L A;  3M7G A;  3WTU C;  3MZH A;  2H6B A;  3IL2 A;  4BAY A;  2ZME A;  3WU1 B;  4M73 A;  4CGZ A;  1LEB A;  1TQP A;  5ICF A;  2NS0 A;  1IZ1 A;  4OMZ A;  1K79 A;  3C7J A;  5LEJ A;  3IWZ A;  4WWC A;  4BYY A;  1K7A A;  2Y48 A;  2QLZ A;  3SHF A;  4R79 A;  1Z6T A;  3WG9 A;  4RGX A;  1HW2 A;  1K78 B;  4M9S A;  5DDG A;  2HOE A;  4OMY A;  1OYW A;  1XCV A;  2JTV A;  4N0B A;  4U0V A;  2OBP A;  5E1Z B;  4HQM A;  5L3C A;  4U88 A;  3V8J A;  2L01 A;  1ZAR A;  3WGH A;  2CWE A;  2GAU A;  2VBZ A;  5LLQ A;  4CZZ A;  1O7L A;  1P6R A;  5ILU A;  4O6J A;  1XGS A;  4AWX B;  4O3M A;  4A6D A;  2KKO A;  1IAW A;  1MJ9 A;  4P96 A;  1J9I A;  3J81 Z;  2FEZ A;  2L02 A;  3Q9V A;  4IF4 A;  3R60 A;  1P2F A;  4HQE A;  4LLN A;  1H0M A;  1HW5 A;  3HOT A;  5BQT A;  1P4W A;  3HOS A;  4WX9 A;  5D8L B;  1WKM A;  1K78 A;  2EFQ A;  2F5D A;  3GX4 X;  3ABU A;  2P7V B;  3EQL F;  4FX0 A;  2OZ6 A;  1Q1H A;  2LKP A;  4MHG A;  3RKY A;  2V9V A;  2F2E A;  3T8T A;  5D8K B;  5J8C A;  1SAX A;  3FXR A;  3E6C C;  5IT9 Z;  4LJZ F;  3TQN A;  4CYD A;  1KQ8 A;  1G3Y A;  4A0Z A;  1XDS A;  3ML6 A;  1BIA A;  5E18 F;  4RB3 C;  2FNA A;  4HLX A;  1SMY F;  3IWF A;  1EH6 A;  4HF1 A;  1G3W A;  2QQ9 A;  4PGH A;  3L00 A;  5H6R A;  2M30 A;  4Z2Y A;  3CUQ B;  4FX4 A;  4AVP A;  2O8X A;  2Y0M A;  2D1V A;  3I58 A;  3BJO A;  2Q8K A;  1SD7 A;  1JXS A;  1FWZ A;  1DPU A;  3KZY A;  3ZN1 A;  2W57 A;  4WXD A;  2CO5 A;  1J59 A;  4M6X A;  3FHZ A;  5IT9 K;  3HRT A;  3CTA A;  2M8E A;  1ZG3 A;  3K0L A;  4AIH A;  1IF1 A;  1RUN A;  5E17 F;  4EJV A;  2GXB A;  3ZMT A;  6PAX A;  5CVR A;  2VT2 A;  1ON1 A;  4IJA A;  4LB6 B;  4PCQ A;  2OA4 A;  3VOD A;  3ZMV A;  2BGC A;  2FU4 A;  3ZMU A;  4LFU A;  2MC3 A;  1ZG5 A;  1R1V A;  2W85 A;  2NNY A;  4KUM A;  2XUB A;  4FHT A;  2VBY A;  1TQI A;  2ESN A;  3E6D A;  2VBW A;  5FFX A;  1IXC A;  3ROU A;  1RUO A;  3L09 A;  1HXD A;  2WV0 A;  1ZRF A;  4GYI A;  2ACJ A;  3QRF F;  3F8B A;  2L4A A;  5FLX Z;  1YLF A;  3NRV A;  4HZF A;  2DK5 A;  5FFZ A;  4YFN F;  2HFH A;  2HGC A;  2HQN A;  3H3Z A;  3SZP A;  1ZRD A;  4S05 A;  4QWQ A;  2D1H A;  2STT A;  2RV8 A;  3JAM K;  4XBF A;  1QPM A;  4B09 A;  4K2E A;  4KIB A;  3K1P A;  1X3U A;  3FF5 A;  4U0W A;  3U9G A;  4MQV A;  1ZG1 A;  2RGV A;  3BP8 A;  3OOP A;  3ZMS A;  5IT3 A;  3HHH A;  4HX4 A;  2EV6 A;  2YPR A;  3M8F A;  4RB1 A;  3J80 K;  4EJT A;  5D4S A;  5HLI A;  1QBJ A;  5K1Y A;  2FF4 A;  3N4M A;  2DBB A;  5HDG A;  2XHK A;  1FYK A;  1XSD A;  4KIC A;  3PQK A;  3DV8 A;  2G9W A;  1GXQ A;  1CF7 A;  1IN7 A;  4UV8 A;  2YX7 A;  3I71 A;  2Z9O A;  1HKQ A;  4Q48 A;  3F22 A;  2OU2 A;  4KIF A;  5D6E A;  3T8R A;  1BI3 A;  2DLL A;  3C3W A;  1W7P B;  1BC8 C;  5AIP A;  5DV5 A;  4HLY A;  3E97 A;  4KT5 C;  1R36 A;  2VC0 A;  2XKO A;  2VBX A;  1E17 A;  1IN5 A;  1D8K A;  2OQG A;  2M1B A;  3ZMZ A;  3TO6 A;  2L54 A;  5ICC A;  4I0B A;  4ESF A;  3HSR A;  1MGT A;  2GA1 A;  4OIN F;  4DNC A;  2Z99 A;  5CJ9 A;  5J8F A;  2QEN A;  4HA8 A;  3KEQ A;  1YW8 A;  1C0W A;  2HYF A;  1I5Z A;  2FBI A;  1U5T B;  3ECH A;  5ED4 A;  5H20 A;  3HTU A;  3WTS C;  2FBK A;  3K69 A;  2GZW A;  3B02 A;  3WGG A;  3P9C A;  3F3X A;  2A61 A;  3KET A;  3O6B B;  2RDP A;  4GYG A;  4JQF A;  2QZ8 A;  1YS7 A;  4Q4Z F;  4KNY A;  2VOD A;  1P4X A;  1R5G A;  2V1U A;  4IRH A;  1PDN C;  3KP6 A;  2QBY B;  3I59 B;  3MQ0 A;  2KIM A;  1KQ9 A;  2XRN A;  2FML A;  3BPX A;  1F4K A;  1QGP A;  3JW4 A;  2ZJ2 A;  2AXL A;  3QP5 A;  1FY7 A;  2BEO A;  3RI4 A;  3KE2 A;  2VON A;  2WTE A;  1Z1D A;  3KP2 A;  1TLH B;  1UFM A;  2V1D A;  2K02 A;  1KU7 A;  3F8F A;  2CG4 A;  3QPH A;  3WTW C;  1MDM B;  1V3F A;  3F72 A;  4RGU A;  2M5W A;  1J7K A;  3V7R A;  4UHT A;  4LLG F;  4I01 A;  1JE8 A;  1SD6 A;  4A12 A;  4G7O F;  1LJ9 A;  2FOK A;  3GEZ A;  3L2C A;  1TNT A;  3TO9 A;  5JR3 A;  5LGN A;  4L9V A;  1HW1 A;  4BXU A;  2QQB A;  1FX7 A;  5LHH A;  1TNS A;  2RNJ A;  5JVT A;  1YQA A;  2QBY A;  3I59 A;  2JT1 A;  1B4A A;  3ZQ7 A;  3D5L A;  3DEU A;  3LA7 A;  3CUQ C;  2LF7 A;  2ETH A;  5CYV A;  4WXC A;  5L3D A;  2OZU A;  5JHU A;  1CGP A;  3LWF A;  1RI7 A;  3LQQ A;  4L5I A;  1FNN A;  1MDM A;  1H9T A;  2F5E A;  3F6V A;  3LA2 A;  1BC7 C;  2IT0 A;  3Q5F A;  3RDI A;  4ZZL A;  1R23 A;  4R1H A;  1WI9 A;  2A3S A;  3SZT A;  2PMU A;  2Q2E A;  5DUK A;  2H27 A;  2XAF A;  1TQM A;  1ONV A;  3H3U A;  2WWY A;  1V4R A;  1L3L A;  1HBX G;  3BOQ A;  1AOY A;  1R5H A;  2EFO A;  2DQR A;  2NNN A;  4ENN A;  4EM2 A;  3I64 A;  1FBS A;  4CO8 A;  2ZNY A;  2ZBK A;  2KRF A;  3WTZ A;  5DD8 A;  4M72 A;  1B9M A;  2DW4 A;  1QO0 D;  1YTY A;  1W5S A;  4M74 A;  1O7F A;  3BJ6 A;  1DP7 P;  3KLN A;  1MJA A;  2P5L C;  2A68 F;  2OQR A;  2JPC A;  1BJA A;  3K1N A;  3QU3 A;  5CVU A;  4EJU A;  2EFN A;  2ZNZ A;  3H92 A;  4BNC A;  3DQV C;  2CFX A;  2PQ8 A;  4I09 A;  2P6S A;  1D3Y A;  1LEA A;  3GLX A;  2RVC A;  2F5F A;  3V4G A;  3O2P E;  4AIJ A;  1EH8 A;  1JHH A;  1KU3 A;  1STZ A;  3WE2 A;  2LNB A;  5HS8 A;  2R7F A;  2EFP A;  2MBF A;  1O3T A;  4UV9 A;  1U8R A;  2HQR A;  1XCB A;  4LK1 F;  5DCF A;  3ZMD A;  2O03 A;  4UUV A;  2HR3 A;  2AS5 F;  3C1D A;  1DUX C;  2VE8 A;  1USS A;  3RPQ A;  4D0P A;  1G6N A;  2BBY A;  3ZP5 A;  3HUG A;  3I54 A;  2FMY A;  4NQW A;  4MTD A;  1KU9 A;  3ELK A;  1R22 A;  5HLG A;  2D45 A;  2MLG A;  3BZ6 A;  1ZYR F;  2DAO A;  5FB2 A;  3MAJ A;  1ZN2 A;  3LFK A;  1R00 A;  3R6S A;  1BN5 A;  2BV6 A;  4M9Z A;  5AIQ A;  4YFK F;  5CLS A;  5A2Q K;  2XRO A;  1FPQ A;  1OPC A;  1MJB A;  1XSX A;  3SFZ A;  3SQN A;  1B9N A;  2HKO A;  5ERI A;  5CVJ A;  3M9A A;  3AAF A;  1S3J A;  3FMS A;  3IC7 A;  2Q0O A;  1R1T A;  3RJP A;  2LF8 A;  3VOE A;  4L9T A;  3E6B A;  4ESB A;  1ZRE A;  4UVC A;  1KU2 A;  1LDD A;  1IN6 A;  4B8X A;  4MQ9 F;  1VTN C;  2DU9 A;  3CUO A;  1HST A;  3REO A;  5DD4 A;  1PUE E;  3W6K B;  2Z3Y A;  4GO1 A;  3JAM Z;  4HOB A;  4IXA A;  3TO7 A;  4BHC A;  1LB2 A;  2FNP A;  3GO5 A;  2DPU A;  3CUQ A;  3U1D A;  1F5T A;  2L3D A;  4U7D A;  1U5T C;  2K86 A;  1OYI A;  2JRT A;  4IRG A;  2LSO A;  4ENJ A;  4O5V A;  2J5O A;  3FWE A;  3S2W A;  1W5T A;  4LD5 A;  3F8M A;  4ASN A;  1GHC A;  3T1B A;  4ZYD A;  1T38 A;  1PP7 U;  1KYZ A;  3IRQ A;  3J80 Z;  3L7W A;  3COA C;  2K4B A;  1SD5 A;  4LGW A;  1XGN A;  2IVM A;  2JPB A;  3LQR A;  2FRH A;  3RYR A;  2NYX A;  2E1N A;  2RC4 A;  2NRA C;  4Q5S F;  5TJJ A;  3QU6 A;  5FO5 A;  5ICE A;  4G7Z F;  3TKY A;  3WTX C;  4Y15 A;  2O0Y A;  3MEX A;  3JTG A;  2GWR A;  5DCM B;  4U7B A;  4OIO F;  4ZYG A;  4HX7 A;  3VFZ A;  1OMI A;  1YYV A;  2GQQ A;  3E6M A;  3G3Z A;  2VT3 A;  2CQK A;  2P7C B;  2VN2 A;  1FBQ A;  2XGX A;  4L5J A;  4LG0 B;  2Z33 A;  1IRF A;  2FXA A;  4HX8 A;  5F6F A;  2V79 A;  4M9X A;  3WTV C;  2C6Y A;  5DYM A;  4ENM A;  2STW A;  3M1E A;  2IPQ X;  1NHA A;  1I6X A;  1FLI A;  1P4A A;  2IP2 A;  2P5V A;  4L9N A;  4PGG A;  3ERE D;  2Y75 A;  3MCZ A;  1SFU A;  4I2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...