4ZZLA

Mexr r21w derepressor mutant causing multidrug resistance in p. aeruginosa by mexab-oprm efflux pump expression
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
146
Chain Sequence
GVDLGTENLYFQSMVNPDLMPALMAVFQHVWTRIQSELDLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutation-Induced Population Shift in the Mexr Conformational Ensemble Disengages DNA Binding: A Novel Mechanism for Marr Family Derepression.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
molecule keywords MULTIDRUG RESISTANCE OPERON REPRESSOR
total genus 47
structure length 146
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zzlA01
4LK0F 3GUDA 3E5UA 4EM2A 1O3TA 3V7SA 3GLXA 1IXSB 1BBYA 4KIBA 1T38A 5D4SA 2KRFA 4EJVA 3TQNA 3KLOA 2AS5F 1OPCA 1CF7B 2XAFA 1FYLA 2P6TA 4I01A 5HS9A 2D1HA 5LEJA 1YYVA 2FEZA 4A6DA 1F4KA 1W5SA 4LD5A 3U2RA 5ERIA 2FA5A 3T8RA 1U8RA 1WQ2A 5H20A 3LSTA 5DYMA 4LG0B 2DQRA 3IWFA 4P96A 3GXOA 1D5VA 3GYHX 1TQMA 4O5VA 2XUBA 4EJOA 2ZNYA 1IAWA 3I59A 5L3DA 1G3WA 1BI2A 4ON0A 5J6XA 3WTTC 1O3RA 2HDCA 4LK1F 2EFPA 1O7FA 3HOTA 1LVAA 3MZYA 2HQNA 2P5VA 4G7OF 3T0YA 3TGNA 4KDPA 2X4HA 1S29A 3CO7C 5JR3A 3R4KA 4LLNA 4UNOA 5HLHA 1OMIA 4U88A 3DP7A 5HLIA 5D6EA 2HEOA 2D2WA 3KZZA 1S8NA 4RB0A 2NRAC 4MNUA 4U0VA 5DCMB 3HHHA 3MWMA 4I0AA 2XIGA 3QP5A 4OOIA 1FWZA 2FBIA 4KT5C 1LEBA 2MH9A 5BPDA 1KGSA 3CTAA 3P9IA 3RKWA 4LFUA 1XDSA 4B09A 4MGRA 1JHFA 1LB2A 5LRRA 3I71A 2DK8A 4RGUA 3FWEA 4KYWA 5JFRA 4Q4ZF 4KUMA 3NQOA 2JPCA 5IT3A 3E6BA 2M45A 1U3EM 5LHGA 1FOKA 3BJ6A 5E1ZB 1TLHB 3L2CA 4K2EA 4UVCA 3TDUC 5F6FA 4Q5SF 2Z3YA 3JSOA 2L4MA 3N97A 1EH6A 1PP7U 4AWXB 2DBBA 1FC3A 2AXLA 2LSOA 3QU6A 3E6CC 3I54A 2QUFA 1BI0A 3BOQA 4CXFA 1ZREA 3QPHA 1P92A 2K27A 3ROUA 1RIOH 4FX0A 4MEXF 3G3ZA 3PQKA 2VBWA 4M6YA 2OZUA 1B4AA 5JHUA 5HDGA 3IL2A 1FNNA 4A12A 4EJWA 2P5KA 6PAXA 1J2XA 4GO1A 1MD0A 4LLGF 1R7JA 1SFEA 1FY7A 2A6HF 5FD5A 1HKSA 3ISPA 4A5MA 2J5OA 2HQRA 3RPUA 2XKPA 1KU9A 2XGXA 2Y75A 1E17A 2R7DA 2LF7A 1XGMA 2RC4A 5LGTA 3ZQ7A 1BIBA 4HX7A 2ZFWA 1XSXA 3ZMZA 4ZYGA 2DK5A 2E7XA 2HFHA 5HVQC 2G9WA 2ELHA 5BMZA 3BPXA 1U5TC 2COMA 1GVJA 2NS0A 4M74A 1PDNC 4M9ZA 3VOEA 4R1HA 2DU9A 1XGNA 4OU0A 3P9CA 4IRIA 2CYYA 1GHCA 3JTHA 5FGMA 4OMZA 1ZLJA 4LGWA 4G6QA 3DV8A 3BWGA 3QAHA 5KVRA 2HTJA 2D45A 4RB1A 2Z9OA 4EMSA 1P4AA 2ESNA 1BIAA 5H6RA 2V9VA 1DP7P 2K4JA 3MEXA 4L18B 1KQ9A 3VEPA 4BH9A 3K2ZA 2STWA 5ICGA 2JTVA 4KN4X 1MJBA 4WX9A 4L9TA 1TQIA 2Z33A 2KKOA 4I98B 2UZKA 1IN4A 1QGPA 4YIFA 2DI3A 4WXHA 4IJAA 1DUXC 3WTWC 4EGYA 3WODF 2PFBA 1T39A 2XAQA 2QLZA 2M5WA 3V8LA 4I7HA 3ECOA 4BNCA 1U5TA 1USTA 2OQGA 4ENKA 1YW8A 2EA4A 1GXPA 1Z91A 4ETSA 4HF1A 1L0OC 3QRFF 1GXQA 2QZ8A 3DQVC 2WC2A 3WTVC 2FOKA 1BM9A 5BPIA 2LDUA 4OINF 4CDGA 1F1ZA 1S7OA 4HOBA 3SZPA 1KQ0A 2EV0A 3HTUA 2HS5A 1ZYRF 4ASNA 4GYIA 2PJPA 1ZH5A 1X3UA 2V1DA 3TDZC 1D8KA 1W5TA 5E18F 4M71A 5F1RA 3CDHA 2H94A 1P2FA 2Q0OA 2CW0F 3QP6A 1IN5A 1T6SA 4IF4A 1BI1A 3C7JA 5F64A 2KIMA 4CO8A 3F3XA 2DTRA 2W84A 1FP2A 1V4RA 5D5VB 4M73A 4L9JA 3J7AO 3F22A 2FNAA 4CZZA 3MCZA 3M7GA 3FM5A 2GA1A 1ULYA 1OYIA 4XSZF 4U7DA 3WGGA 5D5UB 4L9NA 3BJAA 2EWNA 2K4BA 3U1DA 3GFMA 4EQQA 4HF2A 3H92A 2QBYB 5CVJA 1QPMA 1CGPA 2VT2A 2O6GE 3KCCA 2L54A 5AIPA 1MGTA 3FM3A 5CJ9A 3RI4A 3I5UA 1PP8F 1Z6RA 2LF8A 3D0SA 2PBIA 2XKOA 1SD5A 3IWZA 4ENNA 2K02A 2JSCA 4PGHA 1EH7A 4LG0A 5L3CA 5E1WA 4PDKA 2ZMEA 1UHWA 2VC1A 1S3JA 3RYPA 1JE8A 2BEOA 2FSWA 3HYIA 5D4RA 2LKPA 2VC0A 5DDGA 5L3GA 2BGCA 2HKOA 3R60A 2YR2A 3U9GA 2QYOA 2XROA 3HSFA 3DFGA 4MHGA 1IZ1A 5LHHA 1XCVA 4CICA 4S04A 5LBQA 4XRFA 1XMAA 4DQ2A 1UB9A 2TDXA 1FBSA 3TOBA 1XSVA 3PQJA 2Z5UA 4QWQA 2ZO4A 1YTYA 4N9HA 1V3FA 4UHTA 2V6CA 4RAYA 1KA8A 2V1UA 2V1XA 4P9FA 2Q8KA 1XSDA 1JGSA 2EJRA 3L7WA 1BC7C 3ERED 5DD4A 3HTSB 1HKTA 4UXNA 4LLLA 1XCBA 3CLOA 1LNWA 3BZ6A 3GZ5A 2IA0A 1AWCA 2F5FA 4I0BA 3GW2A 2CWEA 2RQPA 5DCFA 4ZZDA 2QENA 2ZJ2A 1VTNC 1BOAA 4RB2C 4L0YB 1Z05A 1RUOA 2NAZA 2GZWA 3MQ0A 4G94A 1KU7A 1MKMA 2GXBA 1SFXA 4LB5A 1XGOA 1QNTA 1ZG3A 3WTYC 3ZN0A 1RZ4A 4NB5A 2C6YA 2FBHA 1SFUA 5D8LB 3E5XA 2QQAA 3F21A 1R36A 2ADUA 2GIVA 5LGNA 2M30A 1LJ9A 1PUEE 4MQVA 4A0YA 1R1TA 4KMUX 2D1VA 2MA3A 3LA2A 5K5OA 3SQNA 3WG9A 1H9TA 4HV5A 3KP5A 3TOAA 1IF1A 1R5HA 3VFZA 1R23A 1K6OA 3EUHA 3K1MA 4EJTA 2VXZA 4G9YA 2P5LC 4ESJA 1R58A 3WE3A 3R61A 1YQAA 3FMSA 5JVTA 5HDKA 2QWWA 3WTSC 1ZGAA 3GFLA 1ZRCA 2V79A 4HAMA 3M8FA 4E70A 3IC7A 4FX4A 4Q48A 2XASA 4S05A 1IN7A 4M9XA 1HKQA 2OD5A 5E20A 1ZHFA 2M87A 3J80Z 2RV8A 3RIRA 1ODDA 1STZA 3T5XA 2RN7A 4ZZLA 4M6XA 5E1XA 5DUKA 4BYYA 2ZCWA 2F5EA 3RKXA 2PG4A 3OV8A 1FZPB 4IHTA 1I6XA 3REOA 1ZLKA 2QVOA 2PLYA 1ZAOA 4KA4A 4AVPA 3LQQA 1FPQA 4H0EA 4HLXA 1FT9A 1O57A 1MJAA 5HOOA 1HQCA 4YIIA 4Y17A 3WU0A 3K69A 1XDUA 3HRTA 3ZPLA 4IPAA 3GF2A 4Y15A 3L9FA 3DPTA 4OIRF 4BHCA 4ESBA 1EV7A 4HX8A 5E8IA 3FX3A 5A2QZ 1XB4A 1OYWA 4Y13A 4CGZA 3IKVA 2EFQA 5HS8A 1O3QA 1BI3A 2A69F 1IUYA 1I27A 3BP8A 1S7AA 2EA2A 5DCMA 2GQQA 3RDIA 5FB2A 3MFKA 2DQLA 1FSHA 3K0LA 1NHAA 4FT8A 2FMLA 5FLXK 2Q2EA 1MDMB 1P4WA 1J0RA 1K7AA 4RAZA 5BS6A 4EVIA 3F72A 4NHJA 1G3SA 4G7HF 4WXCA 1CF7A 3JAMK 3T8TA 3ZMSA 4KIGA 2M1BA 4ENJA 4O3MA 1Z7UA 3M9AA 1JHHA 3O3KA 1B59A 1YO5C 3HHGA 5H6QA 2QBYA 1TW3A 3RPQA 2PEXA 3F23A 4IXAA 3B73A 5FO5A 2A3SA 3EDPA 1Q1HA 2OZ6A 2VE9A 4PZJA 3ML6A 1WKMA 1HSTA 1BJAA 4KIFA 1HW2A 1UHMA 4KN7X 3GVAA 4LB6B 1MZBA 3ZN1A 3F8NA 4ZYHA 1TTYA 1TNSA 4U7BA 2ESHA 3MAJA 1IXCA 1ON1A 4BXUA 5K5RA 3KEQA 1J59A 2OA4A 5K1YA 2HOEA 3CUOA 2R3SA 3C3WA 3FMRA 1FBUA 3C1DA 4OIPF 4IRHA 2E1CA 2A61A 2P7CB 4XLNF 5TJJA 1MJ9A 2VOOA 1QZYA 5CVIA 2YX4A 5AIQA 2Z99A 3DPLC 1LDDA 5ED4A 3ABTA 4L5JA 4KNYA 3KP3A 5ICEA 3FZVA 4PGGA 4L0ZB 4ZH4F 3R0AA 1Y0UA 1B9MA 5KK1A 3J80K 4Z2YA 4BQAA 3E6DA 3K1PA 4WCGA 4EM1A 1G3TA 5DV5A 2XV4S 2CSOA 4WWCA 3RYRA 5D5XB 1A04A 3WTZA 2UXNA 3WGHA 3JTGA 1XGSA 2DW4A 2P8TA 3FXQA 1U78A 4BHBA 1QQIA 3Q9VA 3IKTA 4HYEA 5D5WB 3K9TA 4HDUA 3C18A 2FMYA 3FF5A 5CVUA 4A5NA 2XAJA 4WF2A 5J8FA 3V4GA 3ZMUA 3KLNA 1HXDA 2K86A 3QU3A 2F5CA 3I59B 1RNLA 2QQ9A 2OQRA 4HF0A 4HDVA 2EV5A 4G8XA 2A68F 4PCQA 1SD4A 5L3BA 5DUIA 4G6DA 3V8KA 3COAC 2EFWA 2W85A 5CLSA 1D8JA 5IT9Z 4LJZF 1LQ1A 1T0FA 2WTEA 4IHSA 1HSJA 1KU2A 2YSRA 2X0LA 1XMKA 2WV0A 4QLCU 2RNJA 3HIFA 1AOYA 3LAPA 1SMYF 3TKYA 4BHPA 2J5PA 2FQ3A 5ILVA 4F7ZA 3ELKA 3P7NA 1KYWA 4B8XA 3HRSA 4P55A 4RGRA 3H3UA 1OYYA 4G7ZF 2KIFA 5D6FA 2ACJA 4P9UA 2ZNZA 1WSUA 1XD7A 2O3FA 2UXXA 2IPQX 2IJLA 3HSEA 3BY6A 1B6AA 1SAXA 3HUGA 4N0BA 1HBXG 1FBQA 2IW5A 3HRUA 4OIQF 1BC8C 1SD7A 1O7LA 1SD6A 2IA1A 4I09A 2ISYA 1Z1DA 2CFXA 1W7PA 2DO7A 1QZZA 1WI9A 3SZTA 4I2OA 2JZYA 1ZG1A 3GEZA 3ZP5A 4MTEA 4NQWA 3KP7A 2NNYA 5ICFA 5LLQA 1REPC 3J81K 2RDPA 1QO0D 1U5TB 1J9IA 4RGSA 3W6KB 2HR3A 2ZBKA 1TW2A 2VN2A 3TO9A 4WXDA 3SFZA 5DEQA 2W24A 1D3YA 2ZKZA 2XHKA 3L00A 4XLPF 1G3YA 3FXRA 1HW5A 4GXOA 1IRFA 5HDNA 1B1BA 3S2WA 1IN8A 2A5YB 3M8EA 3Q5FA 3ULQB 5CVVA 3T1BA 3J81Z 4KFCA 2VT3A 2E7WA 1QBJA 3F8MA 4ZYEA 3ABUA 4HA8A 1G6NA 2P7VB 1F9NA 4HX4A 3BROA 3R6SA 1B9NA 2O0YA 2CGPA 3W6JB 4HW0A 1BN5A 2XRNA 2QQBA 2EB7A 1P6RA 4RB3C 2NYXA 4N9IA 2P6SA 3CUQB 3OOPA 2BE5F 1FX7A 2WWYA 3ECHA 3Q9SA 5LGUA 1ZRFA 4TV7A 1K78B 2F2EA 4UUVA 2CO5A 3O6BB 5EEGA 3ZMDA 5TRDA 5ICCA 3TO7A 4ZYDA 4YFXF 3CJNA 3FXUA 4Q47A 1U2WA 3F6OA 2VBYA 3KZYA 2MD5A 3ZMVA 2XAHA 3G73A 1RI7A 3EYIA 3CUQA 3GFJA 4HBLA 3KP6A 2F5DA 4UV8A 2EFNA 4AD9A 4GGGA 1TBXA 5HLGA 2G7HA 3BPVA 3E6MA 2OU2A 4M9SA 2A07F 2YU3A 2HTSA 3K1NA 2RVCA 1H9GA 3LA3A 4IRGA 3DEUA 3JSPA 2DT5A 5BQTA 1OKRA 4UV9A 2DFIA 2UWMA 4EGZA 1W4MA 1YW9A 2A6EF 1XN7A 3KETA 2KJCA 1DPRA 3SHFA 2HKXA 2ETHA 1IRGA 2EK5A 2IP2A 3B02A 2GAUA 5DD8A 3E5QA 4OMYA 4A2UA 2MLKA 3BDDA 3F8BA 2VOPA 3I53A 1E2XA 3IRQA 3HRMA 2FXAA 1JXSA 3NEUA 1Z9CA 2BYVE 4L5IA 3O2PE 4EV0A 5LHIA 1IW7F 2K7LA 1HW1A 3KEOA 4HLYA 3GO5A 3WTXC 2YX7A 5A2QK 2STTA 1TNTA 3MZHA 1TQPA 2L02A 2M8EA 4AIKA 2NNNA 1YG2A 3KP4A 2PN6A 2W57A 1DDNA 4R79A 4GYGA 4CHUA 2FRHA 1WRJA 2OAZA 4ENMA 1T2KA 3M1EA 3EQLF 4DNCA 3EETA 1ONVA 2H6BA 1LDJA 5J8CA 4IVNA 2MBFA 2JT1A 3IRRA 3F6VA 2VBZA 3R0JA 1U6GA 3LA7A 3F8FA 3LQRA 3FHZA 4JQFA 2FBKA 1YS6A 2CG4A 3P9KA 5BOXA 1R00A 1R1UA 2PI0A 1ZN2A 2LNBA 1YIOA 3WGIA 2H27A 1IN6A 2Y48A 1LDKB 3VODA 2EFOA 2VONA 4AIJA 5FD6A 2P4WA 4HQMA 5HS7A 3V8JA 4KMFA 3KFWX 3EYYA 4RS8A 3LWFA 4P5OA 1I1SA 4XSXF 2DAOA 1ZG5A 3KE2A 4A0ZA 4LMYA 5CYVA 4YFKF 1G4DA 5LEKA 4RGXA 1P4XA 2FE3A 2Y0MA 1K79A 2HGCA 2H09A 5E17F 3KP2A 1FLIA 3JAMZ 5L3EA 3RKYA 2DPUA 4UVBA 4JBAA 3DXJF 2MLGA 2DLLA 2QM3A 4EJUA 2ISZA 4MQ9F 2VODA 2KJBA 2EV6A 3DF8A 1L3LA 4CYDA 1YFHA 3HSRA 3AAFA 2ZXJA 1USSA 1YLFA 4A6EA 2RKHA 5CVRA 1KQ8A 5ILUA 2VBXA 3GX4X 1DPUA 2PMUA 4O6JA 2G7UA 4UVAA 2O8XA 2HYGD 2MH2A 4MEYF 3I64A 1K78A 2MC3A 1ZARA 4U0WA 3QPTA 4FHTA 2IVMA 2VE8A 3GWZA 1YW7A 2FF4A 1W7PB 2BV6A 3LFKA 1UFMA 3WTUC 4D0PA 3WU1B 2ZMEB 2IRFG 5AONA 2BBYA 1YS7A 3DKWA 1R22A 1ZRDA 3LAJA 4M72A 3I58A 3JW4A 5K5QA 4YFNF 1OR7A 5JI6A 3N4MA 2PQ8A 4I02A 1FYKA 1UCRA 2JRTA 3HOSA 2FNPA 2HWVA 2GA2A 2PMHA 1R5GA 1W7PD 1T98A 4ESFA 1ZGJA 2GXGA 4KICA 2CQKA 3IHUA 5EEHA 3VB2A 2OBPA 3E97A 2H6CA 1H0MA 3QOPA 4AIHA 3NRVA 1J5YA 4A0XA 3BJOA 2DPDA 3RJPA 1J75A 1C0WA 1KYZA 1FSEA 5FFZA 3D5LA 2GWRA 3WE2A 3I0TA 3RTRA 2O61A 5FLXZ 2L01A 5ILSA 3GZ6A 1LEAA 2O03A 4BAYA 3V7RA 3PFIA 3TO6A 3I4PA 2KIUA 3L09A 1R1VA 2L4AA 2L3DA 2HYFA 3H3ZA 1KU3A 4HV6A 4HZFA 4U0YA 2FU4A 4OIOF 3SXYA 3GFIA 1FP1D 4HQEA 1RUNA 1ON2A 3ZMTA 3V7CA 1MDMA 2IA2A 2XVCA 2RGVA 5LRSA 3FMQA 4YG2F 2HZTA 2W25A 5L3FA 4GCVA 4JK1X 5IT9K 3F8CA 1EH8A 3CUQC 2XAGA 1F5TA 2JPBA 1J7KA 5FFXA 2R7FA 3E3VA 1I1GA 4L9VA 5E8GA 4MTDA 2IT0A 4WK8F 3CO6C 1S6LA 5D8KB 1IXRC 2E1NA 4XBFA 1O3SA 1I5ZA 1Z6TA 1WWXA 4R8HA 1FYMA 1SMTA 2YPRA 4EM0B 2B0LA
chains in the Genus database with same CATH superfamily
3FKJA 3DTEA 4LK0F 3GUDA 2DA3A 3TMOA 1HC8A 4XL9A 3E5UA 1XPXA 1XS9A 4I76A 4EM2A 3S2DJ 1O3TA 2IS6A 1EF4A 3V7SA 1H89C 3GLXA 1IXSB 1LUJB 1BBYA 4KIBA 3CMMA 5EEAA 1T38A 2DFFA 2L9RA 5D4SA 1F36A 2KRFA 4EJVA 3TQNA 2WAQN 3KLOA 2XF6A 2AS5F 1OPCA 4B43A 2LVSA 2NOGA 4PSWA 2R7RA 1CF7B 2XAFA 1FYLA 1UHSA 2P6TA 1BA5A 4I01A 5HS9A 5IP7J 2YUSA 5M5WJ 2D1HA 5LEJA 1YYVA 4QIWN 2FEZA 3A2KA 1B8IB 4BDYA 4A6DA 2JMWA 1F4KA 4B44A 1W5SA 2BZTA 3HBLA 4GFBA 2LY9A 4LD5A 3U2RA 4XK4A 2L0KA 3B6AA 3BCAA 5ERIA 5KAFC 2FA5A 3T8RA 2NS7A 1U8RA 1WQ2A 5H20A 1ZTRA 3LSTA 5DYMA 3K4JA 1OISA 4A3JJ 4LG0B 2DQRA 3IV5A 3IWFA 4P96A 3GXOA 1YIJI 4I6ZA 2R92J 1D5VA 4JX5A 5F0HA 3GYHX 1TQMA 4O5VA 2XUBA 1MH3A 3BC8A 4EJOA 2ZNYA 1IAWA 1LFUP 4XOTA 2FQ4A 3I59A 5L3DA 4DOZA 1G3WA 3LSKA 3HGYA 2ELJA 4A3DJ 1BI2A 4ON0A 2LY1A 3MVPA 4NC8A 2BY1A 1P7IA 1TC3C 1BL0A 5J6XA 3WTTC 1O3RA 1MBKA 2ICWG 2HDCA 4QTRA 4LK1F 2EFPA 3LFUA 4ANJA 1O7FA 2K40A 3HOTA 1Y0NA 1LVAA 3UKGA 3MZYA 2HQNA 2CV2A 2P5VA 4G7OF 4F92B 3RKQA 3T0YA 3TGNA 2ZC2A 4A3IJ 1YHQI 4KDPA 1B72B 2KRCA 2X4HA 1S29A 3CO7C 3CC4I 5JR3A 3R4KA 4LLNA 4UNOA 5HLHA 1OMIA 4U88A 2ECBA 1RETA 2BY2A 1A31A 1ETQA 2LG4A 2VJJA 3HOVJ 1SVMA 3IH3A 1GT0C 3DP7A 5HLIA 3MKWB 3CP2A 3H5NA 3FBIB 5D6EA 3W2WA 3PIOF 3JRCA 4CYCB 5DS9A 2HEOA 2D2WA 2KDOA 4F52A 2I8DA 2Y0SN 3KZZA 3SZGA 3VDXA 1S8NA 3OS2A 4RB0A 2W1OA 2NRAC 4MNUA 3F9KA 2PJRB 4U0VA 5GPAA 1X2MA 5DCMB 3OS0A 1DU6A 3HHHA 3MWMA 4C3IJ 1QU3A 4I0AA 2XIGA 4F93B 2OTJI 2BHYA 1TWCJ 2H1LA 3QP5A 4OOIA 1FWZA 2E1OA 2HOAA 1YRNB 1ITYA 2CQQA 2FBIA 4KT5C 1LEBA 2MH9A 5BPDA 1Z77A 3RZDJ 3IAS2 1KGSA 3CTAA 4HNUA 5F0CA 3P9IA 2E5ZA 2ZSIB 3FDYA 3RKWA 1UG2A 4LFUA 1XDSA 1JKRC 2QSHX 4B09A 1APLC 3ASOH 2ZSHB 4MGRA 1JHFA 1LB2A 3PO3J 5LRRA 3ZQFA 5KNLA 3I71A 2MGQA 2WAQA 2GOMA 2OJED 2DK8A 2ZXIA 2XRLA 5HNFA 4RGUA 3FWEA 3ABLH 1LE8B 4KYWA 5JFRA 4F3QA 1R4NB 1XMXA 2JWTA 2L7MP 4KUMA 4Q4ZF 5M5YJ 1WPKA 4D7NA 3NQOA 4F91B 1UAAA 2JPCA 2X1DA 5IT3A 1WJCA 3E6BA 2M45A 1U3EM 3J7AY 5LHGA 1FOKA 1ZKGA 1W36C 3BJ6A 5E1ZB 3ZOBA 1VF9A 1TLHB 1A35A 1QHGA 3L2CA 3OYEA 4AM3A 4K2EA 4UVCA 3GTOJ 3TDUC 4BE2A 5J3LA 2WAFA 2Z1DA 5F6FA 4Q5SF 2Z3YA 3JSOA 2L4MA 2K3PA 3N97A 2IS2A 3GTLJ 1MW7A 2R5YA 1EH6A 1Z0XA 1PP7U 2LR8A 4AWXB 1PJRA 5C4JJ 2HI3A 2DBBA 2M4GA 1FC3A 1MMAA 1QVUA 2AXLA 2LSOA 3J7YJ 3E0JB 1OLTA 3QU6A 3E6CC 4ZC3A 2QKLB 3I54A 2QUFA 1BI0A 3BOQA 4CXFA 3K4NA 2O7OA 1JI8A 1ZREA 2MSYA 3QPHA 3HUGB 1P92A 2K27A 3ROUA 1RIOH 4FX0A 2CUEA 1MMDA 1WJFA 3FKIJ 3U1KA 4MEXF 4MIMA 3G3ZA 3PQKA 2VBWA 4M6YA 2KL4A 2OZUA 2WV1A 1KZHA 2Y30A 1B4AA 2JUCA 5JHUA 3QQAA 3OSFA 2HPIA 1ZQ3P 5HDGA 2ME6A 3IL2A 1FNNA 1QZEA 4Y4RA 3FK7A 1TT0A 4A12A 4EJWA 2GOXB 4B3AA 2X6WA 2P5KA 6PAXA 2E36A 1E0EA 3BQZA 2EBIA 3HPGA 1MBGA 1J2XA 4ZDLA 3LL7A 4GO1A 1MD0A 4LLGF 1R7JA 4BEHA 1GDTA 3I4NJ 1F43A 1SFEA 1FY7A 2A6HF 5FD5A 1HKSA 3ISPA 4A5MA 2DMNA 2J5OA 3KYLA 2R7VA 2H8RA 1Y8QB 2KRHA 1HDPA 2HQRA 3CMYA 3RPUA 1FTZA 2XKPA 1KU9A 3IH4A 2XGXA 3K70C 2NVQJ 2Y75A 1E17A 1Z7LA 2R7DA 4RLFA 3M07A 4FQGA 3E1SA 1Y8RB 4M3FA 1MMGA 2E1MB 2LF7A 1XGMA 2RC4A 2ZMEC 4N4OB 3OIOA 3HKZN 5C4XJ 4BKXA 5LGTA 3ZQ7A 2XB5A 1BIBA 1QRYA 4A69C 4HX7A 1WHUA 1IO2A 3EUHC 1BR2A 2ZFWA 4YEJA 1XSXA 3ZMZA 5HLTA 2QSGX 2WA0A 4RDUA 3FISA 3RSNA 4ZYGA 2DK5A 2E7XA 2HFHA 4ZYAA 2R0QC 2AO9A 2NOJB 5HVQC 5IYCJ 1SVLA 2G9WA 2ELHA 5BMZA 4BJ6C 3BPXA 1U5TC 2IGMA 1VQ8I 2COMA 1JKQC 1E3HA 1GVJA 2NS0A 2FJ1A 3QPSA 4M74A 1RRJA 2VKHA 4BUPA 1PDNC 5K7FA 4M9ZA 3VOEA 4BE1A 4R1HA 2DU9A 4CCNA 2E71A 3DCFA 1XGNA 3CF2A 4OU0A 2DA5A 3CCQI 3QYBA 3P9CA 3PIPF 2V1NA 4HG2A 1R5ID 4IRIA 2JQ7A 2CYYA 1GHCA 4M3EA 2V7FA 3JTHA 5FGMA 3K4BA 2MD0A 2OF7A 2LLKA 3HXLA 3MN2A 4OMZA 5M3FJ 1ZLJA 4H4KC 2HDDA 4LGWA 1Z67A 4G6QA 3DV8A 3OL4A 3BWGA 3QAHA 5KVRA 2HTJA 2D45A 2K9MA 2OV7A 1WH5A 3HB9A 2FOWA 4RB1A 2Z9OA 1LFPA 4EMSA 1N77A 4AUXA 1MH4A 1P4AA 2ESNA 2K9SA 1UELB 1BIAA 3U21A 5H6RA 2V9VA 2ME0A 1DP7P 2K4JA 2IGKA 3MEXA 4ITVA 4AYBN 1KQ9A 4L18B 3GTMJ 3VEPA 3OYAA 1JT0A 1GUUA 4BH9A 2NVYJ 3K2ZA 1NTCA 3CZ6A 2STWA 5ICGA 2JTVA 4KN4X 3PM1A 1DQUA 1MJBA 5IT9K 4DJAA 2X6YA 4WX9A 3ZQIA 1HOMA 4L9TA 3GTQJ 1N78A 4BE0A 1SAUA 1TQIA 2K85A 2KKOA 4I98B 5B1AH 2NVUB 1IN4A 2UZKA 2Z33A 1BJZA 1QGPA 4YIFA 2DI3A 1J09A 3O8HA 3TP3A 2H8WA 4WXHA 2A05A 2CV0A 4IJAA 1DUXC 3WTWC 4EGYA 1Z3XA 3WODF 4C3JJ 2PFBA 5FJ8J 4PJJA 5GTHC 2TCTA 1T39A 3FXLA 1NH3A 1LPQA 1D0XA 1Z3YA 1X4PA 2WADA 2XAQA 3PSFA 2QLZA 2M5WA 3V8LA 4I7HA 2M9HA 3ECOA 4BNCA 1U5TA 1USTA 5IOZA 2OQGA 4ENKA 3VYSB 1YW8A 2EA4A 2BXZA 4BDZA 1Z91A 1GXPA 4ETSA 4NQWB 3CCMI 2R7XA 2LC2A 5FLVA 4HF1A 1L0OC 1WVRA 2B63J 3A01A 2BY3A 3QRFF 1GXQA 3TEDA 2QZ8A 1AU7A 3DQVC 2LREA 2WC2A 3WTVC 3OYLA 3JRIA 4XMYA 2Q2EB 2DT6A 4IQ4A 2FOKA 3HGGA 1QA6A 4DBRA 1RR8C 3CCVI 3OOUA 1BM9A 5BPIA 1AKHA 2I10A 1H8AC 4BGDA 2LDUA 4JP0A 3W2VA 4OINF 4BEHB 3TW6A 4CDGA 3S14J 1F1ZA 3A02A 3PL8A 1S7OA 4HOBA 3SZPA 3FXOA 5JLWA 1KQ0A 2EV0A 3FXMA 1D5YA 3CDIA 2QF7A 1E3OC 3HTUA 1Y1VJ 1I39A 3S3NA 2HS5A 1ZYRF 4ASNA 4GYIA 2LMDA 1ZH5A 3CCEI 1X3UA 2PJPA 2V1DA 3KZIC 3TDZC 4ZDOA 1D8KA 1W5TA 3GLLA 5E18F 2DCEA 4M71A 5F1RA 3CDHA 2L5QA 2PMZN 2H94A 1P2FA 2Q0OA 3CCJI 1MSFC 2CW0F 3DU6A 2ZB9A 2DXIA 1D1CA 3QP6A 2KMUA 2GIZA 4KISA 2HOSA 1IN5A 3BR6A 1T6SA 4A3BJ 3QOEA 4IF4A 1CQTA 1TZLA 1BI1A 3C7JA 4BBSJ 5F64A 2KIMA 4A3MJ 4CO8A 2XB0X 1EKEA 2AQFA 3F3XA 3CMAI 2DTRA 3K7AJ 2W84A 1FP2A 5EF6A 1V4RA 3BG6A 5D5VB 5BNGA 2X9DA 4M73A 4MLOA 4V19K 4L9JA 3J7AO 3F22A 4X6AJ 3VYUB 2FNAA 5H2FC 5C44J 4CZZA 2X85A 4NBQA 3CCUI 3SJMA 3MCZA 2LKSA 1IV8A 3M7GA 3OMYA 3FM5A 2GA1A 1ULYA 1OYIA 4XNFA 2KDZA 3ABKH 4XSZF 4U7DA 3M1CA 3WGGA 1OCOH 4BQQA 5D5UB 4XKVA 4L9NA 2RNGA 1V5EA 3BJAA 2EWNA 3A01B 2K4BA 1ZELA 2EILH 3U1DA 2MG4A 2TRTA 3GBGA 3GFMA 4IOCF 3AFHA 4EQQA 4EEFG 3M4OJ 4HF2A 3H92A 4E7ZA 2QBYB 5CVJA 2HNHA 1QPMA 2LTPA 1CGPA 3S1MJ 4A3LJ 2VT2A 2O6GE 1JKPC 5JLXA 3KCCA 3OYCA 2L54A 5AIPA 1MGTA 3FM3A 4XQFA 3CCRI 3Q0WA 5CJ9A 3RI4A 3I5UA 4DZJA 4Z6YA 1PP8F 1IRXA 1K6YA 1Z6RA 2X1CA 2LF8A 3D0SA 2PBIA 2XKOA 2XPUA 1WJDA 1SD5A 2E34A 4YRVA 3IWZA 4YELA 5FKMA 4XORA 4QSHA 4ENNA 1SEUA 4M3GA 5DTDA 2K02A 2VPRA 2JSCA 3AL0C 3L2VA 4PGHA 4BXXJ 3C2GA 2AXTC 1EH7A 4LG0A 5L3CA 5E1WA 4PDKA 1D1BA 1XC5A 2ZMEA 4B4CA 1UHWA 2QKMB 2VC1A 2DJIA 1S3JA 3RYPA 2BVMA 1JE8A 2ID6A 2DT7B 2BEOA 2FSWA 3HYIA 3H9GA 4DYQA 5D4RA 2LKPA 2VC0A 4UB6C 5DDGA 5L3GA 2BGCA 2F6CA 2HKOA 3R60A 2CUZA 2YR2A 2EH3A 2Y31A 3U9GA 1U0JA 1D0ZA 2QYOA 3J7ZI 2XROA 2CH0A 3HSFA 3HM5A 1TL8A 2L2OA 3G6EI 3DFGA 2MC4A 4MHGA 5KHDA 4UUSB 1T08B 1IZ1A 5LHHA 1XCVA 2EINH 4CICA 1ERDA 4IQJA 4S04A 5LBQA 2FD5A 4XRFA 2R7TA 1XMAA 3MKLA 4DQ2A 1UB9A 2TDXA 1FBSA 3CLQA 3FXKA 3TOBA 3GZNB 3LOCA 1XSVA 3PQJA 2Z5UA 3BTJA 1WZ2A 4S0HB 4QWQA 4AVZA 2ZO4A 1YTYA 3IH2A 2R7ZJ 4N9HA 1V3FA 4UHTA 1KONA 2DYRH 4EATA 3VPRA 2V6CA 4RAYA 1KA8A 2V1UA 2V1XA 4P9FA 2Q8KA 1MIJA 3BZKA 1PYVA 1XSDA 1IC8A 1JGSA 2EJRA 3L7WA 4XRMA 2AQEA 1WJ5A 1BC7C 3ERED 4XKCA 5DD4A 3HTSB 1HKTA 4UXNA 5EGOB 4CH7A 3H5AA 1JT6A 4LLLA 1XCBA 3EUKL 1AHDP 1FEXA 3CLOA 4DZPA 3S1NJ 4KITB 1LNWA 2K5CA 3BZ6A 3GZ5A 2IA0A 1AWCA 2EZKA 3KPHA 3S8PA 4CCLA 4IZZA 1YOVB 2F5FA 4I0BA 1X2NA 1ENHA 3I4MJ 3GW2A 2CWEA 1VQOI 2RQPA 5DCFA 4ZZDA 5DM7F 1YITI 5E3LA 3OYNA 2QENA 3ZQCA 2HQ5A 2ZJ2A 4CA0A 1K4TA 1VTNC 5LD2C 1BOAA 4RB2C 4X1EA 4W97A 3RQIA 4L0YB 1Z05A 4E7HA 2RREA 3S32A 3HKZA 1GV2A 3ESWB 1RUOA 2NAZA 1ETOA 2JA5J 2GZWA 3MQ0A 2KQRA 2LY2A 4G94A 1KU7A 1MKMA 2GXBA 1SFXA 3BT9A 4LB5A 1E3PA 1X1BA 1XGOA 4C30A 2X51A 3VYRB 1QNTA 3AG3H 2Y0SA 4XKWA 1ZG3A 3WTYC 3ZN0A 3W3CA 4BU2A 1RZ4A 1BW6A 4NB5A 5KCMA 1RESA 4GRIA 2C6YA 3FK6A 2DOFA 2FBHA 1A6QA 1SFUA 5D8LB 3TW7A 2R7SA 1NG6A 4XRSG 3E5XA 5FKKA 2QQAA 3ZGKA 3F21A 1R36A 2DA6A 5J4YA 2ADUA 3MKYB 2GIVA 5LGNA 2M30A 2B7EA 1LJ9A 1PUEE 4MQVA 1VQ5I 4A0YA 1R1TA 3MMYB 4KMUX 2D1VA 2LP0A 2MA3A 3LA2A 3SQNA 5K5OA 3WG9A 1H9TA 4ZTFA 1A5JA 2O9LA 4HV5A 4X0GA 3KP5A 3K70D 3TOAA 3VFZA 1R5HA 2BOLA 1R23A 1K6OA 1IF1A 3EUHA 4RAGA 2VKVA 3K1MA 2VKDA 4EJTA 2VXZA 1R9TJ 2NXNB 4G9YA 2P5LC 3H9QA 4ESJA 3OYJA 3OYKA 1R58A 3WE3A 2VIXA 4IO9F 2L7FP 3R61A 5C3EJ 1IJWC 3FBNB 4KT6A 5GAHJ 1YQAA 3FMSA 5JVTA 5E3NA 5HDKA 2QWWA 1WJAA 3WTSC 2IGOA 3MZ8A 5GAGJ 4NC6A 5FLMJ 4A3FJ 1SC7A 1MMSA 4XRSA 2JRMA 2LRDA 3CJTB 1ZGAA 2VI6A 3GFLA 1ZRCA 4J01A 2LYCA 2V79A 4HAMA 4UB8C 3M8FA 4E70A 1G59A 3S1QJ 3IC7A 4FX4A 4Q48A 2XASA 4S05A 1IN7A 1UJ8A 3OL3A 4M9XA 1HKQA 1A36A 2OD5A 4A3GJ 5E20A 4F55A 1ZHFA 2M87A 3LSGA 5IOYA 3J80Z 4XLCA 3OYFA 3OR2C 2RV8A 4BY7J 1MBFA 2IS4A 3SDBA 5DM6F 3RIRA 5IPAA 1ODDA 4FTHA 1STZA 3T5XA 2XPVA 2X6XA 2XGEA 1D0YA 5CQGA 2RN7A 3CCSI 4ZZLA 4M6XA 5E1XA 5DUKA 4BYYA 2ZCWA 1FIPA 2F4MB 2F5EA 3JRHA 4KJZA 4XIDA 3RKXA 2PG4A 2CS3A 3OV8A 3BZCA 5M5XJ 1FZPB 4IHTA 3SEQA 1I6XA 1X1DA 3REOA 1ZLKA 2QVOA 2PLYA 1ZAOA 4KA4A 3X2QH 2BY0A 3RCOA 2OTLI 2XF5A 4AVPA 3HJEA 3LQQA 1FPQA 2EIMH 4H0EA 1QVTA 1S5LC 2G0EA 1W0UA 4HLXA 1FT9A 1O57A 1MJAA 5HOOA 2Z16A 1HQCA 3L1PA 1T0FC 2VJ4A 4RBOA 1VI0A 4YIIA 1NG7A 3CJRB 5EZGA 1FMWA 3I56I 1Y6IA 4Y17A 3ZQLA 3H35A 3PNVA 3WU0A 1YI2I 4PJLA 1RKTA 3K69A 4E7IA 1XDUA 3HRTA 1S72I 3ZPLA 1GLNA 1B8IA 4IPAA 2JA8J 2JK3A 3C2HA 3GF2A 1OCPA 4Y15A 3L9FA 3DPTA 4BXFA 4OIRF 1T95A 4E7LA 4BHCA 5GTIC 4ESBA 1EV7A 4D5FA 4HX8A 5E8IA 1MMNA 2CFOA 1U9NA 1QPIA 1QHHD 3FX3A 2HOTA 5A2QZ 3KYCB 4DBQA 3HOUJ 1XB4A 3AG1H 3FXJA 1MNEA 1OYWA 4Y13A 4XN3A 4CGZA 1OFCX 4C2MJ 2CMPA 4UY8I 4XLFA 3IKVA 3BR1A 1JUSA 3OYIA 3OS1A 1WH7A 2EFQA 3A03A 5JHFA 3N05A 4CCJA 5HS8A 4V2FA 1IDZA 2PX9A 1O3QA 1BI3A 2A69F 3D5RC 1I27A 1IUYA 3BP8A 1S7AA 2EA2A 3K4CA 5DCMA 2LOOA 2GQQA 3H0DA 2XPWA 3RDIA 5HODA 5FB2A 3MFKA 4JX6A 1S7EA 2DQLA 1FSHA 3NAUA 3H0GJ 3K0LA 4D9JA 1IUFA 2XGDA 5FRMA 1NHAA 4FT8A 2FMLA 3TP0A 4C9YA 2QA4I 5FLXK 1JTYA 1M1EB 5GADJ 2Q2EA 3GTGJ 1MDMB 1ZGWA 4FETA 1P4WA 1J0RA 4JX4A 4RAZA 1K7AA 5BS6A 4EVIA 4E7JA 3KYDB 3F72A 2JA7J 4NHJA 1G3SA 4G7HF 2M4KA 3HOZJ 4WXCA 1CF7A 3JAMK 2Q1ZB 5F0FA 3T8TA 3ZMSA 1UMQA 4KIGA 2M1BA 4ENJA 4O3MA 1Z7UA 4II3A 3DEWA 3OYMA 1P9QC 1VQMI 3M9AA 1JHHA 3O3KA 2DA1A 3PNYA 1VQPI 1B59A 1YO5C 1UG0A 3HHGA 5H6QA 2QBYA 3M3YJ 1TW3A 3RPQA 2PEXA 1WGXA 3F23A 1MBEA 2E2HJ 4IXAA 2WAEA 3B73A 2M2EA 1MBJA 5FO5A 2A3SA 3EDPA 3A0BC 1Q1HA 2OZ6A 2VE9A 3GMEA 4PZJA 3ML6A 1WKMA 1HSTA 3RQ4A 1BJAA 1X3ZB 3AG4H 2DMPA 4KIFA 1HW2A 1UHMA 4KN7X 2HU9A 3GVAA 3OWTA 2R5YB 2LBFB 3SEZA 1ETVA 4LB6B 1MZBA 3ZN1A 3F8NA 4ZYHA 2VLAA 1TTYA 3ZQQA 4QPQA 1TNSA 2M7AA 1ETXA 3M8JA 4U7BA 2ESHA 3MAJA 2DFEA 1IXCA 1ON1A 4BXUA 5K5RA 3KEQA 4M3DA 1J59A 2OA4A 2KZGA 3ABMH 5K1YA 2HOEA 3BQYA 3CUOA 4PUSA 2BW3A 2W82A 3K4MA 3H3VK 4QPOA 2L9SA 2R3SA 2UV1A 4M3BA 1OJLA 3C3WA 1OCCH 1Q1VA 1YE9A 2KHMA 3FMRA 1FBUA 3C1DA 5F27A 4XICA 4IRHA 4OIPF 2CW7A 3UR3C 2CW8A 3JCUC 2E1CA 1TWAJ 4N4NB 1NK3P 2A61A 2YU9J 2P7CB 4XLNF 3E7LA 5EJCA 5TJJA 1MJ9A 5FROA 3ZR8X 2D5VA 2B9SA 2VOOA 1RR7A 2DODA 1QZYA 2EIKH 5CVIA 2YX4A 3DWLE 5AIQA 2Z99A 3DPLC 2LFBA 1LDDA 5ED4A 3ABTA 2DOEA 4L5JA 4KNYA 3O8GA 3KP3A 5ICEA 2ZJRF 4A93J 3FZVA 1X1AA 2QSFX 3JRDA 3WG7H 4JYKA 4XLHA 4PGGA 4L0ZB 4IEJA 4ZH4F 1RPWA 2HQAA 3AKZA 3CP8A 3R0AA 1Y0UA 5FRNA 1B9MA 5KK1A 3J80K 4Z2YA 1IV6A 4BQAA 5IP6A 2OCCH 3E6DA 3LSPA 2DOAA 1H88C 3K1PA 1FMVA 3LSMA 1Y1WJ 2WB1A 4LOCA 4WCGA 4EM1A 1IRZA 1ZK8A 1A6IA 2QGUA 4AIDA 1DGWY 3VWBA 2VQLA 3S1RJ 1G3TA 4A3KJ 5DV5A 2XV4S 2A5WA 3QWLA 4FCYA 2CSOA 5EG0B 4HNTA 1W1WE 4XKBA 5E3MA 3RYRA 5D5XB 4WWCA 3LNQA 3CCLI 1G8XA 1WCMJ 1VQ4I 4BJ5C 1A04A 3WTZA 5TISC 2IS1A 2UXNA 2DMQA 3WGHA 2ZJQF 3JTGA 1XGSA 2DW4A 3IUOA 2P8TA 1AA7A 3FXQA 1U78A 4BHBA 1QQIA 4XONA 3Q9VA 3IKTA 4HYEA 5IP9J 5D5WB 3ZRGA 2KISA 3K9TA 4DIQA 4HDUA 3C18A 2LK2A 2FMYA 3OYBA 3FF5A 5CVUA 4A5NA 2XAUA 2XAJA 4WF2A 5J8FA 2ZJPF 3DKYA 3V4GA 3ZMUA 3IAM2 3KLNA 1K4SA 2CUFA 3BR2A 2R7OA 1HXDA 4L5EA 2K86A 3QU3A 2F5CA 4BY1J 3I59B 1RNLA 2QQ9A 4UUTA 2OQRA 1ETWA 4HF0A 2DA7A 4HDVA 2O5RA 2WBMA 5IYBJ 2EV5A 4G8XA 2A68F 4PCQA 4RM2A 1SD4A 5L3BA 1ACIA 4B47A 5DUIA 4G6DA 1AKHB 4HRIA 3G2BA 3V8KA 3COAC 1OCRH 5M3MJ 2EFWA 2W85A 5CLSA 1VQ9I 3EPZA 1D8JA 5IT9Z 4LJZF 1ZR2A 2CQNA 1LQ1A 1T0FA 1ETKA 1N25A 2WTEA 4IHSA 4CCKA 1HSJA 1KU2A 2YSRA 3GTJJ 2CJJA 1R49A 2X0LA 1XMKA 2WV0A 2HDWA 1XG1A 4QLCU 2RNJA 3HIFA 1AOYA 2CUJA 3LAPA 1HA8A 2NS8A 1SMYF 1WJEA 3TKYA 4BHPA 3D1NI 4HSRA 5F04A 3ASNH 4II2A 1B72A 2K9QA 1YX5A 1FTTA 1FIAA 1T56A 2J5PA 2FQ3A 3S2HJ 3NWSA 5ILVA 3G1OA 4BQOA 3K4LA 4F7ZA 3CMEI 2GLOA 3ELKA 3P7NA 2DMUA 1KYWA 4B8XA 3HRSA 2DMTA 4P55A 4RGRA 2W7NA 3OSGA 3H3UA 3HOXJ 1BR1A 1OYYA 4G7ZF 4E7SA 5EYRA 2IAIA 4NC7A 3RPUD 2KIFA 2NVTJ 2HPMA 2MW8A 2KLOA 5D6FA 1N75A 2ACJA 2BXYA 3PO2J 1I3QJ 4P9UA 2ZNZA 2VASA 3CJQB 1V55H 1WSUA 3DTKA 1XD7A 2E19A 5B3SH 1POGA 2O3FA 1VZ0A 2UXXA 2HXOA 2IPQX 3GTPJ 2XSDC 2IJLA 3HSEA 3WHBA 3CC7I 4NNJA 3BY6A 3ONQA 4DGWB 3ZXSA 1ZR4A 1YRNA 4PSXA 1RC9A 1B6AA 4U87A 1SAXA 4DYRA 1ETYA 3HUGA 4CCMA 1DU0A 2K9LA 4N0BA 1HBXG 3S16J 1FBQA 2IW5A 3HRUA 3LSHA 4OIQF 1BC8C 3HOWJ 1SD7A 3S3OA 2OC6A 4E7KA 1O7LA 1SD6A 3CQZJ 2IA1A 4I09A 2V26A 2ISYA 1Z1DA 2CFXA 1W7PA 2R93J 2DO7A 4XOPA 2CV1A 1QZZA 1WI9A 4UUSA 2K3FA 4CYCA 1U8BA 5B1BH 4A3EJ 4M6VA 3NARA 1LE8A 3SZTA 4I2OA 4ZTJA 2JZYA 4Y7NJ 1ZG1A 3GEZA 1OR7C 3ZP5A 4MTEA 3BG9A 4NQWA 3A4CA 3KP7A 2NNYA 2LH9A 4Y3OA 5ICFA 5LLQA 3J81K 5EG0A 4IX7A 1REPC 2RDPA 1QO0D 1U5TB 1J9IA 3L2UA 4RGSA 4RMNA 3W6KB 2HR3A 3DBHB 2EIJH 2ZBKA 1TW2A 2VN2A 3TO9A 4WXDA 2F4OB 3SFZA 5DEQA 2W24A 3OYHA 1D3YA 2M7BA 2IEKA 2ZKZA 4FE4A 4J00A 3CDLA 3DBRB 2XHKA 3BTIA 3PUFA 3L00A 2WY7Q 4XLPF 1G3YA 3FXRA 3G71I 1HW5A 4GXOA 1IRFA 3DTIA 5HDNA 2KT0A 1B1BA 3S2WA 4IHXA 5FKLA 1IN8A 2A5YB 1G2HA 3OY9A 1JKOC 5EDNA 3M8EA 2FX0A 2E5NA 3HEFA 4MFEA 5GP9A 4MFDA 3Q5FA 3ULQB 5CVVA 3T1BA 3J81Z 1I6HJ 3KIOA 2R7UA 4KFCA 2VT3A 2E7WA 1QBJA 5CKTA 3F8MA 4ZYEA 3ABUA 4HA8A 1VQ6I 1T33A 2W4SA 1G6NA 4B48A 2P7VB 1F9NA 1X1PA 5E79C 4HX4A 3BROA 3R6SA 2F48A 1B9NA 4Y33A 2O0YA 1WFXA 2CGPA 1V5GA 3W6JB 1D1AA 4HW0A 1BN5A 2XRNA 4IHWA 2QQBA 4OAZA 2ZFUA 2VQHA 2EB7A 1P6RA 2ID3A 5HNHA 4RB3C 2NYXA 4N9IA 1W36D 2N8GA 5E3OA 2P6SA 3CUQB 3OOPA 3S93A 3V42A 1U9OA 2BE5F 1FX7A 3ECHA 3Q9SA 2W00A 5LGUA 2WWYA 1YJ9I 1ZRFA 4TV7A 4IOAF 1K78B 2XGCA 3QYEA 3I55I 2F2EA 4UUVA 2VL8A 2CO5A 4BJTA 2Y69H 3O6BB 1K61A 5EEGA 3ZMDA 3GTKJ 5TRDA 3SDGA 4HEA2 2CQ7A 5ICCA 3TO7A 4ZYDA 4YFXF 5B66C 3CJNA 1JGGA 5LFAA 2P81A 4NDLA 1R71A 2V6EA 3FXUA 3JR9A 4Q47A 1U2WA 3F6OA 3HG9A 5FKNA 2V4JC 2VBYA 3KZYA 2MD5A 3IP4B 5J1YA 2MFZA 3ZMVA 2XAHA 3G73A 5KAIC 4J19A 3KEYA 4FASD 1RI7A 3BG3A 3JRAA 3CUQA 3S3MA 3EYIA 3GFJA 4HBLA 3KP6A 1YX3A 3VYTB 1R6RA 3K2AA 2F5DA 4CUGA 4UV8A 3CF5F 2EFNA 4AD9A 4GGGA 3PUBA 1TBXA 5HLGA 9ANTA 1GV5A 3DU5A 2G7HA 4IHVA 3S17J 3FHNA 2EPFA 3BPVA 3E6MA 2OU2A 4M9SA 2JN6A 2A07F 1SVOA 2YU3A 3SYTA 2HTSA 3K1NA 4PK4A 2RVCA 3FIWA 1H9GA 3LA3A 2DDBA 4CSWA 4IRGA 3DEUA 3JSPA 2DT5A 5BQTA 1OKRA 4UV9A 3TBIA 4XLAA 1SFOJ 1X4OA 2DFIA 3HPHA 3P5JA 2CRGA 5K7ZA 1I3AA 4RAFA 2X48A 1ORKA 2UWMA 2X1EA 1W4MA 4EGZA 4E4HA 1YW9A 2A6EF 1XN7A 3KETA 2KJCA 1DPRA 3SHFA 2HKXA 4ABZA 2ETHA 4E6KG 3QYFA 2XDVA 1IRGA 3G1MA 2EK5A 3WU2C 2IP2A 2KIQA 3B02A 3BR5A 1PVEA 2GAUA 3BTLA 3DEEA 5DD8A 2QEXI 3E5QA 1R4MB 3HC7A 4OMYA 3ZCOA 4A2UA 2MLKA 1GVDA 4OAYA 2DA2A 3BDDA 3F8BA 1JJ8C 5F1JA 2VOPA 3I53A 1E2XA 3PSIA 3IRQA 3HRMA 2FXAA 2IBDA 4HNVA 1JXSA 3NEUA 2ZXHA 3BTCA 3OR1C 1Z9CA 5F08A 2BYVE 4L5IA 2BW3B 3O2PE 1MNDA 1VQNI 2DN0A 1OCZH 4EV0A 1LKXA 5LHIA 2NVXJ 1V5FA 1IW7F 2K7LA 1HW1A 4G12A 2F4IA 3QODA 3KEOA 4HLYA 2Y2ZA 4ZJZA 2IXSA 5EGOA 2R5ZA 1BW5A 3GO5A 2L9NA 4CCOA 3WTXC 2YX7A 1VNDA 5A2QK 1FOYA 3JRBA 1IDYA 4BL0B 2PJRA 4C2TA 1Y39A 2JSPA 3K6GA 2STTA 5EZHA 1TNTA 2OPTA 3MZHA 1T8IA 2E35A 2O8KA 1TQPA 2L02A 2M8EA 4AIKA 4IHYA 2NNNA 4HSTA 1YG2A 3KP4A 2PN6A 2W57A 4V2GA 1W0TA 4DYCA 3OYGA 1DDNA 3HL2A 4R79A 2OCEA 4GYGA 4CHUA 2FRHA 2MABA 2I5UA 1WRJA 2HVQA 3JRGA 1UZCA 2X6OA 2OAZA 4ENMA 3JRFA 2KP6A 3PJRA 3D5SC 2P0WA 2Y9YA 1T2KA 3M1EA 4XM3A 3EQLF 4DNCA 3EETA 2R5ZB 1SANA 3K10A 1ONVA 2H6BA 3NWTA 1LDJA 2EZIA 4P1WA 5J8CA 4IVNA 3BR3A 2MBFA 4RA2A 2JT1A 2LKXA 3IRRA 3F6VA 2VBZA 1LVKA 3OIQA 1TP4A 2DJNA 4FISA 3R0JA 3I9V2 1U6GA 3LA7A 2Z2SB 3F8FA 3LQRA 3FHZA 1EA3A 4JQFA 1YJWI 3W6VA 3TL4X 1Y56A 3CESA 2Y9ZA 2VQGA 3VSKA 4JOMA 2FBKA 1OCTC 3GCMA 1YS6A 2CG4A 3P9KA 4IL6C 2DTZA 4LIUA 2DYSH 4PJ0C 2JUGA 3L2RA 1R00A 1R1UA 5BOXA 3DPUA 2JA6J 4A3CJ 1FOWA 2F5VA 2PI0A 1ZN2A 2LNBA 1YIOA 4D5CA 3WGIA 2H27A 1IN6A 2Y48A 1LDKB 3VODA 4FE7A 3HOYJ 2EFOA 2VONA 1HDDC 4AIJA 5FD6A 1VFCA 5FKOA 1TWGJ 2P4WA 2VQCA 4RLQA 2E2IJ 1TWFJ 5JVGF 4HQMA 2V9PA 5HS7A 3V8JA 1BR4A 4KMFA 2L7ZA 4XN0A 3LSJA 5J1RA 3KFWX 2VXDA 3G4SI 1FOXA 2KPMA 4CZCA 2R7WA 3EYYA 4G6TB 4RS8A 3LWFA 4P5OA 3BG7A 1MBHA 1I1SA 2M8GX 1X19A 4XSXF 2DDAA 3MKZA 2DAOA 2M34A 3KE2A 1ZG5A 2E2JJ 4A0ZA 4LMYA 5CYVA 3BR0A 4YFKF 1X3WB 2E1MC 1G4DA 3H5RA 1HLVA 3L2QA 5LEKA 4RGXA 1P4XA 1WI3A 2FE3A 2Y0MA 3OIPA 1K79A 2HGCA 2BHZA 1BOBA 4LITA 2H09A 5E17F 3KP2A 3KX2A 1FLIA 3JAMZ 5L3EA 3ZQGA 3RKYA 2DPUA 4UVBA 4JBAA 3DXJF 5J1UA 2MLGA 1X1CA 4BACA 2DLLA 2QM3A 3LMMA 4EJUA 2ISZA 4MQ9F 4XLEA 2VODA 2KJBA 2EV6A 5CPRB 2HZDA 5TGTA 3Q0UA 3DF8A 1L3LA 1I50J 3JREA 5J4VA 3MD2A 1Z21A 4CYDA 1YFHA 3HSRA 3AAFA 2ZXJA 2H1KA 1JUMA 1USSA 2AHQA 1YLFA 4A6EA 5B5EC 3F0CA 2RKHA 5CVRA 3CCYA 1KQ8A 2EZHA 5ILUA 2VBXA 3GX4X 1PUFA 1DPUA 3W2AA 2DA4A 2PMUA 4O6JA 2G7UA 2VPLA 2L7KA 4AYBA 2LBFA 4UVAA 4LIVA 2JVHA 2O8XA 3BG5A 2GM4A 2HYGD 2RQQA 2MH2A 3A0HC 2OUMA 1JTXA 2YS9A 2JVGA 4MEYF 1YJNI 5J40A 3I64A 3LSIA 1K78A 2MC3A 2HVSA 2VB6A 1HCRA 1ZARA 4U0WA 3QPTA 3HZJA 4FHTA 2IVMA 2ELKA 2VE8A 3PFYA 4AC0A 2BVLA 2RAEA 2M0MA 3GWZA 1YW7A 1RKWA 2FF4A 1FJLA 1EJ9A 2M3AA 1MNMC 2XF7A 2UUZA 1HF0A 1W7PB 2BV6A 3LFKA 1DGRM 2LD5A 1UFMA 4B3XA 5J47A 3WTUC 4D0PA 3WU1B 3DLLF 2ZMEB 1W5CC 2IRFG 5AONA 2BBYA 1YS7A 3DKWA 1R22A 1ZRDA 2ECCA 3LAJA 4M72A 3I58A 3JW4A 5K5QA 4YFNF 2L9VA 4BS9A 3HDDA 1OR7A 5JI6A 3N4MA 2PQ8A 2VJIA 3PNTA 3LSRA 3ERMA 4I02A 3C2BA 1FYKA 4B1RA 4AU7A 1IGNA 1UCRA 2ZXWH 2JRTA 3I3LA 2COBA 4RM3A 2FNPA 3HOSA 4GDFA 4ZDPA 3S15J 3AG2H 2HWVA 1OQYA 4I99C 2GA2A 2PMHA 2EQRA 1R5GA 1W7PD 1T98A 5GAEJ 4ESFA 1ZGJA 2GXGA 1S9HA 1X58A 4KICA 2E60A 4D1QA 4C2UA 2CQKA 3IHUA 4D7MA 3EUAA 5EEHA 2HVRA 2EZLA 3VB2A 1JUPA 3ZQHA 5K7HA 3RZOJ 2OBPA 3E97A 2H6CA 3WHCA 1H0MA 1MSEC 1PUFB 3QOPA 4AIHA 3NRVA 1J5YA 4A0XA 1O4XA 3BJOA 3L2WA 5GPCA 2DPDA 4C3HJ 3RJPA 1J75A 2IGNA 1KYZA 1C0WA 1FSEA 4PJMA 5FFZA 1JJ6C 4BQNA 3CD6I 2WY8Q 3D5LA 1XTAA 2GWRA 2KFDA 2XC7A 5IYDJ 1SFKA 3BLYA 2CQXA 3WE2A 3AL0B 2QCOA 3K4KA 3Q0VA 4Y52J 3I0TA 3RTRA 2O61A 5FLXZ 3DKXA 2L01A 5ILSA 3GZ6A 1LEAA 2O03A 4BAYA 3V7RA 3PFIA 5CQEA 3TO6A 2M0CA 3I4PA 2KIUA 1WJBA 3L09A 1R1VA 2L4AA 4MO7A 2L3DA 4W1UA 2MYSA 2HYFA 3H3ZA 1KU3A 4HPQA 2R7QA 4PFOA 3VSLA 4HV6A 4HZFA 2PMZA 2CU7A 2XSJC 1IG7A 1VQ7I 2R4GA 4U0YA 3CC2I 3OYDA 3UNGC 2FU4A 4OIOF 2KZVA 3SXYA 1VQLI 3GFIA 1FP1D 4LG3A 4HQEA 2FUG2 1RUNA 1ON2A 2VKEA 1TT5B 4YIRX 3ZMTA 3V7CA 1MDMA 2IA2A 2XVCA 4BBRJ 2RGVA 2HXIA 1P7JA 3B6CA 3BCBA 1DP3A 3H36A 5LRSA 2W48A 2VJ5A 3FMQA 2GXAA 3SFIA 3H1CA 4YG2F 2HZTA 2W25A 3DBLB 3A1YA 3QPLA 4GCVA 4JK1X 4PFPA 5L3FA 4PJNA 4IKFA 1K83J 3G1LA 3F8CA 1EH8A 3CUQC 2XAGA 1F5TA 2WB1N 2JPBA 1J7KA 2QQ8A 2GBYA 1V54H 5FFXA 2A6TA 2JJ7A 2R7FA 3E3VA 1I1GA 2K9NA 2VUMJ 4L9VA 4NUBA 2DFHA 4XR6A 1XX5A 5E8GA 2HYJA 4MTDA 2JA2A 3Q3SA 3H9JA 1NK2P 2IT0A 4WK8F 3CO6C 4DW6A 1S6LA 1VQKI 5D8KB 1IXRC 2E1NA 4OWRB 2V9KA 1TWHJ 4XBFA 1O3SA 1I5ZA 1Z6TA 1WWXA 4R8HA 1FYMA 1LFBA 1SMTA 5IY5H 2YPRA 4EM0B 3DLAA 2B0LA
chains in the Genus database with same CATH topology
4LK0F 3GUDA 3E5UA 4EM2A 1O3TA 3V7SA 3GLXA 1IXSB 1BBYA 4KIBA 1T38A 5D4SA 2KRFA 4EJVA 3TQNA 3KLOA 2AS5F 1OPCA 1CF7B 2XAFA 1FYLA 2P6TA 4I01A 5HS9A 2D1HA 5LEJA 1YYVA 2FEZA 4A6DA 1F4KA 1W5SA 4LD5A 3U2RA 5ERIA 2FA5A 3T8RA 1U8RA 1WQ2A 5H20A 3LSTA 5DYMA 4LG0B 2DQRA 3IWFA 4P96A 3GXOA 1D5VA 3GYHX 1TQMA 4O5VA 2XUBA 4EJOA 2ZNYA 1IAWA 3I59A 5L3DA 1G3WA 1BI2A 4ON0A 5J6XA 3WTTC 1O3RA 2HDCA 4LK1F 2EFPA 1O7FA 3HOTA 1LVAA 3MZYA 2HQNA 2P5VA 4G7OF 3T0YA 3TGNA 4KDPA 2X4HA 1S29A 3CO7C 5JR3A 3R4KA 4LLNA 4UNOA 5HLHA 1OMIA 4U88A 3DP7A 5HLIA 5D6EA 2HEOA 2D2WA 3KZZA 1S8NA 4RB0A 2NRAC 4MNUA 4U0VA 5DCMB 3HHHA 3MWMA 4I0AA 2XIGA 3QP5A 4OOIA 1FWZA 2FBIA 4KT5C 1LEBA 2MH9A 5BPDA 1KGSA 3CTAA 3P9IA 3RKWA 4LFUA 1XDSA 4B09A 4MGRA 1JHFA 1LB2A 5LRRA 3I71A 2DK8A 4RGUA 3FWEA 4KYWA 5JFRA 4Q4ZF 4KUMA 3NQOA 2JPCA 5IT3A 3E6BA 2M45A 1U3EM 5LHGA 1FOKA 3BJ6A 5E1ZB 1TLHB 3L2CA 4K2EA 4UVCA 3TDUC 5F6FA 4Q5SF 2Z3YA 3JSOA 2L4MA 3N97A 1EH6A 1PP7U 4AWXB 2DBBA 1FC3A 2AXLA 2LSOA 3QU6A 3E6CC 3I54A 2QUFA 1BI0A 3BOQA 4CXFA 1ZREA 3QPHA 1P92A 2K27A 3ROUA 1RIOH 4FX0A 4MEXF 3G3ZA 3PQKA 2VBWA 4M6YA 2OZUA 1B4AA 5JHUA 5HDGA 3IL2A 1FNNA 4A12A 4EJWA 2P5KA 6PAXA 1J2XA 4GO1A 1MD0A 4LLGF 1R7JA 1SFEA 1FY7A 2A6HF 5FD5A 1HKSA 3ISPA 4A5MA 2J5OA 2HQRA 3RPUA 2XKPA 1KU9A 2XGXA 2Y75A 1E17A 2R7DA 2LF7A 1XGMA 2RC4A 5LGTA 3ZQ7A 1BIBA 4HX7A 2ZFWA 1XSXA 3ZMZA 4ZYGA 2DK5A 2E7XA 2HFHA 5HVQC 2G9WA 2ELHA 5BMZA 3BPXA 1U5TC 2COMA 1GVJA 2NS0A 4M74A 1PDNC 4M9ZA 3VOEA 4R1HA 2DU9A 1XGNA 4OU0A 3P9CA 4IRIA 2CYYA 1GHCA 3JTHA 5FGMA 4OMZA 1ZLJA 4LGWA 4G6QA 3DV8A 3BWGA 3QAHA 5KVRA 2HTJA 2D45A 4RB1A 2Z9OA 4EMSA 1P4AA 2ESNA 1BIAA 5H6RA 2V9VA 1DP7P 2K4JA 3MEXA 4L18B 1KQ9A 3VEPA 4BH9A 3K2ZA 2STWA 5ICGA 2JTVA 4KN4X 1MJBA 4WX9A 4L9TA 1TQIA 2Z33A 2KKOA 4I98B 2UZKA 1IN4A 1QGPA 4YIFA 2DI3A 4WXHA 4IJAA 1DUXC 3WTWC 4EGYA 3WODF 2PFBA 1T39A 2XAQA 2QLZA 2M5WA 3V8LA 4I7HA 3ECOA 4BNCA 1U5TA 1USTA 2OQGA 4ENKA 1YW8A 2EA4A 1GXPA 1Z91A 4ETSA 4HF1A 1L0OC 3QRFF 1GXQA 2QZ8A 3DQVC 2WC2A 3WTVC 2FOKA 1BM9A 5BPIA 2LDUA 4OINF 4CDGA 1F1ZA 1S7OA 4HOBA 3SZPA 1KQ0A 2EV0A 3HTUA 2HS5A 1ZYRF 4ASNA 4GYIA 2PJPA 1ZH5A 1X3UA 2V1DA 3TDZC 1D8KA 1W5TA 5E18F 4M71A 5F1RA 3CDHA 2H94A 1P2FA 2Q0OA 2CW0F 3QP6A 1IN5A 1T6SA 4IF4A 1BI1A 3C7JA 5F64A 2KIMA 4CO8A 3F3XA 2DTRA 2W84A 1FP2A 1V4RA 5D5VB 4M73A 4L9JA 3J7AO 3F22A 2FNAA 4CZZA 3MCZA 3M7GA 3FM5A 2GA1A 1ULYA 1OYIA 4XSZF 4U7DA 3WGGA 5D5UB 4L9NA 3BJAA 2EWNA 2K4BA 3U1DA 3GFMA 4EQQA 4HF2A 3H92A 2QBYB 5CVJA 1QPMA 1CGPA 2VT2A 2O6GE 3KCCA 2L54A 5AIPA 1MGTA 3FM3A 5CJ9A 3RI4A 3I5UA 1PP8F 1Z6RA 2LF8A 3D0SA 2PBIA 2XKOA 1SD5A 3IWZA 4ENNA 2K02A 2JSCA 4PGHA 1EH7A 4LG0A 5L3CA 5E1WA 4PDKA 2ZMEA 1UHWA 2VC1A 1S3JA 3RYPA 1JE8A 2BEOA 2FSWA 3HYIA 5D4RA 2LKPA 2VC0A 5DDGA 5L3GA 2BGCA 2HKOA 3R60A 2YR2A 3U9GA 2QYOA 2XROA 3HSFA 3DFGA 4MHGA 1IZ1A 5LHHA 1XCVA 4CICA 4S04A 5LBQA 4XRFA 1XMAA 4DQ2A 1UB9A 2TDXA 1FBSA 3TOBA 1XSVA 3PQJA 2Z5UA 4QWQA 2ZO4A 1YTYA 4N9HA 1V3FA 4UHTA 2V6CA 4RAYA 1KA8A 2V1UA 2V1XA 4P9FA 2Q8KA 1XSDA 1JGSA 2EJRA 3L7WA 1BC7C 3ERED 5DD4A 3HTSB 1HKTA 4UXNA 4LLLA 1XCBA 3CLOA 1LNWA 3BZ6A 3GZ5A 2IA0A 1AWCA 2F5FA 4I0BA 3GW2A 2CWEA 2RQPA 5DCFA 4ZZDA 2QENA 2ZJ2A 1VTNC 1BOAA 4RB2C 4L0YB 1Z05A 1RUOA 2NAZA 2GZWA 3MQ0A 4G94A 1KU7A 1MKMA 2GXBA 1SFXA 4LB5A 1XGOA 1QNTA 1ZG3A 3WTYC 3ZN0A 1RZ4A 4NB5A 2C6YA 2FBHA 1SFUA 5D8LB 3E5XA 2QQAA 3F21A 1R36A 2ADUA 2GIVA 5LGNA 2M30A 1LJ9A 1PUEE 4MQVA 4A0YA 1R1TA 4KMUX 2D1VA 2MA3A 3LA2A 5K5OA 3SQNA 3WG9A 1H9TA 4HV5A 3KP5A 3TOAA 1IF1A 1R5HA 3VFZA 1R23A 1K6OA 3EUHA 3K1MA 4EJTA 2VXZA 4G9YA 2P5LC 4ESJA 1R58A 3WE3A 3R61A 1YQAA 3FMSA 5JVTA 5HDKA 2QWWA 3WTSC 1ZGAA 3GFLA 1ZRCA 2V79A 4HAMA 3M8FA 4E70A 3IC7A 4FX4A 4Q48A 2XASA 4S05A 1IN7A 4M9XA 1HKQA 2OD5A 5E20A 1ZHFA 2M87A 3J80Z 2RV8A 3RIRA 1ODDA 1STZA 3T5XA 2RN7A 4ZZLA 4M6XA 5E1XA 5DUKA 4BYYA 2ZCWA 2F5EA 3RKXA 2PG4A 3OV8A 1FZPB 4IHTA 1I6XA 3REOA 1ZLKA 2QVOA 2PLYA 1ZAOA 4KA4A 4AVPA 3LQQA 1FPQA 4H0EA 4HLXA 1FT9A 1O57A 1MJAA 5HOOA 1HQCA 4YIIA 4Y17A 3WU0A 3K69A 1XDUA 3HRTA 3ZPLA 4IPAA 3GF2A 4Y15A 3L9FA 3DPTA 4OIRF 4BHCA 4ESBA 1EV7A 4HX8A 5E8IA 3FX3A 5A2QZ 1XB4A 1OYWA 4Y13A 4CGZA 3IKVA 2EFQA 5HS8A 1O3QA 1BI3A 2A69F 1IUYA 1I27A 3BP8A 1S7AA 2EA2A 5DCMA 2GQQA 3RDIA 5FB2A 3MFKA 2DQLA 1FSHA 3K0LA 1NHAA 4FT8A 2FMLA 5FLXK 2Q2EA 1MDMB 1P4WA 1J0RA 1K7AA 4RAZA 5BS6A 4EVIA 3F72A 4NHJA 1G3SA 4G7HF 4WXCA 1CF7A 3JAMK 3T8TA 3ZMSA 4KIGA 2M1BA 4ENJA 4O3MA 1Z7UA 3M9AA 1JHHA 3O3KA 1B59A 1YO5C 3HHGA 5H6QA 2QBYA 1TW3A 3RPQA 2PEXA 3F23A 4IXAA 3B73A 5FO5A 2A3SA 3EDPA 1Q1HA 2OZ6A 2VE9A 4PZJA 3ML6A 1WKMA 1HSTA 1BJAA 4KIFA 1HW2A 1UHMA 4KN7X 3GVAA 4LB6B 1MZBA 3ZN1A 3F8NA 4ZYHA 1TTYA 1TNSA 4U7BA 2ESHA 3MAJA 1IXCA 1ON1A 4BXUA 5K5RA 3KEQA 1J59A 2OA4A 5K1YA 2HOEA 3CUOA 2R3SA 3C3WA 3FMRA 1FBUA 3C1DA 4OIPF 4IRHA 2E1CA 2A61A 2P7CB 4XLNF 5TJJA 1MJ9A 2VOOA 1QZYA 5CVIA 2YX4A 5AIQA 2Z99A 3DPLC 1LDDA 5ED4A 3ABTA 4L5JA 4KNYA 3KP3A 5ICEA 3FZVA 4PGGA 4L0ZB 4ZH4F 3R0AA 1Y0UA 1B9MA 5KK1A 3J80K 4Z2YA 4BQAA 3E6DA 3K1PA 4WCGA 4EM1A 1G3TA 5DV5A 2XV4S 2CSOA 4WWCA 3RYRA 5D5XB 1A04A 3WTZA 2UXNA 3WGHA 3JTGA 1XGSA 2DW4A 2P8TA 3FXQA 1U78A 4BHBA 1QQIA 3Q9VA 3IKTA 4HYEA 5D5WB 3K9TA 4HDUA 3C18A 2FMYA 3FF5A 5CVUA 4A5NA 2XAJA 4WF2A 5J8FA 3V4GA 3ZMUA 3KLNA 1HXDA 2K86A 3QU3A 2F5CA 3I59B 1RNLA 2QQ9A 2OQRA 4HF0A 4HDVA 2EV5A 4G8XA 2A68F 4PCQA 1SD4A 5L3BA 5DUIA 4G6DA 3V8KA 3COAC 2EFWA 2W85A 5CLSA 1D8JA 5IT9Z 4LJZF 1LQ1A 1T0FA 2WTEA 4IHSA 1HSJA 1KU2A 2YSRA 2X0LA 1XMKA 2WV0A 4QLCU 2RNJA 3HIFA 1AOYA 3LAPA 1SMYF 3TKYA 4BHPA 2J5PA 2FQ3A 5ILVA 4F7ZA 3ELKA 3P7NA 1KYWA 4B8XA 3HRSA 4P55A 4RGRA 3H3UA 1OYYA 4G7ZF 2KIFA 5D6FA 2ACJA 4P9UA 2ZNZA 1WSUA 1XD7A 2O3FA 2UXXA 2IPQX 2IJLA 3HSEA 3BY6A 1B6AA 1SAXA 3HUGA 4N0BA 1HBXG 1FBQA 2IW5A 3HRUA 4OIQF 1BC8C 1SD7A 1O7LA 1SD6A 2IA1A 4I09A 2ISYA 1Z1DA 2CFXA 1W7PA 2DO7A 1QZZA 1WI9A 3SZTA 4I2OA 2JZYA 1ZG1A 3GEZA 3ZP5A 4MTEA 4NQWA 3KP7A 2NNYA 5ICFA 5LLQA 1REPC 3J81K 2RDPA 1QO0D 1U5TB 1J9IA 4RGSA 3W6KB 2HR3A 2ZBKA 1TW2A 2VN2A 3TO9A 4WXDA 3SFZA 5DEQA 2W24A 1D3YA 2ZKZA 2XHKA 3L00A 4XLPF 1G3YA 3FXRA 1HW5A 4GXOA 1IRFA 5HDNA 1B1BA 3S2WA 1IN8A 2A5YB 3M8EA 3Q5FA 3ULQB 5CVVA 3T1BA 3J81Z 4KFCA 2VT3A 2E7WA 1QBJA 3F8MA 4ZYEA 3ABUA 4HA8A 1G6NA 2P7VB 1F9NA 4HX4A 3BROA 3R6SA 1B9NA 2O0YA 2CGPA 3W6JB 4HW0A 1BN5A 2XRNA 2QQBA 2EB7A 1P6RA 4RB3C 2NYXA 4N9IA 2P6SA 3CUQB 3OOPA 2BE5F 1FX7A 2WWYA 3ECHA 3Q9SA 5LGUA 1ZRFA 4TV7A 1K78B 2F2EA 4UUVA 2CO5A 3O6BB 5EEGA 3ZMDA 5TRDA 5ICCA 3TO7A 4ZYDA 4YFXF 3CJNA 3FXUA 4Q47A 1U2WA 3F6OA 2VBYA 3KZYA 2MD5A 3ZMVA 2XAHA 3G73A 1RI7A 3EYIA 3CUQA 3GFJA 4HBLA 3KP6A 2F5DA 4UV8A 2EFNA 4AD9A 4GGGA 1TBXA 5HLGA 2G7HA 3BPVA 3E6MA 2OU2A 4M9SA 2A07F 2YU3A 2HTSA 3K1NA 2RVCA 1H9GA 3LA3A 4IRGA 3DEUA 3JSPA 2DT5A 5BQTA 1OKRA 4UV9A 2DFIA 2UWMA 4EGZA 1W4MA 1YW9A 2A6EF 1XN7A 3KETA 2KJCA 1DPRA 3SHFA 2HKXA 2ETHA 1IRGA 2EK5A 2IP2A 3B02A 2GAUA 5DD8A 3E5QA 4OMYA 4A2UA 2MLKA 3BDDA 3F8BA 2VOPA 3I53A 1E2XA 3IRQA 3HRMA 2FXAA 1JXSA 3NEUA 1Z9CA 2BYVE 4L5IA 3O2PE 4EV0A 5LHIA 1IW7F 2K7LA 1HW1A 3KEOA 4HLYA 3GO5A 3WTXC 2YX7A 5A2QK 2STTA 1TNTA 3MZHA 1TQPA 2L02A 2M8EA 4AIKA 2NNNA 1YG2A 3KP4A 2PN6A 2W57A 1DDNA 4R79A 4GYGA 4CHUA 2FRHA 1WRJA 2OAZA 4ENMA 1T2KA 3M1EA 3EQLF 4DNCA 3EETA 1ONVA 2H6BA 1LDJA 5J8CA 4IVNA 2MBFA 2JT1A 3IRRA 3F6VA 2VBZA 3R0JA 1U6GA 3LA7A 3F8FA 3LQRA 3FHZA 4JQFA 2FBKA 1YS6A 2CG4A 3P9KA 5BOXA 1R00A 1R1UA 2PI0A 1ZN2A 2LNBA 1YIOA 3WGIA 2H27A 1IN6A 2Y48A 1LDKB 3VODA 2EFOA 2VONA 4AIJA 5FD6A 2P4WA 4HQMA 5HS7A 3V8JA 4KMFA 3KFWX 3EYYA 4RS8A 3LWFA 4P5OA 1I1SA 4XSXF 2DAOA 1ZG5A 3KE2A 4A0ZA 4LMYA 5CYVA 4YFKF 1G4DA 5LEKA 4RGXA 1P4XA 2FE3A 2Y0MA 1K79A 2HGCA 2H09A 5E17F 3KP2A 1FLIA 3JAMZ 5L3EA 3RKYA 2DPUA 4UVBA 4JBAA 3DXJF 2MLGA 2DLLA 2QM3A 4EJUA 2ISZA 4MQ9F 2VODA 2KJBA 2EV6A 3DF8A 1L3LA 4CYDA 1YFHA 3HSRA 3AAFA 2ZXJA 1USSA 1YLFA 4A6EA 2RKHA 5CVRA 1KQ8A 5ILUA 2VBXA 3GX4X 1DPUA 2PMUA 4O6JA 2G7UA 4UVAA 2O8XA 2HYGD 2MH2A 4MEYF 3I64A 1K78A 2MC3A 1ZARA 4U0WA 3QPTA 4FHTA 2IVMA 2VE8A 3GWZA 1YW7A 2FF4A 1W7PB 2BV6A 3LFKA 1UFMA 3WTUC 4D0PA 3WU1B 2ZMEB 2IRFG 5AONA 2BBYA 1YS7A 3DKWA 1R22A 1ZRDA 3LAJA 4M72A 3I58A 3JW4A 5K5QA 4YFNF 1OR7A 5JI6A 3N4MA 2PQ8A 4I02A 1FYKA 1UCRA 2JRTA 3HOSA 2FNPA 2HWVA 2GA2A 2PMHA 1R5GA 1W7PD 1T98A 4ESFA 1ZGJA 2GXGA 4KICA 2CQKA 3IHUA 5EEHA 3VB2A 2OBPA 3E97A 2H6CA 1H0MA 3QOPA 4AIHA 3NRVA 1J5YA 4A0XA 3BJOA 2DPDA 3RJPA 1J75A 1C0WA 1KYZA 1FSEA 5FFZA 3D5LA 2GWRA 3WE2A 3I0TA 3RTRA 2O61A 5FLXZ 2L01A 5ILSA 3GZ6A 1LEAA 2O03A 4BAYA 3V7RA 3PFIA 3TO6A 3I4PA 2KIUA 3L09A 1R1VA 2L4AA 2L3DA 2HYFA 3H3ZA 1KU3A 4HV6A 4HZFA 4U0YA 2FU4A 4OIOF 3SXYA 3GFIA 1FP1D 4HQEA 1RUNA 1ON2A 3ZMTA 3V7CA 1MDMA 2IA2A 2XVCA 2RGVA 5LRSA 3FMQA 4YG2F 2HZTA 2W25A 5L3FA 4GCVA 4JK1X 5IT9K 3F8CA 1EH8A 3CUQC 2XAGA 1F5TA 2JPBA 1J7KA 5FFXA 2R7FA 3E3VA 1I1GA 4L9VA 5E8GA 4MTDA 2IT0A 4WK8F 3CO6C 1S6LA 5D8KB 1IXRC 2E1NA 4XBFA 1O3SA 1I5ZA 1Z6TA 1WWXA 4R8HA 1FYMA 1SMTA 2YPRA 4EM0B 2B0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK0 F;  3GUD A;  3E5U A;  4EM2 A;  1O3T A;  3V7S A;  3GLX A;  1IXS B;  1BBY A;  4KIB A;  1T38 A;  5D4S A;  2KRF A;  4EJV A;  3TQN A;  3KLO A;  2AS5 F;  1OPC A;  1CF7 B;  2XAF A;  1FYL A;  2P6T A;  4I01 A;  5HS9 A;  2D1H A;  5LEJ A;  1YYV A;  2FEZ A;  4A6D A;  1F4K A;  1W5S A;  4LD5 A;  3U2R A;  5ERI A;  2FA5 A;  3T8R A;  1U8R A;  1WQ2 A;  5H20 A;  3LST A;  5DYM A;  4LG0 B;  2DQR A;  3IWF A;  4P96 A;  3GXO A;  1D5V A;  3GYH X;  1TQM A;  4O5V A;  2XUB A;  4EJO A;  2ZNY A;  1IAW A;  3I59 A;  5L3D A;  1G3W A;  1BI2 A;  4ON0 A;  5J6X A;  3WTT C;  1O3R A;  2HDC A;  4LK1 F;  2EFP A;  1O7F A;  3HOT A;  1LVA A;  3MZY A;  2HQN A;  2P5V A;  4G7O F;  3T0Y A;  3TGN A;  4KDP A;  2X4H A;  1S29 A;  3CO7 C;  5JR3 A;  3R4K A;  4LLN A;  4UNO A;  5HLH A;  1OMI A;  4U88 A;  3DP7 A;  5HLI A;  5D6E A;  2HEO A;  2D2W A;  3KZZ A;  1S8N A;  4RB0 A;  2NRA C;  4MNU A;  4U0V A;  5DCM B;  3HHH A;  3MWM A;  4I0A A;  2XIG A;  3QP5 A;  4OOI A;  1FWZ A;  2FBI A;  4KT5 C;  1LEB A;  2MH9 A;  5BPD A;  1KGS A;  3CTA A;  3P9I A;  3RKW A;  4LFU A;  1XDS A;  4B09 A;  4MGR A;  1JHF A;  1LB2 A;  5LRR A;  3I71 A;  2DK8 A;  4RGU A;  3FWE A;  4KYW A;  5JFR A;  4Q4Z F;  4KUM A;  3NQO A;  2JPC A;  5IT3 A;  3E6B A;  2M45 A;  1U3E M;  5LHG A;  1FOK A;  3BJ6 A;  5E1Z B;  1TLH B;  3L2C A;  4K2E A;  4UVC A;  3TDU C;  5F6F A;  4Q5S F;  2Z3Y A;  3JSO A;  2L4M A;  3N97 A;  1EH6 A;  1PP7 U;  4AWX B;  2DBB A;  1FC3 A;  2AXL A;  2LSO A;  3QU6 A;  3E6C C;  3I54 A;  2QUF A;  1BI0 A;  3BOQ A;  4CXF A;  1ZRE A;  3QPH A;  1P92 A;  2K27 A;  3ROU A;  1RIO H;  4FX0 A;  4MEX F;  3G3Z A;  3PQK A;  2VBW A;  4M6Y A;  2OZU A;  1B4A A;  5JHU A;  5HDG A;  3IL2 A;  1FNN A;  4A12 A;  4EJW A;  2P5K A;  6PAX A;  1J2X A;  4GO1 A;  1MD0 A;  4LLG F;  1R7J A;  1SFE A;  1FY7 A;  2A6H F;  5FD5 A;  1HKS A;  3ISP A;  4A5M A;  2J5O A;  2HQR A;  3RPU A;  2XKP A;  1KU9 A;  2XGX A;  2Y75 A;  1E17 A;  2R7D A;  2LF7 A;  1XGM A;  2RC4 A;  5LGT A;  3ZQ7 A;  1BIB A;  4HX7 A;  2ZFW A;  1XSX A;  3ZMZ A;  4ZYG A;  2DK5 A;  2E7X A;  2HFH A;  5HVQ C;  2G9W A;  2ELH A;  5BMZ A;  3BPX A;  1U5T C;  2COM A;  1GVJ A;  2NS0 A;  4M74 A;  1PDN C;  4M9Z A;  3VOE A;  4R1H A;  2DU9 A;  1XGN A;  4OU0 A;  3P9C A;  4IRI A;  2CYY A;  1GHC A;  3JTH A;  5FGM A;  4OMZ A;  1ZLJ A;  4LGW A;  4G6Q A;  3DV8 A;  3BWG A;  3QAH A;  5KVR A;  2HTJ A;  2D45 A;  4RB1 A;  2Z9O A;  4EMS A;  1P4A A;  2ESN A;  1BIA A;  5H6R A;  2V9V A;  1DP7 P;  2K4J A;  3MEX A;  4L18 B;  1KQ9 A;  3VEP A;  4BH9 A;  3K2Z A;  2STW A;  5ICG A;  2JTV A;  4KN4 X;  1MJB A;  4WX9 A;  4L9T A;  1TQI A;  2Z33 A;  2KKO A;  4I98 B;  2UZK A;  1IN4 A;  1QGP A;  4YIF A;  2DI3 A;  4WXH A;  4IJA A;  1DUX C;  3WTW C;  4EGY A;  3WOD F;  2PFB A;  1T39 A;  2XAQ A;  2QLZ A;  2M5W A;  3V8L A;  4I7H A;  3ECO A;  4BNC A;  1U5T A;  1UST A;  2OQG A;  4ENK A;  1YW8 A;  2EA4 A;  1GXP A;  1Z91 A;  4ETS A;  4HF1 A;  1L0O C;  3QRF F;  1GXQ A;  2QZ8 A;  3DQV C;  2WC2 A;  3WTV C;  2FOK A;  1BM9 A;  5BPI A;  2LDU A;  4OIN F;  4CDG A;  1F1Z A;  1S7O A;  4HOB A;  3SZP A;  1KQ0 A;  2EV0 A;  3HTU A;  2HS5 A;  1ZYR F;  4ASN A;  4GYI A;  2PJP A;  1ZH5 A;  1X3U A;  2V1D A;  3TDZ C;  1D8K A;  1W5T A;  5E18 F;  4M71 A;  5F1R A;  3CDH A;  2H94 A;  1P2F A;  2Q0O A;  2CW0 F;  3QP6 A;  1IN5 A;  1T6S A;  4IF4 A;  1BI1 A;  3C7J A;  5F64 A;  2KIM A;  4CO8 A;  3F3X A;  2DTR A;  2W84 A;  1FP2 A;  1V4R A;  5D5V B;  4M73 A;  4L9J A;  3J7A O;  3F22 A;  2FNA A;  4CZZ A;  3MCZ A;  3M7G A;  3FM5 A;  2GA1 A;  1ULY A;  1OYI A;  4XSZ F;  4U7D A;  3WGG A;  5D5U B;  4L9N A;  3BJA A;  2EWN A;  2K4B A;  3U1D A;  3GFM A;  4EQQ A;  4HF2 A;  3H92 A;  2QBY B;  5CVJ A;  1QPM A;  1CGP A;  2VT2 A;  2O6G E;  3KCC A;  2L54 A;  5AIP A;  1MGT A;  3FM3 A;  5CJ9 A;  3RI4 A;  3I5U A;  1PP8 F;  1Z6R A;  2LF8 A;  3D0S A;  2PBI A;  2XKO A;  1SD5 A;  3IWZ A;  4ENN A;  2K02 A;  2JSC A;  4PGH A;  1EH7 A;  4LG0 A;  5L3C A;  5E1W A;  4PDK A;  2ZME A;  1UHW A;  2VC1 A;  1S3J A;  3RYP A;  1JE8 A;  2BEO A;  2FSW A;  3HYI A;  5D4R A;  2LKP A;  2VC0 A;  5DDG A;  5L3G A;  2BGC A;  2HKO A;  3R60 A;  2YR2 A;  3U9G A;  2QYO A;  2XRO A;  3HSF A;  3DFG A;  4MHG A;  1IZ1 A;  5LHH A;  1XCV A;  4CIC A;  4S04 A;  5LBQ A;  4XRF A;  1XMA A;  4DQ2 A;  1UB9 A;  2TDX A;  1FBS A;  3TOB A;  1XSV A;  3PQJ A;  2Z5U A;  4QWQ A;  2ZO4 A;  1YTY A;  4N9H A;  1V3F A;  4UHT A;  2V6C A;  4RAY A;  1KA8 A;  2V1U A;  2V1X A;  4P9F A;  2Q8K A;  1XSD A;  1JGS A;  2EJR A;  3L7W A;  1BC7 C;  3ERE D;  5DD4 A;  3HTS B;  1HKT A;  4UXN A;  4LLL A;  1XCB A;  3CLO A;  1LNW A;  3BZ6 A;  3GZ5 A;  2IA0 A;  1AWC A;  2F5F A;  4I0B A;  3GW2 A;  2CWE A;  2RQP A;  5DCF A;  4ZZD A;  2QEN A;  2ZJ2 A;  1VTN C;  1BOA A;  4RB2 C;  4L0Y B;  1Z05 A;  1RUO A;  2NAZ A;  2GZW A;  3MQ0 A;  4G94 A;  1KU7 A;  1MKM A;  2GXB A;  1SFX A;  4LB5 A;  1XGO A;  1QNT A;  1ZG3 A;  3WTY C;  3ZN0 A;  1RZ4 A;  4NB5 A;  2C6Y A;  2FBH A;  1SFU A;  5D8L B;  3E5X A;  2QQA A;  3F21 A;  1R36 A;  2ADU A;  2GIV A;  5LGN A;  2M30 A;  1LJ9 A;  1PUE E;  4MQV A;  4A0Y A;  1R1T A;  4KMU X;  2D1V A;  2MA3 A;  3LA2 A;  5K5O A;  3SQN A;  3WG9 A;  1H9T A;  4HV5 A;  3KP5 A;  3TOA A;  1IF1 A;  1R5H A;  3VFZ A;  1R23 A;  1K6O A;  3EUH A;  3K1M A;  4EJT A;  2VXZ A;  4G9Y A;  2P5L C;  4ESJ A;  1R58 A;  3WE3 A;  3R61 A;  1YQA A;  3FMS A;  5JVT A;  5HDK A;  2QWW A;  3WTS C;  1ZGA A;  3GFL A;  1ZRC A;  2V79 A;  4HAM A;  3M8F A;  4E70 A;  3IC7 A;  4FX4 A;  4Q48 A;  2XAS A;  4S05 A;  1IN7 A;  4M9X A;  1HKQ A;  2OD5 A;  5E20 A;  1ZHF A;  2M87 A;  3J80 Z;  2RV8 A;  3RIR A;  1ODD A;  1STZ A;  3T5X A;  2RN7 A;  4ZZL A;  4M6X A;  5E1X A;  5DUK A;  4BYY A;  2ZCW A;  2F5E A;  3RKX A;  2PG4 A;  3OV8 A;  1FZP B;  4IHT A;  1I6X A;  3REO A;  1ZLK A;  2QVO A;  2PLY A;  1ZAO A;  4KA4 A;  4AVP A;  3LQQ A;  1FPQ A;  4H0E A;  4HLX A;  1FT9 A;  1O57 A;  1MJA A;  5HOO A;  1HQC A;  4YII A;  4Y17 A;  3WU0 A;  3K69 A;  1XDU A;  3HRT A;  3ZPL A;  4IPA A;  3GF2 A;  4Y15 A;  3L9F A;  3DPT A;  4OIR F;  4BHC A;  4ESB A;  1EV7 A;  4HX8 A;  5E8I A;  3FX3 A;  5A2Q Z;  1XB4 A;  1OYW A;  4Y13 A;  4CGZ A;  3IKV A;  2EFQ A;  5HS8 A;  1O3Q A;  1BI3 A;  2A69 F;  1IUY A;  1I27 A;  3BP8 A;  1S7A A;  2EA2 A;  5DCM A;  2GQQ A;  3RDI A;  5FB2 A;  3MFK A;  2DQL A;  1FSH A;  3K0L A;  1NHA A;  4FT8 A;  2FML A;  5FLX K;  2Q2E A;  1MDM B;  1P4W A;  1J0R A;  1K7A A;  4RAZ A;  5BS6 A;  4EVI A;  3F72 A;  4NHJ A;  1G3S A;  4G7H F;  4WXC A;  1CF7 A;  3JAM K;  3T8T A;  3ZMS A;  4KIG A;  2M1B A;  4ENJ A;  4O3M A;  1Z7U A;  3M9A A;  1JHH A;  3O3K A;  1B59 A;  1YO5 C;  3HHG A;  5H6Q A;  2QBY A;  1TW3 A;  3RPQ A;  2PEX A;  3F23 A;  4IXA A;  3B73 A;  5FO5 A;  2A3S A;  3EDP A;  1Q1H A;  2OZ6 A;  2VE9 A;  4PZJ A;  3ML6 A;  1WKM A;  1HST A;  1BJA A;  4KIF A;  1HW2 A;  1UHM A;  4KN7 X;  3GVA A;  4LB6 B;  1MZB A;  3ZN1 A;  3F8N A;  4ZYH A;  1TTY A;  1TNS A;  4U7B A;  2ESH A;  3MAJ A;  1IXC A;  1ON1 A;  4BXU A;  5K5R A;  3KEQ A;  1J59 A;  2OA4 A;  5K1Y A;  2HOE A;  3CUO A;  2R3S A;  3C3W A;  3FMR A;  1FBU A;  3C1D A;  4OIP F;  4IRH A;  2E1C A;  2A61 A;  2P7C B;  4XLN F;  5TJJ A;  1MJ9 A;  2VOO A;  1QZY A;  5CVI A;  2YX4 A;  5AIQ A;  2Z99 A;  3DPL C;  1LDD A;  5ED4 A;  3ABT A;  4L5J A;  4KNY A;  3KP3 A;  5ICE A;  3FZV A;  4PGG A;  4L0Z B;  4ZH4 F;  3R0A A;  1Y0U A;  1B9M A;  5KK1 A;  3J80 K;  4Z2Y A;  4BQA A;  3E6D A;  3K1P A;  4WCG A;  4EM1 A;  1G3T A;  5DV5 A;  2XV4 S;  2CSO A;  4WWC A;  3RYR A;  5D5X B;  1A04 A;  3WTZ A;  2UXN A;  3WGH A;  3JTG A;  1XGS A;  2DW4 A;  2P8T A;  3FXQ A;  1U78 A;  4BHB A;  1QQI A;  3Q9V A;  3IKT A;  4HYE A;  5D5W B;  3K9T A;  4HDU A;  3C18 A;  2FMY A;  3FF5 A;  5CVU A;  4A5N A;  2XAJ A;  4WF2 A;  5J8F A;  3V4G A;  3ZMU A;  3KLN A;  1HXD A;  2K86 A;  3QU3 A;  2F5C A;  3I59 B;  1RNL A;  2QQ9 A;  2OQR A;  4HF0 A;  4HDV A;  2EV5 A;  4G8X A;  2A68 F;  4PCQ A;  1SD4 A;  5L3B A;  5DUI A;  4G6D A;  3V8K A;  3COA C;  2EFW A;  2W85 A;  5CLS A;  1D8J A;  5IT9 Z;  4LJZ F;  1LQ1 A;  1T0F A;  2WTE A;  4IHS A;  1HSJ A;  1KU2 A;  2YSR A;  2X0L A;  1XMK A;  2WV0 A;  4QLC U;  2RNJ A;  3HIF A;  1AOY A;  3LAP A;  1SMY F;  3TKY A;  4BHP A;  2J5P A;  2FQ3 A;  5ILV A;  4F7Z A;  3ELK A;  3P7N A;  1KYW A;  4B8X A;  3HRS A;  4P55 A;  4RGR A;  3H3U A;  1OYY A;  4G7Z F;  2KIF A;  5D6F A;  2ACJ A;  4P9U A;  2ZNZ A;  1WSU A;  1XD7 A;  2O3F A;  2UXX A;  2IPQ X;  2IJL A;  3HSE A;  3BY6 A;  1B6A A;  1SAX A;  3HUG A;  4N0B A;  1HBX G;  1FBQ A;  2IW5 A;  3HRU A;  4OIQ F;  1BC8 C;  1SD7 A;  1O7L A;  1SD6 A;  2IA1 A;  4I09 A;  2ISY A;  1Z1D A;  2CFX A;  1W7P A;  2DO7 A;  1QZZ A;  1WI9 A;  3SZT A;  4I2O A;  2JZY A;  1ZG1 A;  3GEZ A;  3ZP5 A;  4MTE A;  4NQW A;  3KP7 A;  2NNY A;  5ICF A;  5LLQ A;  1REP C;  3J81 K;  2RDP A;  1QO0 D;  1U5T B;  1J9I A;  4RGS A;  3W6K B;  2HR3 A;  2ZBK A;  1TW2 A;  2VN2 A;  3TO9 A;  4WXD A;  3SFZ A;  5DEQ A;  2W24 A;  1D3Y A;  2ZKZ A;  2XHK A;  3L00 A;  4XLP F;  1G3Y A;  3FXR A;  1HW5 A;  4GXO A;  1IRF A;  5HDN A;  1B1B A;  3S2W A;  1IN8 A;  2A5Y B;  3M8E A;  3Q5F A;  3ULQ B;  5CVV A;  3T1B A;  3J81 Z;  4KFC A;  2VT3 A;  2E7W A;  1QBJ A;  3F8M A;  4ZYE A;  3ABU A;  4HA8 A;  1G6N A;  2P7V B;  1F9N A;  4HX4 A;  3BRO A;  3R6S A;  1B9N A;  2O0Y A;  2CGP A;  3W6J B;  4HW0 A;  1BN5 A;  2XRN A;  2QQB A;  2EB7 A;  1P6R A;  4RB3 C;  2NYX A;  4N9I A;  2P6S A;  3CUQ B;  3OOP A;  2BE5 F;  1FX7 A;  2WWY A;  3ECH A;  3Q9S A;  5LGU A;  1ZRF A;  4TV7 A;  1K78 B;  2F2E A;  4UUV A;  2CO5 A;  3O6B B;  5EEG A;  3ZMD A;  5TRD A;  5ICC A;  3TO7 A;  4ZYD A;  4YFX F;  3CJN A;  3FXU A;  4Q47 A;  1U2W A;  3F6O A;  2VBY A;  3KZY A;  2MD5 A;  3ZMV A;  2XAH A;  3G73 A;  1RI7 A;  3EYI A;  3CUQ A;  3GFJ A;  4HBL A;  3KP6 A;  2F5D A;  4UV8 A;  2EFN A;  4AD9 A;  4GGG A;  1TBX A;  5HLG A;  2G7H A;  3BPV A;  3E6M A;  2OU2 A;  4M9S A;  2A07 F;  2YU3 A;  2HTS A;  3K1N A;  2RVC A;  1H9G A;  3LA3 A;  4IRG A;  3DEU A;  3JSP A;  2DT5 A;  5BQT A;  1OKR A;  4UV9 A;  2DFI A;  2UWM A;  4EGZ A;  1W4M A;  1YW9 A;  2A6E F;  1XN7 A;  3KET A;  2KJC A;  1DPR A;  3SHF A;  2HKX A;  2ETH A;  1IRG A;  2EK5 A;  2IP2 A;  3B02 A;  2GAU A;  5DD8 A;  3E5Q A;  4OMY A;  4A2U A;  2MLK A;  3BDD A;  3F8B A;  2VOP A;  3I53 A;  1E2X A;  3IRQ A;  3HRM A;  2FXA A;  1JXS A;  3NEU A;  1Z9C A;  2BYV E;  4L5I A;  3O2P E;  4EV0 A;  5LHI A;  1IW7 F;  2K7L A;  1HW1 A;  3KEO A;  4HLY A;  3GO5 A;  3WTX C;  2YX7 A;  5A2Q K;  2STT A;  1TNT A;  3MZH A;  1TQP A;  2L02 A;  2M8E A;  4AIK A;  2NNN A;  1YG2 A;  3KP4 A;  2PN6 A;  2W57 A;  1DDN A;  4R79 A;  4GYG A;  4CHU A;  2FRH A;  1WRJ A;  2OAZ A;  4ENM A;  1T2K A;  3M1E A;  3EQL F;  4DNC A;  3EET A;  1ONV A;  2H6B A;  1LDJ A;  5J8C A;  4IVN A;  2MBF A;  2JT1 A;  3IRR A;  3F6V A;  2VBZ A;  3R0J A;  1U6G A;  3LA7 A;  3F8F A;  3LQR A;  3FHZ A;  4JQF A;  2FBK A;  1YS6 A;  2CG4 A;  3P9K A;  5BOX A;  1R00 A;  1R1U A;  2PI0 A;  1ZN2 A;  2LNB A;  1YIO A;  3WGI A;  2H27 A;  1IN6 A;  2Y48 A;  1LDK B;  3VOD A;  2EFO A;  2VON A;  4AIJ A;  5FD6 A;  2P4W A;  4HQM A;  5HS7 A;  3V8J A;  4KMF A;  3KFW X;  3EYY A;  4RS8 A;  3LWF A;  4P5O A;  1I1S A;  4XSX F;  2DAO A;  1ZG5 A;  3KE2 A;  4A0Z A;  4LMY A;  5CYV A;  4YFK F;  1G4D A;  5LEK A;  4RGX A;  1P4X A;  2FE3 A;  2Y0M A;  1K79 A;  2HGC A;  2H09 A;  5E17 F;  3KP2 A;  1FLI A;  3JAM Z;  5L3E A;  3RKY A;  2DPU A;  4UVB A;  4JBA A;  3DXJ F;  2MLG A;  2DLL A;  2QM3 A;  4EJU A;  2ISZ A;  4MQ9 F;  2VOD A;  2KJB A;  2EV6 A;  3DF8 A;  1L3L A;  4CYD A;  1YFH A;  3HSR A;  3AAF A;  2ZXJ A;  1USS A;  1YLF A;  4A6E A;  2RKH A;  5CVR A;  1KQ8 A;  5ILU A;  2VBX A;  3GX4 X;  1DPU A;  2PMU A;  4O6J A;  2G7U A;  4UVA A;  2O8X A;  2HYG D;  2MH2 A;  4MEY F;  3I64 A;  1K78 A;  2MC3 A;  1ZAR A;  4U0W A;  3QPT A;  4FHT A;  2IVM A;  2VE8 A;  3GWZ A;  1YW7 A;  2FF4 A;  1W7P B;  2BV6 A;  3LFK A;  1UFM A;  3WTU C;  4D0P A;  3WU1 B;  2ZME B;  2IRF G;  5AON A;  2BBY A;  1YS7 A;  3DKW A;  1R22 A;  1ZRD A;  3LAJ A;  4M72 A;  3I58 A;  3JW4 A;  5K5Q A;  4YFN F;  1OR7 A;  5JI6 A;  3N4M A;  2PQ8 A;  4I02 A;  1FYK A;  1UCR A;  2JRT A;  3HOS A;  2FNP A;  2HWV A;  2GA2 A;  2PMH A;  1R5G A;  1W7P D;  1T98 A;  4ESF A;  1ZGJ A;  2GXG A;  4KIC A;  2CQK A;  3IHU A;  5EEH A;  3VB2 A;  2OBP A;  3E97 A;  2H6C A;  1H0M A;  3QOP A;  4AIH A;  3NRV A;  1J5Y A;  4A0X A;  3BJO A;  2DPD A;  3RJP A;  1J75 A;  1C0W A;  1KYZ A;  1FSE A;  5FFZ A;  3D5L A;  2GWR A;  3WE2 A;  3I0T A;  3RTR A;  2O61 A;  5FLX Z;  2L01 A;  5ILS A;  3GZ6 A;  1LEA A;  2O03 A;  4BAY A;  3V7R A;  3PFI A;  3TO6 A;  3I4P A;  2KIU A;  3L09 A;  1R1V A;  2L4A A;  2L3D A;  2HYF A;  3H3Z A;  1KU3 A;  4HV6 A;  4HZF A;  4U0Y A;  2FU4 A;  4OIO F;  3SXY A;  3GFI A;  1FP1 D;  4HQE A;  1RUN A;  1ON2 A;  3ZMT A;  3V7C A;  1MDM A;  2IA2 A;  2XVC A;  2RGV A;  5LRS A;  3FMQ A;  4YG2 F;  2HZT A;  2W25 A;  5L3F A;  4GCV A;  4JK1 X;  5IT9 K;  3F8C A;  1EH8 A;  3CUQ C;  2XAG A;  1F5T A;  2JPB A;  1J7K A;  5FFX A;  2R7F A;  3E3V A;  1I1G A;  4L9V A;  5E8G A;  4MTD A;  2IT0 A;  4WK8 F;  3CO6 C;  1S6L A;  5D8K B;  1IXR C;  2E1N A;  4XBF A;  1O3S A;  1I5Z A;  1Z6T A;  1WWX A;  4R8H A;  1FYM A;  1SMT A;  2YPR A;  4EM0 B;  2B0L A; 
#chains in the Genus database with same CATH topology
 3FKJ A;  3DTE A;  4LK0 F;  3GUD A;  2DA3 A;  3TMO A;  1HC8 A;  4XL9 A;  3E5U A;  1XPX A;  1XS9 A;  4I76 A;  4EM2 A;  3S2D J;  1O3T A;  2IS6 A;  1EF4 A;  3V7S A;  1H89 C;  3GLX A;  1IXS B;  1LUJ B;  1BBY A;  4KIB A;  3CMM A;  5EEA A;  1T38 A;  2DFF A;  2L9R A;  5D4S A;  1F36 A;  2KRF A;  4EJV A;  3TQN A;  2WAQ N;  3KLO A;  2XF6 A;  2AS5 F;  1OPC A;  4B43 A;  2LVS A;  2NOG A;  4PSW A;  2R7R A;  1CF7 B;  2XAF A;  1FYL A;  1UHS A;  2P6T A;  1BA5 A;  4I01 A;  5HS9 A;  5IP7 J;  2YUS A;  5M5W J;  2D1H A;  5LEJ A;  1YYV A;  4QIW N;  2FEZ A;  3A2K A;  1B8I B;  4BDY A;  4A6D A;  2JMW A;  1F4K A;  4B44 A;  1W5S A;  2BZT A;  3HBL A;  4GFB A;  2LY9 A;  4LD5 A;  3U2R A;  4XK4 A;  2L0K A;  3B6A A;  3BCA A;  5ERI A;  5KAF C;  2FA5 A;  3T8R A;  2NS7 A;  1U8R A;  1WQ2 A;  5H20 A;  1ZTR A;  3LST A;  5DYM A;  3K4J A;  1OIS A;  4A3J J;  4LG0 B;  2DQR A;  3IV5 A;  3IWF A;  4P96 A;  3GXO A;  1YIJ I;  4I6Z A;  2R92 J;  1D5V A;  4JX5 A;  5F0H A;  3GYH X;  1TQM A;  4O5V A;  2XUB A;  1MH3 A;  3BC8 A;  4EJO A;  2ZNY A;  1IAW A;  1LFU P;  4XOT A;  2FQ4 A;  3I59 A;  5L3D A;  4DOZ A;  1G3W A;  3LSK A;  3HGY A;  2ELJ A;  4A3D J;  1BI2 A;  4ON0 A;  2LY1 A;  3MVP A;  4NC8 A;  2BY1 A;  1P7I A;  1TC3 C;  1BL0 A;  5J6X A;  3WTT C;  1O3R A;  1MBK A;  2ICW G;  2HDC A;  4QTR A;  4LK1 F;  2EFP A;  3LFU A;  4ANJ A;  1O7F A;  2K40 A;  3HOT A;  1Y0N A;  1LVA A;  3UKG A;  3MZY A;  2HQN A;  2CV2 A;  2P5V A;  4G7O F;  4F92 B;  3RKQ A;  3T0Y A;  3TGN A;  2ZC2 A;  4A3I J;  1YHQ I;  4KDP A;  1B72 B;  2KRC A;  2X4H A;  1S29 A;  3CO7 C;  3CC4 I;  5JR3 A;  3R4K A;  4LLN A;  4UNO A;  5HLH A;  1OMI A;  4U88 A;  2ECB A;  1RET A;  2BY2 A;  1A31 A;  1ETQ A;  2LG4 A;  2VJJ A;  3HOV J;  1SVM A;  3IH3 A;  1GT0 C;  3DP7 A;  5HLI A;  3MKW B;  3CP2 A;  3H5N A;  3FBI B;  5D6E A;  3W2W A;  3PIO F;  3JRC A;  4CYC B;  5DS9 A;  2HEO A;  2D2W A;  2KDO A;  4F52 A;  2I8D A;  2Y0S N;  3KZZ A;  3SZG A;  3VDX A;  1S8N A;  3OS2 A;  4RB0 A;  2W1O A;  2NRA C;  4MNU A;  3F9K A;  2PJR B;  4U0V A;  5GPA A;  1X2M A;  5DCM B;  3OS0 A;  1DU6 A;  3HHH A;  3MWM A;  4C3I J;  1QU3 A;  4I0A A;  2XIG A;  4F93 B;  2OTJ I;  2BHY A;  1TWC J;  2H1L A;  3QP5 A;  4OOI A;  1FWZ A;  2E1O A;  2HOA A;  1YRN B;  1ITY A;  2CQQ A;  2FBI A;  4KT5 C;  1LEB A;  2MH9 A;  5BPD A;  1Z77 A;  3RZD J;  3IAS 2;  1KGS A;  3CTA A;  4HNU A;  5F0C A;  3P9I A;  2E5Z A;  2ZSI B;  3FDY A;  3RKW A;  1UG2 A;  4LFU A;  1XDS A;  1JKR C;  2QSH X;  4B09 A;  1APL C;  3ASO H;  2ZSH B;  4MGR A;  1JHF A;  1LB2 A;  3PO3 J;  5LRR A;  3ZQF A;  5KNL A;  3I71 A;  2MGQ A;  2WAQ A;  2GOM A;  2OJE D;  2DK8 A;  2ZXI A;  2XRL A;  5HNF A;  4RGU A;  3FWE A;  3ABL H;  1LE8 B;  4KYW A;  5JFR A;  4F3Q A;  1R4N B;  1XMX A;  2JWT A;  2L7M P;  4KUM A;  4Q4Z F;  5M5Y J;  1WPK A;  4D7N A;  3NQO A;  4F91 B;  1UAA A;  2JPC A;  2X1D A;  5IT3 A;  1WJC A;  3E6B A;  2M45 A;  1U3E M;  3J7A Y;  5LHG A;  1FOK A;  1ZKG A;  1W36 C;  3BJ6 A;  5E1Z B;  3ZOB A;  1VF9 A;  1TLH B;  1A35 A;  1QHG A;  3L2C A;  3OYE A;  4AM3 A;  4K2E A;  4UVC A;  3GTO J;  3TDU C;  4BE2 A;  5J3L A;  2WAF A;  2Z1D A;  5F6F A;  4Q5S F;  2Z3Y A;  3JSO A;  2L4M A;  2K3P A;  3N97 A;  2IS2 A;  3GTL J;  1MW7 A;  2R5Y A;  1EH6 A;  1Z0X A;  1PP7 U;  2LR8 A;  4AWX B;  1PJR A;  5C4J J;  2HI3 A;  2DBB A;  2M4G A;  1FC3 A;  1MMA A;  1QVU A;  2AXL A;  2LSO A;  3J7Y J;  3E0J B;  1OLT A;  3QU6 A;  3E6C C;  4ZC3 A;  2QKL B;  3I54 A;  2QUF A;  1BI0 A;  3BOQ A;  4CXF A;  3K4N A;  2O7O A;  1JI8 A;  1ZRE A;  2MSY A;  3QPH A;  3HUG B;  1P92 A;  2K27 A;  3ROU A;  1RIO H;  4FX0 A;  2CUE A;  1MMD A;  1WJF A;  3FKI J;  3U1K A;  4MEX F;  4MIM A;  3G3Z A;  3PQK A;  2VBW A;  4M6Y A;  2KL4 A;  2OZU A;  2WV1 A;  1KZH A;  2Y30 A;  1B4A A;  2JUC A;  5JHU A;  3QQA A;  3OSF A;  2HPI A;  1ZQ3 P;  5HDG A;  2ME6 A;  3IL2 A;  1FNN A;  1QZE A;  4Y4R A;  3FK7 A;  1TT0 A;  4A12 A;  4EJW A;  2GOX B;  4B3A A;  2X6W A;  2P5K A;  6PAX A;  2E36 A;  1E0E A;  3BQZ A;  2EBI A;  3HPG A;  1MBG A;  1J2X A;  4ZDL A;  3LL7 A;  4GO1 A;  1MD0 A;  4LLG F;  1R7J A;  4BEH A;  1GDT A;  3I4N J;  1F43 A;  1SFE A;  1FY7 A;  2A6H F;  5FD5 A;  1HKS A;  3ISP A;  4A5M A;  2DMN A;  2J5O A;  3KYL A;  2R7V A;  2H8R A;  1Y8Q B;  2KRH A;  1HDP A;  2HQR A;  3CMY A;  3RPU A;  1FTZ A;  2XKP A;  1KU9 A;  3IH4 A;  2XGX A;  3K70 C;  2NVQ J;  2Y75 A;  1E17 A;  1Z7L A;  2R7D A;  4RLF A;  3M07 A;  4FQG A;  3E1S A;  1Y8R B;  4M3F A;  1MMG A;  2E1M B;  2LF7 A;  1XGM A;  2RC4 A;  2ZME C;  4N4O B;  3OIO A;  3HKZ N;  5C4X J;  4BKX A;  5LGT A;  3ZQ7 A;  2XB5 A;  1BIB A;  1QRY A;  4A69 C;  4HX7 A;  1WHU A;  1IO2 A;  3EUH C;  1BR2 A;  2ZFW A;  4YEJ A;  1XSX A;  3ZMZ A;  5HLT A;  2QSG X;  2WA0 A;  4RDU A;  3FIS A;  3RSN A;  4ZYG A;  2DK5 A;  2E7X A;  2HFH A;  4ZYA A;  2R0Q C;  2AO9 A;  2NOJ B;  5HVQ C;  5IYC J;  1SVL A;  2G9W A;  2ELH A;  5BMZ A;  4BJ6 C;  3BPX A;  1U5T C;  2IGM A;  1VQ8 I;  2COM A;  1JKQ C;  1E3H A;  1GVJ A;  2NS0 A;  2FJ1 A;  3QPS A;  4M74 A;  1RRJ A;  2VKH A;  4BUP A;  1PDN C;  5K7F A;  4M9Z A;  3VOE A;  4BE1 A;  4R1H A;  2DU9 A;  4CCN A;  2E71 A;  3DCF A;  1XGN A;  3CF2 A;  4OU0 A;  2DA5 A;  3CCQ I;  3QYB A;  3P9C A;  3PIP F;  2V1N A;  4HG2 A;  1R5I D;  4IRI A;  2JQ7 A;  2CYY A;  1GHC A;  4M3E A;  2V7F A;  3JTH A;  5FGM A;  3K4B A;  2MD0 A;  2OF7 A;  2LLK A;  3HXL A;  3MN2 A;  4OMZ A;  5M3F J;  1ZLJ A;  4H4K C;  2HDD A;  4LGW A;  1Z67 A;  4G6Q A;  3DV8 A;  3OL4 A;  3BWG A;  3QAH A;  5KVR A;  2HTJ A;  2D45 A;  2K9M A;  2OV7 A;  1WH5 A;  3HB9 A;  2FOW A;  4RB1 A;  2Z9O A;  1LFP A;  4EMS A;  1N77 A;  4AUX A;  1MH4 A;  1P4A A;  2ESN A;  2K9S A;  1UEL B;  1BIA A;  3U21 A;  5H6R A;  2V9V A;  2ME0 A;  1DP7 P;  2K4J A;  2IGK A;  3MEX A;  4ITV A;  4AYB N;  1KQ9 A;  4L18 B;  3GTM J;  3VEP A;  3OYA A;  1JT0 A;  1GUU A;  4BH9 A;  2NVY J;  3K2Z A;  1NTC A;  3CZ6 A;  2STW A;  5ICG A;  2JTV A;  4KN4 X;  3PM1 A;  1DQU A;  1MJB A;  5IT9 K;  4DJA A;  2X6Y A;  4WX9 A;  3ZQI A;  1HOM A;  4L9T A;  3GTQ J;  1N78 A;  4BE0 A;  1SAU A;  1TQI A;  2K85 A;  2KKO A;  4I98 B;  5B1A H;  2NVU B;  1IN4 A;  2UZK A;  2Z33 A;  1BJZ A;  1QGP A;  4YIF A;  2DI3 A;  1J09 A;  3O8H A;  3TP3 A;  2H8W A;  4WXH A;  2A05 A;  2CV0 A;  4IJA A;  1DUX C;  3WTW C;  4EGY A;  1Z3X A;  3WOD F;  4C3J J;  2PFB A;  5FJ8 J;  4PJJ A;  5GTH C;  2TCT A;  1T39 A;  3FXL A;  1NH3 A;  1LPQ A;  1D0X A;  1Z3Y A;  1X4P A;  2WAD A;  2XAQ A;  3PSF A;  2QLZ A;  2M5W A;  3V8L A;  4I7H A;  2M9H A;  3ECO A;  4BNC A;  1U5T A;  1UST A;  5IOZ A;  2OQG A;  4ENK A;  3VYS B;  1YW8 A;  2EA4 A;  2BXZ A;  4BDZ A;  1Z91 A;  1GXP A;  4ETS A;  4NQW B;  3CCM I;  2R7X A;  2LC2 A;  5FLV A;  4HF1 A;  1L0O C;  1WVR A;  2B63 J;  3A01 A;  2BY3 A;  3QRF F;  1GXQ A;  3TED A;  2QZ8 A;  1AU7 A;  3DQV C;  2LRE A;  2WC2 A;  3WTV C;  3OYL A;  3JRI A;  4XMY A;  2Q2E B;  2DT6 A;  4IQ4 A;  2FOK A;  3HGG A;  1QA6 A;  4DBR A;  1RR8 C;  3CCV I;  3OOU A;  1BM9 A;  5BPI A;  1AKH A;  2I10 A;  1H8A C;  4BGD A;  2LDU A;  4JP0 A;  3W2V A;  4OIN F;  4BEH B;  3TW6 A;  4CDG A;  3S14 J;  1F1Z A;  3A02 A;  3PL8 A;  1S7O A;  4HOB A;  3SZP A;  3FXO A;  5JLW A;  1KQ0 A;  2EV0 A;  3FXM A;  1D5Y A;  3CDI A;  2QF7 A;  1E3O C;  3HTU A;  1Y1V J;  1I39 A;  3S3N A;  2HS5 A;  1ZYR F;  4ASN A;  4GYI A;  2LMD A;  1ZH5 A;  3CCE I;  1X3U A;  2PJP A;  2V1D A;  3KZI C;  3TDZ C;  4ZDO A;  1D8K A;  1W5T A;  3GLL A;  5E18 F;  2DCE A;  4M71 A;  5F1R A;  3CDH A;  2L5Q A;  2PMZ N;  2H94 A;  1P2F A;  2Q0O A;  3CCJ I;  1MSF C;  2CW0 F;  3DU6 A;  2ZB9 A;  2DXI A;  1D1C A;  3QP6 A;  2KMU A;  2GIZ A;  4KIS A;  2HOS A;  1IN5 A;  3BR6 A;  1T6S A;  4A3B J;  3QOE A;  4IF4 A;  1CQT A;  1TZL A;  1BI1 A;  3C7J A;  4BBS J;  5F64 A;  2KIM A;  4A3M J;  4CO8 A;  2XB0 X;  1EKE A;  2AQF A;  3F3X A;  3CMA I;  2DTR A;  3K7A J;  2W84 A;  1FP2 A;  5EF6 A;  1V4R A;  3BG6 A;  5D5V B;  5BNG A;  2X9D A;  4M73 A;  4MLO A;  4V19 K;  4L9J A;  3J7A O;  3F22 A;  4X6A J;  3VYU B;  2FNA A;  5H2F C;  5C44 J;  4CZZ A;  2X85 A;  4NBQ A;  3CCU I;  3SJM A;  3MCZ A;  2LKS A;  1IV8 A;  3M7G A;  3OMY A;  3FM5 A;  2GA1 A;  1ULY A;  1OYI A;  4XNF A;  2KDZ A;  3ABK H;  4XSZ F;  4U7D A;  3M1C A;  3WGG A;  1OCO H;  4BQQ A;  5D5U B;  4XKV A;  4L9N A;  2RNG A;  1V5E A;  3BJA A;  2EWN A;  3A01 B;  2K4B A;  1ZEL A;  2EIL H;  3U1D A;  2MG4 A;  2TRT A;  3GBG A;  3GFM A;  4IOC F;  3AFH A;  4EQQ A;  4EEF G;  3M4O J;  4HF2 A;  3H92 A;  4E7Z A;  2QBY B;  5CVJ A;  2HNH A;  1QPM A;  2LTP A;  1CGP A;  3S1M J;  4A3L J;  2VT2 A;  2O6G E;  1JKP C;  5JLX A;  3KCC A;  3OYC A;  2L54 A;  5AIP A;  1MGT A;  3FM3 A;  4XQF A;  3CCR I;  3Q0W A;  5CJ9 A;  3RI4 A;  3I5U A;  4DZJ A;  4Z6Y A;  1PP8 F;  1IRX A;  1K6Y A;  1Z6R A;  2X1C A;  2LF8 A;  3D0S A;  2PBI A;  2XKO A;  2XPU A;  1WJD A;  1SD5 A;  2E34 A;  4YRV A;  3IWZ A;  4YEL A;  5FKM A;  4XOR A;  4QSH A;  4ENN A;  1SEU A;  4M3G A;  5DTD A;  2K02 A;  2VPR A;  2JSC A;  3AL0 C;  3L2V A;  4PGH A;  4BXX J;  3C2G A;  2AXT C;  1EH7 A;  4LG0 A;  5L3C A;  5E1W A;  4PDK A;  1D1B A;  1XC5 A;  2ZME A;  4B4C A;  1UHW A;  2QKM B;  2VC1 A;  2DJI A;  1S3J A;  3RYP A;  2BVM A;  1JE8 A;  2ID6 A;  2DT7 B;  2BEO A;  2FSW A;  3HYI A;  3H9G A;  4DYQ A;  5D4R A;  2LKP A;  2VC0 A;  4UB6 C;  5DDG A;  5L3G A;  2BGC A;  2F6C A;  2HKO A;  3R60 A;  2CUZ A;  2YR2 A;  2EH3 A;  2Y31 A;  3U9G A;  1U0J A;  1D0Z A;  2QYO A;  3J7Z I;  2XRO A;  2CH0 A;  3HSF A;  3HM5 A;  1TL8 A;  2L2O A;  3G6E I;  3DFG A;  2MC4 A;  4MHG A;  5KHD A;  4UUS B;  1T08 B;  1IZ1 A;  5LHH A;  1XCV A;  2EIN H;  4CIC A;  1ERD A;  4IQJ A;  4S04 A;  5LBQ A;  2FD5 A;  4XRF A;  2R7T A;  1XMA A;  3MKL A;  4DQ2 A;  1UB9 A;  2TDX A;  1FBS A;  3CLQ A;  3FXK A;  3TOB A;  3GZN B;  3LOC A;  1XSV A;  3PQJ A;  2Z5U A;  3BTJ A;  1WZ2 A;  4S0H B;  4QWQ A;  4AVZ A;  2ZO4 A;  1YTY A;  3IH2 A;  2R7Z J;  4N9H A;  1V3F A;  4UHT A;  1KON A;  2DYR H;  4EAT A;  3VPR A;  2V6C A;  4RAY A;  1KA8 A;  2V1U A;  2V1X A;  4P9F A;  2Q8K A;  1MIJ A;  3BZK A;  1PYV A;  1XSD A;  1IC8 A;  1JGS A;  2EJR A;  3L7W A;  4XRM A;  2AQE A;  1WJ5 A;  1BC7 C;  3ERE D;  4XKC A;  5DD4 A;  3HTS B;  1HKT A;  4UXN A;  5EGO B;  4CH7 A;  3H5A A;  1JT6 A;  4LLL A;  1XCB A;  3EUK L;  1AHD P;  1FEX A;  3CLO A;  4DZP A;  3S1N J;  4KIT B;  1LNW A;  2K5C A;  3BZ6 A;  3GZ5 A;  2IA0 A;  1AWC A;  2EZK A;  3KPH A;  3S8P A;  4CCL A;  4IZZ A;  1YOV B;  2F5F A;  4I0B A;  1X2N A;  1ENH A;  3I4M J;  3GW2 A;  2CWE A;  1VQO I;  2RQP A;  5DCF A;  4ZZD A;  5DM7 F;  1YIT I;  5E3L A;  3OYN A;  2QEN A;  3ZQC A;  2HQ5 A;  2ZJ2 A;  4CA0 A;  1K4T A;  1VTN C;  5LD2 C;  1BOA A;  4RB2 C;  4X1E A;  4W97 A;  3RQI A;  4L0Y B;  1Z05 A;  4E7H A;  2RRE A;  3S32 A;  3HKZ A;  1GV2 A;  3ESW B;  1RUO A;  2NAZ A;  1ETO A;  2JA5 J;  2GZW A;  3MQ0 A;  2KQR A;  2LY2 A;  4G94 A;  1KU7 A;  1MKM A;  2GXB A;  1SFX A;  3BT9 A;  4LB5 A;  1E3P A;  1X1B A;  1XGO A;  4C30 A;  2X51 A;  3VYR B;  1QNT A;  3AG3 H;  2Y0S A;  4XKW A;  1ZG3 A;  3WTY C;  3ZN0 A;  3W3C A;  4BU2 A;  1RZ4 A;  1BW6 A;  4NB5 A;  5KCM A;  1RES A;  4GRI A;  2C6Y A;  3FK6 A;  2DOF A;  2FBH A;  1A6Q A;  1SFU A;  5D8L B;  3TW7 A;  2R7S A;  1NG6 A;  4XRS G;  3E5X A;  5FKK A;  2QQA A;  3ZGK A;  3F21 A;  1R36 A;  2DA6 A;  5J4Y A;  2ADU A;  3MKY B;  2GIV A;  5LGN A;  2M30 A;  2B7E A;  1LJ9 A;  1PUE E;  4MQV A;  1VQ5 I;  4A0Y A;  1R1T A;  3MMY B;  4KMU X;  2D1V A;  2LP0 A;  2MA3 A;  3LA2 A;  3SQN A;  5K5O A;  3WG9 A;  1H9T A;  4ZTF A;  1A5J A;  2O9L A;  4HV5 A;  4X0G A;  3KP5 A;  3K70 D;  3TOA A;  3VFZ A;  1R5H A;  2BOL A;  1R23 A;  1K6O A;  1IF1 A;  3EUH A;  4RAG A;  2VKV A;  3K1M A;  2VKD A;  4EJT A;  2VXZ A;  1R9T J;  2NXN B;  4G9Y A;  2P5L C;  3H9Q A;  4ESJ A;  3OYJ A;  3OYK A;  1R58 A;  3WE3 A;  2VIX A;  4IO9 F;  2L7F P;  3R61 A;  5C3E J;  1IJW C;  3FBN B;  4KT6 A;  5GAH J;  1YQA A;  3FMS A;  5JVT A;  5E3N A;  5HDK A;  2QWW A;  1WJA A;  3WTS C;  2IGO A;  3MZ8 A;  5GAG J;  4NC6 A;  5FLM J;  4A3F J;  1SC7 A;  1MMS A;  4XRS A;  2JRM A;  2LRD A;  3CJT B;  1ZGA A;  2VI6 A;  3GFL A;  1ZRC A;  4J01 A;  2LYC A;  2V79 A;  4HAM A;  4UB8 C;  3M8F A;  4E70 A;  1G59 A;  3S1Q J;  3IC7 A;  4FX4 A;  4Q48 A;  2XAS A;  4S05 A;  1IN7 A;  1UJ8 A;  3OL3 A;  4M9X A;  1HKQ A;  1A36 A;  2OD5 A;  4A3G J;  5E20 A;  4F55 A;  1ZHF A;  2M87 A;  3LSG A;  5IOY A;  3J80 Z;  4XLC A;  3OYF A;  3OR2 C;  2RV8 A;  4BY7 J;  1MBF A;  2IS4 A;  3SDB A;  5DM6 F;  3RIR A;  5IPA A;  1ODD A;  4FTH A;  1STZ A;  3T5X A;  2XPV A;  2X6X A;  2XGE A;  1D0Y A;  5CQG A;  2RN7 A;  3CCS I;  4ZZL A;  4M6X A;  5E1X A;  5DUK A;  4BYY A;  2ZCW A;  1FIP A;  2F4M B;  2F5E A;  3JRH A;  4KJZ A;  4XID A;  3RKX A;  2PG4 A;  2CS3 A;  3OV8 A;  3BZC A;  5M5X J;  1FZP B;  4IHT A;  3SEQ A;  1I6X A;  1X1D A;  3REO A;  1ZLK A;  2QVO A;  2PLY A;  1ZAO A;  4KA4 A;  3X2Q H;  2BY0 A;  3RCO A;  2OTL I;  2XF5 A;  4AVP A;  3HJE A;  3LQQ A;  1FPQ A;  2EIM H;  4H0E A;  1QVT A;  1S5L C;  2G0E A;  1W0U A;  4HLX A;  1FT9 A;  1O57 A;  1MJA A;  5HOO A;  2Z16 A;  1HQC A;  3L1P A;  1T0F C;  2VJ4 A;  4RBO A;  1VI0 A;  4YII A;  1NG7 A;  3CJR B;  5EZG A;  1FMW A;  3I56 I;  1Y6I A;  4Y17 A;  3ZQL A;  3H35 A;  3PNV A;  3WU0 A;  1YI2 I;  4PJL A;  1RKT A;  3K69 A;  4E7I A;  1XDU A;  3HRT A;  1S72 I;  3ZPL A;  1GLN A;  1B8I A;  4IPA A;  2JA8 J;  2JK3 A;  3C2H A;  3GF2 A;  1OCP A;  4Y15 A;  3L9F A;  3DPT A;  4BXF A;  4OIR F;  1T95 A;  4E7L A;  4BHC A;  5GTI C;  4ESB A;  1EV7 A;  4D5F A;  4HX8 A;  5E8I A;  1MMN A;  2CFO A;  1U9N A;  1QPI A;  1QHH D;  3FX3 A;  2HOT A;  5A2Q Z;  3KYC B;  4DBQ A;  3HOU J;  1XB4 A;  3AG1 H;  3FXJ A;  1MNE A;  1OYW A;  4Y13 A;  4XN3 A;  4CGZ A;  1OFC X;  4C2M J;  2CMP A;  4UY8 I;  4XLF A;  3IKV A;  3BR1 A;  1JUS A;  3OYI A;  3OS1 A;  1WH7 A;  2EFQ A;  3A03 A;  5JHF A;  3N05 A;  4CCJ A;  5HS8 A;  4V2F A;  1IDZ A;  2PX9 A;  1O3Q A;  1BI3 A;  2A69 F;  3D5R C;  1I27 A;  1IUY A;  3BP8 A;  1S7A A;  2EA2 A;  3K4C A;  5DCM A;  2LOO A;  2GQQ A;  3H0D A;  2XPW A;  3RDI A;  5HOD A;  5FB2 A;  3MFK A;  4JX6 A;  1S7E A;  2DQL A;  1FSH A;  3NAU A;  3H0G J;  3K0L A;  4D9J A;  1IUF A;  2XGD A;  5FRM A;  1NHA A;  4FT8 A;  2FML A;  3TP0 A;  4C9Y A;  2QA4 I;  5FLX K;  1JTY A;  1M1E B;  5GAD J;  2Q2E A;  3GTG J;  1MDM B;  1ZGW A;  4FET A;  1P4W A;  1J0R A;  4JX4 A;  4RAZ A;  1K7A A;  5BS6 A;  4EVI A;  4E7J A;  3KYD B;  3F72 A;  2JA7 J;  4NHJ A;  1G3S A;  4G7H F;  2M4K A;  3HOZ J;  4WXC A;  1CF7 A;  3JAM K;  2Q1Z B;  5F0F A;  3T8T A;  3ZMS A;  1UMQ A;  4KIG A;  2M1B A;  4ENJ A;  4O3M A;  1Z7U A;  4II3 A;  3DEW A;  3OYM A;  1P9Q C;  1VQM I;  3M9A A;  1JHH A;  3O3K A;  2DA1 A;  3PNY A;  1VQP I;  1B59 A;  1YO5 C;  1UG0 A;  3HHG A;  5H6Q A;  2QBY A;  3M3Y J;  1TW3 A;  3RPQ A;  2PEX A;  1WGX A;  3F23 A;  1MBE A;  2E2H J;  4IXA A;  2WAE A;  3B73 A;  2M2E A;  1MBJ A;  5FO5 A;  2A3S A;  3EDP A;  3A0B C;  1Q1H A;  2OZ6 A;  2VE9 A;  3GME A;  4PZJ A;  3ML6 A;  1WKM A;  1HST A;  3RQ4 A;  1BJA A;  1X3Z B;  3AG4 H;  2DMP A;  4KIF A;  1HW2 A;  1UHM A;  4KN7 X;  2HU9 A;  3GVA A;  3OWT A;  2R5Y B;  2LBF B;  3SEZ A;  1ETV A;  4LB6 B;  1MZB A;  3ZN1 A;  3F8N A;  4ZYH A;  2VLA A;  1TTY A;  3ZQQ A;  4QPQ A;  1TNS A;  2M7A A;  1ETX A;  3M8J A;  4U7B A;  2ESH A;  3MAJ A;  2DFE A;  1IXC A;  1ON1 A;  4BXU A;  5K5R A;  3KEQ A;  4M3D A;  1J59 A;  2OA4 A;  2KZG A;  3ABM H;  5K1Y A;  2HOE A;  3BQY A;  3CUO A;  4PUS A;  2BW3 A;  2W82 A;  3K4M A;  3H3V K;  4QPO A;  2L9S A;  2R3S A;  2UV1 A;  4M3B A;  1OJL A;  3C3W A;  1OCC H;  1Q1V A;  1YE9 A;  2KHM A;  3FMR A;  1FBU A;  3C1D A;  5F27 A;  4XIC A;  4IRH A;  4OIP F;  2CW7 A;  3UR3 C;  2CW8 A;  3JCU C;  2E1C A;  1TWA J;  4N4N B;  1NK3 P;  2A61 A;  2YU9 J;  2P7C B;  4XLN F;  3E7L A;  5EJC A;  5TJJ A;  1MJ9 A;  5FRO A;  3ZR8 X;  2D5V A;  2B9S A;  2VOO A;  1RR7 A;  2DOD A;  1QZY A;  2EIK H;  5CVI A;  2YX4 A;  3DWL E;  5AIQ A;  2Z99 A;  3DPL C;  2LFB A;  1LDD A;  5ED4 A;  3ABT A;  2DOE A;  4L5J A;  4KNY A;  3O8G A;  3KP3 A;  5ICE A;  2ZJR F;  4A93 J;  3FZV A;  1X1A A;  2QSF X;  3JRD A;  3WG7 H;  4JYK A;  4XLH A;  4PGG A;  4L0Z B;  4IEJ A;  4ZH4 F;  1RPW A;  2HQA A;  3AKZ A;  3CP8 A;  3R0A A;  1Y0U A;  5FRN A;  1B9M A;  5KK1 A;  3J80 K;  4Z2Y A;  1IV6 A;  4BQA A;  5IP6 A;  2OCC H;  3E6D A;  3LSP A;  2DOA A;  1H88 C;  3K1P A;  1FMV A;  3LSM A;  1Y1W J;  2WB1 A;  4LOC A;  4WCG A;  4EM1 A;  1IRZ A;  1ZK8 A;  1A6I A;  2QGU A;  4AID A;  1DGW Y;  3VWB A;  2VQL A;  3S1R J;  1G3T A;  4A3K J;  5DV5 A;  2XV4 S;  2A5W A;  3QWL A;  4FCY A;  2CSO A;  5EG0 B;  4HNT A;  1W1W E;  4XKB A;  5E3M A;  3RYR A;  5D5X B;  4WWC A;  3LNQ A;  3CCL I;  1G8X A;  1WCM J;  1VQ4 I;  4BJ5 C;  1A04 A;  3WTZ A;  5TIS C;  2IS1 A;  2UXN A;  2DMQ A;  3WGH A;  2ZJQ F;  3JTG A;  1XGS A;  2DW4 A;  3IUO A;  2P8T A;  1AA7 A;  3FXQ A;  1U78 A;  4BHB A;  1QQI A;  4XON A;  3Q9V A;  3IKT A;  4HYE A;  5IP9 J;  5D5W B;  3ZRG A;  2KIS A;  3K9T A;  4DIQ A;  4HDU A;  3C18 A;  2LK2 A;  2FMY A;  3OYB A;  3FF5 A;  5CVU A;  4A5N A;  2XAU A;  2XAJ A;  4WF2 A;  5J8F A;  2ZJP F;  3DKY A;  3V4G A;  3ZMU A;  3IAM 2;  3KLN A;  1K4S A;  2CUF A;  3BR2 A;  2R7O A;  1HXD A;  4L5E A;  2K86 A;  3QU3 A;  2F5C A;  4BY1 J;  3I59 B;  1RNL A;  2QQ9 A;  4UUT A;  2OQR A;  1ETW A;  4HF0 A;  2DA7 A;  4HDV A;  2O5R A;  2WBM A;  5IYB J;  2EV5 A;  4G8X A;  2A68 F;  4PCQ A;  4RM2 A;  1SD4 A;  5L3B A;  1ACI A;  4B47 A;  5DUI A;  4G6D A;  1AKH B;  4HRI A;  3G2B A;  3V8K A;  3COA C;  1OCR H;  5M3M J;  2EFW A;  2W85 A;  5CLS A;  1VQ9 I;  3EPZ A;  1D8J A;  5IT9 Z;  4LJZ F;  1ZR2 A;  2CQN A;  1LQ1 A;  1T0F A;  1ETK A;  1N25 A;  2WTE A;  4IHS A;  4CCK A;  1HSJ A;  1KU2 A;  2YSR A;  3GTJ J;  2CJJ A;  1R49 A;  2X0L A;  1XMK A;  2WV0 A;  2HDW A;  1XG1 A;  4QLC U;  2RNJ A;  3HIF A;  1AOY A;  2CUJ A;  3LAP A;  1HA8 A;  2NS8 A;  1SMY F;  1WJE A;  3TKY A;  4BHP A;  3D1N I;  4HSR A;  5F04 A;  3ASN H;  4II2 A;  1B72 A;  2K9Q A;  1YX5 A;  1FTT A;  1FIA A;  1T56 A;  2J5P A;  2FQ3 A;  3S2H J;  3NWS A;  5ILV A;  3G1O A;  4BQO A;  3K4L A;  4F7Z A;  3CME I;  2GLO A;  3ELK A;  3P7N A;  2DMU A;  1KYW A;  4B8X A;  3HRS A;  2DMT A;  4P55 A;  4RGR A;  2W7N A;  3OSG A;  3H3U A;  3HOX J;  1BR1 A;  1OYY A;  4G7Z F;  4E7S A;  5EYR A;  2IAI A;  4NC7 A;  3RPU D;  2KIF A;  2NVT J;  2HPM A;  2MW8 A;  2KLO A;  5D6F A;  1N75 A;  2ACJ A;  2BXY A;  3PO2 J;  1I3Q J;  4P9U A;  2ZNZ A;  2VAS A;  3CJQ B;  1V55 H;  1WSU A;  3DTK A;  1XD7 A;  2E19 A;  5B3S H;  1POG A;  2O3F A;  1VZ0 A;  2UXX A;  2HXO A;  2IPQ X;  3GTP J;  2XSD C;  2IJL A;  3HSE A;  3WHB A;  3CC7 I;  4NNJ A;  3BY6 A;  3ONQ A;  4DGW B;  3ZXS A;  1ZR4 A;  1YRN A;  4PSX A;  1RC9 A;  1B6A A;  4U87 A;  1SAX A;  4DYR A;  1ETY A;  3HUG A;  4CCM A;  1DU0 A;  2K9L A;  4N0B A;  1HBX G;  3S16 J;  1FBQ A;  2IW5 A;  3HRU A;  3LSH A;  4OIQ F;  1BC8 C;  3HOW J;  1SD7 A;  3S3O A;  2OC6 A;  4E7K A;  1O7L A;  1SD6 A;  3CQZ J;  2IA1 A;  4I09 A;  2V26 A;  2ISY A;  1Z1D A;  2CFX A;  1W7P A;  2R93 J;  2DO7 A;  4XOP A;  2CV1 A;  1QZZ A;  1WI9 A;  4UUS A;  2K3F A;  4CYC A;  1U8B A;  5B1B H;  4A3E J;  4M6V A;  3NAR A;  1LE8 A;  3SZT A;  4I2O A;  4ZTJ A;  2JZY A;  4Y7N J;  1ZG1 A;  3GEZ A;  1OR7 C;  3ZP5 A;  4MTE A;  3BG9 A;  4NQW A;  3A4C A;  3KP7 A;  2NNY A;  2LH9 A;  4Y3O A;  5ICF A;  5LLQ A;  3J81 K;  5EG0 A;  4IX7 A;  1REP C;  2RDP A;  1QO0 D;  1U5T B;  1J9I A;  3L2U A;  4RGS A;  4RMN A;  3W6K B;  2HR3 A;  3DBH B;  2EIJ H;  2ZBK A;  1TW2 A;  2VN2 A;  3TO9 A;  4WXD A;  2F4O B;  3SFZ A;  5DEQ A;  2W24 A;  3OYH A;  1D3Y A;  2M7B A;  2IEK A;  2ZKZ A;  4FE4 A;  4J00 A;  3CDL A;  3DBR B;  2XHK A;  3BTI A;  3PUF A;  3L00 A;  2WY7 Q;  4XLP F;  1G3Y A;  3FXR A;  3G71 I;  1HW5 A;  4GXO A;  1IRF A;  3DTI A;  5HDN A;  2KT0 A;  1B1B A;  3S2W A;  4IHX A;  5FKL A;  1IN8 A;  2A5Y B;  1G2H A;  3OY9 A;  1JKO C;  5EDN A;  3M8E A;  2FX0 A;  2E5N A;  3HEF A;  4MFE A;  5GP9 A;  4MFD A;  3Q5F A;  3ULQ B;  5CVV A;  3T1B A;  3J81 Z;  1I6H J;  3KIO A;  2R7U A;  4KFC A;  2VT3 A;  2E7W A;  1QBJ A;  5CKT A;  3F8M A;  4ZYE A;  3ABU A;  4HA8 A;  1VQ6 I;  1T33 A;  2W4S A;  1G6N A;  4B48 A;  2P7V B;  1F9N A;  1X1P A;  5E79 C;  4HX4 A;  3BRO A;  3R6S A;  2F48 A;  1B9N A;  4Y33 A;  2O0Y A;  1WFX A;  2CGP A;  1V5G A;  3W6J B;  1D1A A;  4HW0 A;  1BN5 A;  2XRN A;  4IHW A;  2QQB A;  4OAZ A;  2ZFU A;  2VQH A;  2EB7 A;  1P6R A;  2ID3 A;  5HNH A;  4RB3 C;  2NYX A;  4N9I A;  1W36 D;  2N8G A;  5E3O A;  2P6S A;  3CUQ B;  3OOP A;  3S93 A;  3V42 A;  1U9O A;  2BE5 F;  1FX7 A;  3ECH A;  3Q9S A;  2W00 A;  5LGU A;  2WWY A;  1YJ9 I;  1ZRF A;  4TV7 A;  4IOA F;  1K78 B;  2XGC A;  3QYE A;  3I55 I;  2F2E A;  4UUV A;  2VL8 A;  2CO5 A;  4BJT A;  2Y69 H;  3O6B B;  1K61 A;  5EEG A;  3ZMD A;  3GTK J;  5TRD A;  3SDG A;  4HEA 2;  2CQ7 A;  5ICC A;  3TO7 A;  4ZYD A;  4YFX F;  5B66 C;  3CJN A;  1JGG A;  5LFA A;  2P81 A;  4NDL A;  1R71 A;  2V6E A;  3FXU A;  3JR9 A;  4Q47 A;  1U2W A;  3F6O A;  3HG9 A;  5FKN A;  2V4J C;  2VBY A;  3KZY A;  2MD5 A;  3IP4 B;  5J1Y A;  2MFZ A;  3ZMV A;  2XAH A;  3G73 A;  5KAI C;  4J19 A;  3KEY A;  4FAS D;  1RI7 A;  3BG3 A;  3JRA A;  3CUQ A;  3S3M A;  3EYI A;  3GFJ A;  4HBL A;  3KP6 A;  1YX3 A;  3VYT B;  1R6R A;  3K2A A;  2F5D A;  4CUG A;  4UV8 A;  3CF5 F;  2EFN A;  4AD9 A;  4GGG A;  3PUB A;  1TBX A;  5HLG A;  9ANT A;  1GV5 A;  3DU5 A;  2G7H A;  4IHV A;  3S17 J;  3FHN A;  2EPF A;  3BPV A;  3E6M A;  2OU2 A;  4M9S A;  2JN6 A;  2A07 F;  1SVO A;  2YU3 A;  3SYT A;  2HTS A;  3K1N A;  4PK4 A;  2RVC A;  3FIW A;  1H9G A;  3LA3 A;  2DDB A;  4CSW A;  4IRG A;  3DEU A;  3JSP A;  2DT5 A;  5BQT A;  1OKR A;  4UV9 A;  3TBI A;  4XLA A;  1SFO J;  1X4O A;  2DFI A;  3HPH A;  3P5J A;  2CRG A;  5K7Z A;  1I3A A;  4RAF A;  2X48 A;  1ORK A;  2UWM A;  2X1E A;  1W4M A;  4EGZ A;  4E4H A;  1YW9 A;  2A6E F;  1XN7 A;  3KET A;  2KJC A;  1DPR A;  3SHF A;  2HKX A;  4ABZ A;  2ETH A;  4E6K G;  3QYF A;  2XDV A;  1IRG A;  3G1M A;  2EK5 A;  3WU2 C;  2IP2 A;  2KIQ A;  3B02 A;  3BR5 A;  1PVE A;  2GAU A;  3BTL A;  3DEE A;  5DD8 A;  2QEX I;  3E5Q A;  1R4M B;  3HC7 A;  4OMY A;  3ZCO A;  4A2U A;  2MLK A;  1GVD A;  4OAY A;  2DA2 A;  3BDD A;  3F8B A;  1JJ8 C;  5F1J A;  2VOP A;  3I53 A;  1E2X A;  3PSI A;  3IRQ A;  3HRM A;  2FXA A;  2IBD A;  4HNV A;  1JXS A;  3NEU A;  2ZXH A;  3BTC A;  3OR1 C;  1Z9C A;  5F08 A;  2BYV E;  4L5I A;  2BW3 B;  3O2P E;  1MND A;  1VQN I;  2DN0 A;  1OCZ H;  4EV0 A;  1LKX A;  5LHI A;  2NVX J;  1V5F A;  1IW7 F;  2K7L A;  1HW1 A;  4G12 A;  2F4I A;  3QOD A;  3KEO A;  4HLY A;  2Y2Z A;  4ZJZ A;  2IXS A;  5EGO A;  2R5Z A;  1BW5 A;  3GO5 A;  2L9N A;  4CCO A;  3WTX C;  2YX7 A;  1VND A;  5A2Q K;  1FOY A;  3JRB A;  1IDY A;  4BL0 B;  2PJR A;  4C2T A;  1Y39 A;  2JSP A;  3K6G A;  2STT A;  5EZH A;  1TNT A;  2OPT A;  3MZH A;  1T8I A;  2E35 A;  2O8K A;  1TQP A;  2L02 A;  2M8E A;  4AIK A;  4IHY A;  2NNN A;  4HST A;  1YG2 A;  3KP4 A;  2PN6 A;  2W57 A;  4V2G A;  1W0T A;  4DYC A;  3OYG A;  1DDN A;  3HL2 A;  4R79 A;  2OCE A;  4GYG A;  4CHU A;  2FRH A;  2MAB A;  2I5U A;  1WRJ A;  2HVQ A;  3JRG A;  1UZC A;  2X6O A;  2OAZ A;  4ENM A;  3JRF A;  2KP6 A;  3PJR A;  3D5S C;  2P0W A;  2Y9Y A;  1T2K A;  3M1E A;  4XM3 A;  3EQL F;  4DNC A;  3EET A;  2R5Z B;  1SAN A;  3K10 A;  1ONV A;  2H6B A;  3NWT A;  1LDJ A;  2EZI A;  4P1W A;  5J8C A;  4IVN A;  3BR3 A;  2MBF A;  4RA2 A;  2JT1 A;  2LKX A;  3IRR A;  3F6V A;  2VBZ A;  1LVK A;  3OIQ A;  1TP4 A;  2DJN A;  4FIS A;  3R0J A;  3I9V 2;  1U6G A;  3LA7 A;  2Z2S B;  3F8F A;  3LQR A;  3FHZ A;  1EA3 A;  4JQF A;  1YJW I;  3W6V A;  3TL4 X;  1Y56 A;  3CES A;  2Y9Z A;  2VQG A;  3VSK A;  4JOM A;  2FBK A;  1OCT C;  3GCM A;  1YS6 A;  2CG4 A;  3P9K A;  4IL6 C;  2DTZ A;  4LIU A;  2DYS H;  4PJ0 C;  2JUG A;  3L2R A;  1R00 A;  1R1U A;  5BOX A;  3DPU A;  2JA6 J;  4A3C J;  1FOW A;  2F5V A;  2PI0 A;  1ZN2 A;  2LNB A;  1YIO A;  4D5C A;  3WGI A;  2H27 A;  1IN6 A;  2Y48 A;  1LDK B;  3VOD A;  4FE7 A;  3HOY J;  2EFO A;  2VON A;  1HDD C;  4AIJ A;  5FD6 A;  1VFC A;  5FKO A;  1TWG J;  2P4W A;  2VQC A;  4RLQ A;  2E2I J;  1TWF J;  5JVG F;  4HQM A;  2V9P A;  5HS7 A;  3V8J A;  1BR4 A;  4KMF A;  2L7Z A;  4XN0 A;  3LSJ A;  5J1R A;  3KFW X;  2VXD A;  3G4S I;  1FOX A;  2KPM A;  4CZC A;  2R7W A;  3EYY A;  4G6T B;  4RS8 A;  3LWF A;  4P5O A;  3BG7 A;  1MBH A;  1I1S A;  2M8G X;  1X19 A;  4XSX F;  2DDA A;  3MKZ A;  2DAO A;  2M34 A;  3KE2 A;  1ZG5 A;  2E2J J;  4A0Z A;  4LMY A;  5CYV A;  3BR0 A;  4YFK F;  1X3W B;  2E1M C;  1G4D A;  3H5R A;  1HLV A;  3L2Q A;  5LEK A;  4RGX A;  1P4X A;  1WI3 A;  2FE3 A;  2Y0M A;  3OIP A;  1K79 A;  2HGC A;  2BHZ A;  1BOB A;  4LIT A;  2H09 A;  5E17 F;  3KP2 A;  3KX2 A;  1FLI A;  3JAM Z;  5L3E A;  3ZQG A;  3RKY A;  2DPU A;  4UVB A;  4JBA A;  3DXJ F;  5J1U A;  2MLG A;  1X1C A;  4BAC A;  2DLL A;  2QM3 A;  3LMM A;  4EJU A;  2ISZ A;  4MQ9 F;  4XLE A;  2VOD A;  2KJB A;  2EV6 A;  5CPR B;  2HZD A;  5TGT A;  3Q0U A;  3DF8 A;  1L3L A;  1I50 J;  3JRE A;  5J4V A;  3MD2 A;  1Z21 A;  4CYD A;  1YFH A;  3HSR A;  3AAF A;  2ZXJ A;  2H1K A;  1JUM A;  1USS A;  2AHQ A;  1YLF A;  4A6E A;  5B5E C;  3F0C A;  2RKH A;  5CVR A;  3CCY A;  1KQ8 A;  2EZH A;  5ILU A;  2VBX A;  3GX4 X;  1PUF A;  1DPU A;  3W2A A;  2DA4 A;  2PMU A;  4O6J A;  2G7U A;  2VPL A;  2L7K A;  4AYB A;  2LBF A;  4UVA A;  4LIV A;  2JVH A;  2O8X A;  3BG5 A;  2GM4 A;  2HYG D;  2RQQ A;  2MH2 A;  3A0H C;  2OUM A;  1JTX A;  2YS9 A;  2JVG A;  4MEY F;  1YJN I;  5J40 A;  3I64 A;  3LSI A;  1K78 A;  2MC3 A;  2HVS A;  2VB6 A;  1HCR A;  1ZAR A;  4U0W A;  3QPT A;  3HZJ A;  4FHT A;  2IVM A;  2ELK A;  2VE8 A;  3PFY A;  4AC0 A;  2BVL A;  2RAE A;  2M0M A;  3GWZ A;  1YW7 A;  1RKW A;  2FF4 A;  1FJL A;  1EJ9 A;  2M3A A;  1MNM C;  2XF7 A;  2UUZ A;  1HF0 A;  1W7P B;  2BV6 A;  3LFK A;  1DGR M;  2LD5 A;  1UFM A;  4B3X A;  5J47 A;  3WTU C;  4D0P A;  3WU1 B;  3DLL F;  2ZME B;  1W5C C;  2IRF G;  5AON A;  2BBY A;  1YS7 A;  3DKW A;  1R22 A;  1ZRD A;  2ECC A;  3LAJ A;  4M72 A;  3I58 A;  3JW4 A;  5K5Q A;  4YFN F;  2L9V A;  4BS9 A;  3HDD A;  1OR7 A;  5JI6 A;  3N4M A;  2PQ8 A;  2VJI A;  3PNT A;  3LSR A;  3ERM A;  4I02 A;  3C2B A;  1FYK A;  4B1R A;  4AU7 A;  1IGN A;  1UCR A;  2ZXW H;  2JRT A;  3I3L A;  2COB A;  4RM3 A;  2FNP A;  3HOS A;  4GDF A;  4ZDP A;  3S15 J;  3AG2 H;  2HWV A;  1OQY A;  4I99 C;  2GA2 A;  2PMH A;  2EQR A;  1R5G A;  1W7P D;  1T98 A;  5GAE J;  4ESF A;  1ZGJ A;  2GXG A;  1S9H A;  1X58 A;  4KIC A;  2E60 A;  4D1Q A;  4C2U A;  2CQK A;  3IHU A;  4D7M A;  3EUA A;  5EEH A;  2HVR A;  2EZL A;  3VB2 A;  1JUP A;  3ZQH A;  5K7H A;  3RZO J;  2OBP A;  3E97 A;  2H6C A;  3WHC A;  1H0M A;  1MSE C;  1PUF B;  3QOP A;  4AIH A;  3NRV A;  1J5Y A;  4A0X A;  1O4X A;  3BJO A;  3L2W A;  5GPC A;  2DPD A;  4C3H J;  3RJP A;  1J75 A;  2IGN A;  1KYZ A;  1C0W A;  1FSE A;  4PJM A;  5FFZ A;  1JJ6 C;  4BQN A;  3CD6 I;  2WY8 Q;  3D5L A;  1XTA A;  2GWR A;  2KFD A;  2XC7 A;  5IYD J;  1SFK A;  3BLY A;  2CQX A;  3WE2 A;  3AL0 B;  2QCO A;  3K4K A;  3Q0V A;  4Y52 J;  3I0T A;  3RTR A;  2O61 A;  5FLX Z;  3DKX A;  2L01 A;  5ILS A;  3GZ6 A;  1LEA A;  2O03 A;  4BAY A;  3V7R A;  3PFI A;  5CQE A;  3TO6 A;  2M0C A;  3I4P A;  2KIU A;  1WJB A;  3L09 A;  1R1V A;  2L4A A;  4MO7 A;  2L3D A;  4W1U A;  2MYS A;  2HYF A;  3H3Z A;  1KU3 A;  4HPQ A;  2R7Q A;  4PFO A;  3VSL A;  4HV6 A;  4HZF A;  2PMZ A;  2CU7 A;  2XSJ C;  1IG7 A;  1VQ7 I;  2R4G A;  4U0Y A;  3CC2 I;  3OYD A;  3UNG C;  2FU4 A;  4OIO F;  2KZV A;  3SXY A;  1VQL I;  3GFI A;  1FP1 D;  4LG3 A;  4HQE A;  2FUG 2;  1RUN A;  1ON2 A;  2VKE A;  1TT5 B;  4YIR X;  3ZMT A;  3V7C A;  1MDM A;  2IA2 A;  2XVC A;  4BBR J;  2RGV A;  2HXI A;  1P7J A;  3B6C A;  3BCB A;  1DP3 A;  3H36 A;  5LRS A;  2W48 A;  2VJ5 A;  3FMQ A;  2GXA A;  3SFI A;  3H1C A;  4YG2 F;  2HZT A;  2W25 A;  3DBL B;  3A1Y A;  3QPL A;  4GCV A;  4JK1 X;  4PFP A;  5L3F A;  4PJN A;  4IKF A;  1K83 J;  3G1L A;  3F8C A;  1EH8 A;  3CUQ C;  2XAG A;  1F5T A;  2WB1 N;  2JPB A;  1J7K A;  2QQ8 A;  2GBY A;  1V54 H;  5FFX A;  2A6T A;  2JJ7 A;  2R7F A;  3E3V A;  1I1G A;  2K9N A;  2VUM J;  4L9V A;  4NUB A;  2DFH A;  4XR6 A;  1XX5 A;  5E8G A;  2HYJ A;  4MTD A;  2JA2 A;  3Q3S A;  3H9J A;  1NK2 P;  2IT0 A;  4WK8 F;  3CO6 C;  4DW6 A;  1S6L A;  1VQK I;  5D8K B;  1IXR C;  2E1N A;  4OWR B;  2V9K A;  1TWH J;  4XBF A;  1O3S A;  1I5Z A;  1Z6T A;  1WWX A;  4R8H A;  1FYM A;  1LFB A;  1SMT A;  5IY5 H;  2YPR A;  4EM0 B;  3DLA A;  2B0L A; 
#chains in the Genus database with same CATH homology
 4LK0 F;  3GUD A;  3E5U A;  4EM2 A;  1O3T A;  3V7S A;  3GLX A;  1IXS B;  1BBY A;  4KIB A;  1T38 A;  5D4S A;  2KRF A;  4EJV A;  3TQN A;  3KLO A;  2AS5 F;  1OPC A;  1CF7 B;  2XAF A;  1FYL A;  2P6T A;  4I01 A;  5HS9 A;  2D1H A;  5LEJ A;  1YYV A;  2FEZ A;  4A6D A;  1F4K A;  1W5S A;  4LD5 A;  3U2R A;  5ERI A;  2FA5 A;  3T8R A;  1U8R A;  1WQ2 A;  5H20 A;  3LST A;  5DYM A;  4LG0 B;  2DQR A;  3IWF A;  4P96 A;  3GXO A;  1D5V A;  3GYH X;  1TQM A;  4O5V A;  2XUB A;  4EJO A;  2ZNY A;  1IAW A;  3I59 A;  5L3D A;  1G3W A;  1BI2 A;  4ON0 A;  5J6X A;  3WTT C;  1O3R A;  2HDC A;  4LK1 F;  2EFP A;  1O7F A;  3HOT A;  1LVA A;  3MZY A;  2HQN A;  2P5V A;  4G7O F;  3T0Y A;  3TGN A;  4KDP A;  2X4H A;  1S29 A;  3CO7 C;  5JR3 A;  3R4K A;  4LLN A;  4UNO A;  5HLH A;  1OMI A;  4U88 A;  3DP7 A;  5HLI A;  5D6E A;  2HEO A;  2D2W A;  3KZZ A;  1S8N A;  4RB0 A;  2NRA C;  4MNU A;  4U0V A;  5DCM B;  3HHH A;  3MWM A;  4I0A A;  2XIG A;  3QP5 A;  4OOI A;  1FWZ A;  2FBI A;  4KT5 C;  1LEB A;  2MH9 A;  5BPD A;  1KGS A;  3CTA A;  3P9I A;  3RKW A;  4LFU A;  1XDS A;  4B09 A;  4MGR A;  1JHF A;  1LB2 A;  5LRR A;  3I71 A;  2DK8 A;  4RGU A;  3FWE A;  4KYW A;  5JFR A;  4Q4Z F;  4KUM A;  3NQO A;  2JPC A;  5IT3 A;  3E6B A;  2M45 A;  1U3E M;  5LHG A;  1FOK A;  3BJ6 A;  5E1Z B;  1TLH B;  3L2C A;  4K2E A;  4UVC A;  3TDU C;  5F6F A;  4Q5S F;  2Z3Y A;  3JSO A;  2L4M A;  3N97 A;  1EH6 A;  1PP7 U;  4AWX B;  2DBB A;  1FC3 A;  2AXL A;  2LSO A;  3QU6 A;  3E6C C;  3I54 A;  2QUF A;  1BI0 A;  3BOQ A;  4CXF A;  1ZRE A;  3QPH A;  1P92 A;  2K27 A;  3ROU A;  1RIO H;  4FX0 A;  4MEX F;  3G3Z A;  3PQK A;  2VBW A;  4M6Y A;  2OZU A;  1B4A A;  5JHU A;  5HDG A;  3IL2 A;  1FNN A;  4A12 A;  4EJW A;  2P5K A;  6PAX A;  1J2X A;  4GO1 A;  1MD0 A;  4LLG F;  1R7J A;  1SFE A;  1FY7 A;  2A6H F;  5FD5 A;  1HKS A;  3ISP A;  4A5M A;  2J5O A;  2HQR A;  3RPU A;  2XKP A;  1KU9 A;  2XGX A;  2Y75 A;  1E17 A;  2R7D A;  2LF7 A;  1XGM A;  2RC4 A;  5LGT A;  3ZQ7 A;  1BIB A;  4HX7 A;  2ZFW A;  1XSX A;  3ZMZ A;  4ZYG A;  2DK5 A;  2E7X A;  2HFH A;  5HVQ C;  2G9W A;  2ELH A;  5BMZ A;  3BPX A;  1U5T C;  2COM A;  1GVJ A;  2NS0 A;  4M74 A;  1PDN C;  4M9Z A;  3VOE A;  4R1H A;  2DU9 A;  1XGN A;  4OU0 A;  3P9C A;  4IRI A;  2CYY A;  1GHC A;  3JTH A;  5FGM A;  4OMZ A;  1ZLJ A;  4LGW A;  4G6Q A;  3DV8 A;  3BWG A;  3QAH A;  5KVR A;  2HTJ A;  2D45 A;  4RB1 A;  2Z9O A;  4EMS A;  1P4A A;  2ESN A;  1BIA A;  5H6R A;  2V9V A;  1DP7 P;  2K4J A;  3MEX A;  4L18 B;  1KQ9 A;  3VEP A;  4BH9 A;  3K2Z A;  2STW A;  5ICG A;  2JTV A;  4KN4 X;  1MJB A;  4WX9 A;  4L9T A;  1TQI A;  2Z33 A;  2KKO A;  4I98 B;  2UZK A;  1IN4 A;  1QGP A;  4YIF A;  2DI3 A;  4WXH A;  4IJA A;  1DUX C;  3WTW C;  4EGY A;  3WOD F;  2PFB A;  1T39 A;  2XAQ A;  2QLZ A;  2M5W A;  3V8L A;  4I7H A;  3ECO A;  4BNC A;  1U5T A;  1UST A;  2OQG A;  4ENK A;  1YW8 A;  2EA4 A;  1GXP A;  1Z91 A;  4ETS A;  4HF1 A;  1L0O C;  3QRF F;  1GXQ A;  2QZ8 A;  3DQV C;  2WC2 A;  3WTV C;  2FOK A;  1BM9 A;  5BPI A;  2LDU A;  4OIN F;  4CDG A;  1F1Z A;  1S7O A;  4HOB A;  3SZP A;  1KQ0 A;  2EV0 A;  3HTU A;  2HS5 A;  1ZYR F;  4ASN A;  4GYI A;  2PJP A;  1ZH5 A;  1X3U A;  2V1D A;  3TDZ C;  1D8K A;  1W5T A;  5E18 F;  4M71 A;  5F1R A;  3CDH A;  2H94 A;  1P2F A;  2Q0O A;  2CW0 F;  3QP6 A;  1IN5 A;  1T6S A;  4IF4 A;  1BI1 A;  3C7J A;  5F64 A;  2KIM A;  4CO8 A;  3F3X A;  2DTR A;  2W84 A;  1FP2 A;  1V4R A;  5D5V B;  4M73 A;  4L9J A;  3J7A O;  3F22 A;  2FNA A;  4CZZ A;  3MCZ A;  3M7G A;  3FM5 A;  2GA1 A;  1ULY A;  1OYI A;  4XSZ F;  4U7D A;  3WGG A;  5D5U B;  4L9N A;  3BJA A;  2EWN A;  2K4B A;  3U1D A;  3GFM A;  4EQQ A;  4HF2 A;  3H92 A;  2QBY B;  5CVJ A;  1QPM A;  1CGP A;  2VT2 A;  2O6G E;  3KCC A;  2L54 A;  5AIP A;  1MGT A;  3FM3 A;  5CJ9 A;  3RI4 A;  3I5U A;  1PP8 F;  1Z6R A;  2LF8 A;  3D0S A;  2PBI A;  2XKO A;  1SD5 A;  3IWZ A;  4ENN A;  2K02 A;  2JSC A;  4PGH A;  1EH7 A;  4LG0 A;  5L3C A;  5E1W A;  4PDK A;  2ZME A;  1UHW A;  2VC1 A;  1S3J A;  3RYP A;  1JE8 A;  2BEO A;  2FSW A;  3HYI A;  5D4R A;  2LKP A;  2VC0 A;  5DDG A;  5L3G A;  2BGC A;  2HKO A;  3R60 A;  2YR2 A;  3U9G A;  2QYO A;  2XRO A;  3HSF A;  3DFG A;  4MHG A;  1IZ1 A;  5LHH A;  1XCV A;  4CIC A;  4S04 A;  5LBQ A;  4XRF A;  1XMA A;  4DQ2 A;  1UB9 A;  2TDX A;  1FBS A;  3TOB A;  1XSV A;  3PQJ A;  2Z5U A;  4QWQ A;  2ZO4 A;  1YTY A;  4N9H A;  1V3F A;  4UHT A;  2V6C A;  4RAY A;  1KA8 A;  2V1U A;  2V1X A;  4P9F A;  2Q8K A;  1XSD A;  1JGS A;  2EJR A;  3L7W A;  1BC7 C;  3ERE D;  5DD4 A;  3HTS B;  1HKT A;  4UXN A;  4LLL A;  1XCB A;  3CLO A;  1LNW A;  3BZ6 A;  3GZ5 A;  2IA0 A;  1AWC A;  2F5F A;  4I0B A;  3GW2 A;  2CWE A;  2RQP A;  5DCF A;  4ZZD A;  2QEN A;  2ZJ2 A;  1VTN C;  1BOA A;  4RB2 C;  4L0Y B;  1Z05 A;  1RUO A;  2NAZ A;  2GZW A;  3MQ0 A;  4G94 A;  1KU7 A;  1MKM A;  2GXB A;  1SFX A;  4LB5 A;  1XGO A;  1QNT A;  1ZG3 A;  3WTY C;  3ZN0 A;  1RZ4 A;  4NB5 A;  2C6Y A;  2FBH A;  1SFU A;  5D8L B;  3E5X A;  2QQA A;  3F21 A;  1R36 A;  2ADU A;  2GIV A;  5LGN A;  2M30 A;  1LJ9 A;  1PUE E;  4MQV A;  4A0Y A;  1R1T A;  4KMU X;  2D1V A;  2MA3 A;  3LA2 A;  5K5O A;  3SQN A;  3WG9 A;  1H9T A;  4HV5 A;  3KP5 A;  3TOA A;  1IF1 A;  1R5H A;  3VFZ A;  1R23 A;  1K6O A;  3EUH A;  3K1M A;  4EJT A;  2VXZ A;  4G9Y A;  2P5L C;  4ESJ A;  1R58 A;  3WE3 A;  3R61 A;  1YQA A;  3FMS A;  5JVT A;  5HDK A;  2QWW A;  3WTS C;  1ZGA A;  3GFL A;  1ZRC A;  2V79 A;  4HAM A;  3M8F A;  4E70 A;  3IC7 A;  4FX4 A;  4Q48 A;  2XAS A;  4S05 A;  1IN7 A;  4M9X A;  1HKQ A;  2OD5 A;  5E20 A;  1ZHF A;  2M87 A;  3J80 Z;  2RV8 A;  3RIR A;  1ODD A;  1STZ A;  3T5X A;  2RN7 A;  4ZZL A;  4M6X A;  5E1X A;  5DUK A;  4BYY A;  2ZCW A;  2F5E A;  3RKX A;  2PG4 A;  3OV8 A;  1FZP B;  4IHT A;  1I6X A;  3REO A;  1ZLK A;  2QVO A;  2PLY A;  1ZAO A;  4KA4 A;  4AVP A;  3LQQ A;  1FPQ A;  4H0E A;  4HLX A;  1FT9 A;  1O57 A;  1MJA A;  5HOO A;  1HQC A;  4YII A;  4Y17 A;  3WU0 A;  3K69 A;  1XDU A;  3HRT A;  3ZPL A;  4IPA A;  3GF2 A;  4Y15 A;  3L9F A;  3DPT A;  4OIR F;  4BHC A;  4ESB A;  1EV7 A;  4HX8 A;  5E8I A;  3FX3 A;  5A2Q Z;  1XB4 A;  1OYW A;  4Y13 A;  4CGZ A;  3IKV A;  2EFQ A;  5HS8 A;  1O3Q A;  1BI3 A;  2A69 F;  1IUY A;  1I27 A;  3BP8 A;  1S7A A;  2EA2 A;  5DCM A;  2GQQ A;  3RDI A;  5FB2 A;  3MFK A;  2DQL A;  1FSH A;  3K0L A;  1NHA A;  4FT8 A;  2FML A;  5FLX K;  2Q2E A;  1MDM B;  1P4W A;  1J0R A;  1K7A A;  4RAZ A;  5BS6 A;  4EVI A;  3F72 A;  4NHJ A;  1G3S A;  4G7H F;  4WXC A;  1CF7 A;  3JAM K;  3T8T A;  3ZMS A;  4KIG A;  2M1B A;  4ENJ A;  4O3M A;  1Z7U A;  3M9A A;  1JHH A;  3O3K A;  1B59 A;  1YO5 C;  3HHG A;  5H6Q A;  2QBY A;  1TW3 A;  3RPQ A;  2PEX A;  3F23 A;  4IXA A;  3B73 A;  5FO5 A;  2A3S A;  3EDP A;  1Q1H A;  2OZ6 A;  2VE9 A;  4PZJ A;  3ML6 A;  1WKM A;  1HST A;  1BJA A;  4KIF A;  1HW2 A;  1UHM A;  4KN7 X;  3GVA A;  4LB6 B;  1MZB A;  3ZN1 A;  3F8N A;  4ZYH A;  1TTY A;  1TNS A;  4U7B A;  2ESH A;  3MAJ A;  1IXC A;  1ON1 A;  4BXU A;  5K5R A;  3KEQ A;  1J59 A;  2OA4 A;  5K1Y A;  2HOE A;  3CUO A;  2R3S A;  3C3W A;  3FMR A;  1FBU A;  3C1D A;  4OIP F;  4IRH A;  2E1C A;  2A61 A;  2P7C B;  4XLN F;  5TJJ A;  1MJ9 A;  2VOO A;  1QZY A;  5CVI A;  2YX4 A;  5AIQ A;  2Z99 A;  3DPL C;  1LDD A;  5ED4 A;  3ABT A;  4L5J A;  4KNY A;  3KP3 A;  5ICE A;  3FZV A;  4PGG A;  4L0Z B;  4ZH4 F;  3R0A A;  1Y0U A;  1B9M A;  5KK1 A;  3J80 K;  4Z2Y A;  4BQA A;  3E6D A;  3K1P A;  4WCG A;  4EM1 A;  1G3T A;  5DV5 A;  2XV4 S;  2CSO A;  4WWC A;  3RYR A;  5D5X B;  1A04 A;  3WTZ A;  2UXN A;  3WGH A;  3JTG A;  1XGS A;  2DW4 A;  2P8T A;  3FXQ A;  1U78 A;  4BHB A;  1QQI A;  3Q9V A;  3IKT A;  4HYE A;  5D5W B;  3K9T A;  4HDU A;  3C18 A;  2FMY A;  3FF5 A;  5CVU A;  4A5N A;  2XAJ A;  4WF2 A;  5J8F A;  3V4G A;  3ZMU A;  3KLN A;  1HXD A;  2K86 A;  3QU3 A;  2F5C A;  3I59 B;  1RNL A;  2QQ9 A;  2OQR A;  4HF0 A;  4HDV A;  2EV5 A;  4G8X A;  2A68 F;  4PCQ A;  1SD4 A;  5L3B A;  5DUI A;  4G6D A;  3V8K A;  3COA C;  2EFW A;  2W85 A;  5CLS A;  1D8J A;  5IT9 Z;  4LJZ F;  1LQ1 A;  1T0F A;  2WTE A;  4IHS A;  1HSJ A;  1KU2 A;  2YSR A;  2X0L A;  1XMK A;  2WV0 A;  4QLC U;  2RNJ A;  3HIF A;  1AOY A;  3LAP A;  1SMY F;  3TKY A;  4BHP A;  2J5P A;  2FQ3 A;  5ILV A;  4F7Z A;  3ELK A;  3P7N A;  1KYW A;  4B8X A;  3HRS A;  4P55 A;  4RGR A;  3H3U A;  1OYY A;  4G7Z F;  2KIF A;  5D6F A;  2ACJ A;  4P9U A;  2ZNZ A;  1WSU A;  1XD7 A;  2O3F A;  2UXX A;  2IPQ X;  2IJL A;  3HSE A;  3BY6 A;  1B6A A;  1SAX A;  3HUG A;  4N0B A;  1HBX G;  1FBQ A;  2IW5 A;  3HRU A;  4OIQ F;  1BC8 C;  1SD7 A;  1O7L A;  1SD6 A;  2IA1 A;  4I09 A;  2ISY A;  1Z1D A;  2CFX A;  1W7P A;  2DO7 A;  1QZZ A;  1WI9 A;  3SZT A;  4I2O A;  2JZY A;  1ZG1 A;  3GEZ A;  3ZP5 A;  4MTE A;  4NQW A;  3KP7 A;  2NNY A;  5ICF A;  5LLQ A;  1REP C;  3J81 K;  2RDP A;  1QO0 D;  1U5T B;  1J9I A;  4RGS A;  3W6K B;  2HR3 A;  2ZBK A;  1TW2 A;  2VN2 A;  3TO9 A;  4WXD A;  3SFZ A;  5DEQ A;  2W24 A;  1D3Y A;  2ZKZ A;  2XHK A;  3L00 A;  4XLP F;  1G3Y A;  3FXR A;  1HW5 A;  4GXO A;  1IRF A;  5HDN A;  1B1B A;  3S2W A;  1IN8 A;  2A5Y B;  3M8E A;  3Q5F A;  3ULQ B;  5CVV A;  3T1B A;  3J81 Z;  4KFC A;  2VT3 A;  2E7W A;  1QBJ A;  3F8M A;  4ZYE A;  3ABU A;  4HA8 A;  1G6N A;  2P7V B;  1F9N A;  4HX4 A;  3BRO A;  3R6S A;  1B9N A;  2O0Y A;  2CGP A;  3W6J B;  4HW0 A;  1BN5 A;  2XRN A;  2QQB A;  2EB7 A;  1P6R A;  4RB3 C;  2NYX A;  4N9I A;  2P6S A;  3CUQ B;  3OOP A;  2BE5 F;  1FX7 A;  2WWY A;  3ECH A;  3Q9S A;  5LGU A;  1ZRF A;  4TV7 A;  1K78 B;  2F2E A;  4UUV A;  2CO5 A;  3O6B B;  5EEG A;  3ZMD A;  5TRD A;  5ICC A;  3TO7 A;  4ZYD A;  4YFX F;  3CJN A;  3FXU A;  4Q47 A;  1U2W A;  3F6O A;  2VBY A;  3KZY A;  2MD5 A;  3ZMV A;  2XAH A;  3G73 A;  1RI7 A;  3EYI A;  3CUQ A;  3GFJ A;  4HBL A;  3KP6 A;  2F5D A;  4UV8 A;  2EFN A;  4AD9 A;  4GGG A;  1TBX A;  5HLG A;  2G7H A;  3BPV A;  3E6M A;  2OU2 A;  4M9S A;  2A07 F;  2YU3 A;  2HTS A;  3K1N A;  2RVC A;  1H9G A;  3LA3 A;  4IRG A;  3DEU A;  3JSP A;  2DT5 A;  5BQT A;  1OKR A;  4UV9 A;  2DFI A;  2UWM A;  4EGZ A;  1W4M A;  1YW9 A;  2A6E F;  1XN7 A;  3KET A;  2KJC A;  1DPR A;  3SHF A;  2HKX A;  2ETH A;  1IRG A;  2EK5 A;  2IP2 A;  3B02 A;  2GAU A;  5DD8 A;  3E5Q A;  4OMY A;  4A2U A;  2MLK A;  3BDD A;  3F8B A;  2VOP A;  3I53 A;  1E2X A;  3IRQ A;  3HRM A;  2FXA A;  1JXS A;  3NEU A;  1Z9C A;  2BYV E;  4L5I A;  3O2P E;  4EV0 A;  5LHI A;  1IW7 F;  2K7L A;  1HW1 A;  3KEO A;  4HLY A;  3GO5 A;  3WTX C;  2YX7 A;  5A2Q K;  2STT A;  1TNT A;  3MZH A;  1TQP A;  2L02 A;  2M8E A;  4AIK A;  2NNN A;  1YG2 A;  3KP4 A;  2PN6 A;  2W57 A;  1DDN A;  4R79 A;  4GYG A;  4CHU A;  2FRH A;  1WRJ A;  2OAZ A;  4ENM A;  1T2K A;  3M1E A;  3EQL F;  4DNC A;  3EET A;  1ONV A;  2H6B A;  1LDJ A;  5J8C A;  4IVN A;  2MBF A;  2JT1 A;  3IRR A;  3F6V A;  2VBZ A;  3R0J A;  1U6G A;  3LA7 A;  3F8F A;  3LQR A;  3FHZ A;  4JQF A;  2FBK A;  1YS6 A;  2CG4 A;  3P9K A;  5BOX A;  1R00 A;  1R1U A;  2PI0 A;  1ZN2 A;  2LNB A;  1YIO A;  3WGI A;  2H27 A;  1IN6 A;  2Y48 A;  1LDK B;  3VOD A;  2EFO A;  2VON A;  4AIJ A;  5FD6 A;  2P4W A;  4HQM A;  5HS7 A;  3V8J A;  4KMF A;  3KFW X;  3EYY A;  4RS8 A;  3LWF A;  4P5O A;  1I1S A;  4XSX F;  2DAO A;  1ZG5 A;  3KE2 A;  4A0Z A;  4LMY A;  5CYV A;  4YFK F;  1G4D A;  5LEK A;  4RGX A;  1P4X A;  2FE3 A;  2Y0M A;  1K79 A;  2HGC A;  2H09 A;  5E17 F;  3KP2 A;  1FLI A;  3JAM Z;  5L3E A;  3RKY A;  2DPU A;  4UVB A;  4JBA A;  3DXJ F;  2MLG A;  2DLL A;  2QM3 A;  4EJU A;  2ISZ A;  4MQ9 F;  2VOD A;  2KJB A;  2EV6 A;  3DF8 A;  1L3L A;  4CYD A;  1YFH A;  3HSR A;  3AAF A;  2ZXJ A;  1USS A;  1YLF A;  4A6E A;  2RKH A;  5CVR A;  1KQ8 A;  5ILU A;  2VBX A;  3GX4 X;  1DPU A;  2PMU A;  4O6J A;  2G7U A;  4UVA A;  2O8X A;  2HYG D;  2MH2 A;  4MEY F;  3I64 A;  1K78 A;  2MC3 A;  1ZAR A;  4U0W A;  3QPT A;  4FHT A;  2IVM A;  2VE8 A;  3GWZ A;  1YW7 A;  2FF4 A;  1W7P B;  2BV6 A;  3LFK A;  1UFM A;  3WTU C;  4D0P A;  3WU1 B;  2ZME B;  2IRF G;  5AON A;  2BBY A;  1YS7 A;  3DKW A;  1R22 A;  1ZRD A;  3LAJ A;  4M72 A;  3I58 A;  3JW4 A;  5K5Q A;  4YFN F;  1OR7 A;  5JI6 A;  3N4M A;  2PQ8 A;  4I02 A;  1FYK A;  1UCR A;  2JRT A;  3HOS A;  2FNP A;  2HWV A;  2GA2 A;  2PMH A;  1R5G A;  1W7P D;  1T98 A;  4ESF A;  1ZGJ A;  2GXG A;  4KIC A;  2CQK A;  3IHU A;  5EEH A;  3VB2 A;  2OBP A;  3E97 A;  2H6C A;  1H0M A;  3QOP A;  4AIH A;  3NRV A;  1J5Y A;  4A0X A;  3BJO A;  2DPD A;  3RJP A;  1J75 A;  1C0W A;  1KYZ A;  1FSE A;  5FFZ A;  3D5L A;  2GWR A;  3WE2 A;  3I0T A;  3RTR A;  2O61 A;  5FLX Z;  2L01 A;  5ILS A;  3GZ6 A;  1LEA A;  2O03 A;  4BAY A;  3V7R A;  3PFI A;  3TO6 A;  3I4P A;  2KIU A;  3L09 A;  1R1V A;  2L4A A;  2L3D A;  2HYF A;  3H3Z A;  1KU3 A;  4HV6 A;  4HZF A;  4U0Y A;  2FU4 A;  4OIO F;  3SXY A;  3GFI A;  1FP1 D;  4HQE A;  1RUN A;  1ON2 A;  3ZMT A;  3V7C A;  1MDM A;  2IA2 A;  2XVC A;  2RGV A;  5LRS A;  3FMQ A;  4YG2 F;  2HZT A;  2W25 A;  5L3F A;  4GCV A;  4JK1 X;  5IT9 K;  3F8C A;  1EH8 A;  3CUQ C;  2XAG A;  1F5T A;  2JPB A;  1J7K A;  5FFX A;  2R7F A;  3E3V A;  1I1G A;  4L9V A;  5E8G A;  4MTD A;  2IT0 A;  4WK8 F;  3CO6 C;  1S6L A;  5D8K B;  1IXR C;  2E1N A;  4XBF A;  1O3S A;  1I5Z A;  1Z6T A;  1WWX A;  4R8H A;  1FYM A;  1SMT A;  2YPR A;  4EM0 B;  2B0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...