4A24A

Structural and functional analysis of the deaf-1 and bs69 mynd domains
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
GAMEQSCVNCGREAMSECTGCHKVNYCSTFCQRKDWKDHQHICGQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Analysis of the Deaf-1 and Bs69 Mynd Domains.
pubmed doi rcsb
molecule keywords DEFORMED EPIDERMAL AUTOREGULATORY FACTOR 1 HOMOLOG
molecule tags Transcription
source organism Homo sapiens
total genus 10
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.180 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 4a24A00
3OXGA 5CCLA 2JW6A 3MEKA 3OXFA 5HI7A 3QWPA 2ODDA 3PDNA 5EX0A 3RU0A 5CCMA 2OD1A 5HQ8A 3OXLA 4A24A 5EX3A
chains in the Genus database with same CATH superfamily
1MJBA 2N1AB 2YUUA 4FKDA 1TUSA 4MPIA 2LUYA 2GIVA 1HDLA 3TO6A 1TURA 2W0TA 5FUYA 2OU2A 1WGCA 2JA1A 2B8TA 3HH2C 1SGRI 1WKXA 1PCEA 4OVOA 3MEKA 1UVGA 2QQDA 2V1CC 2X52A 3E2IA 2ODDA 2UVOA 1FYBA 1PPFI 2JZMA 1TBRR 1FAQA 4WP4A 2ENNA 1MJAA 1VDDA 2JYYA 2M5XA 2NU2I 1CT2I 2PQ8A 1R79A 2N52A 3FSYA 3SEKC 1PTQA 1TBNA 1XX6A 2E5RA 3OXFA 5J8CA 1Y8FA 1HJAI 4B6DA 4E1PA 2JXDA 1W4RA 2OVOA 3RU0A 1BUSA 2ROWA 1SGPI 2N17A 3QAHA 1OVOA 1PTRA 1CGII 1UUCA 2A20A 2ARPF 2DB6A 1V1IA 2WGCA 2SGEI 3B4VC 2CJSC 4UXHA 1LR7A 3VE5A 2J9RA 1HPTA 2GVIA 1IW4A 1YU6C 1YTPA 3D00A 4DNCA 2P6AC 1K7UA 2V1CA 2RC4A 2SGDI 3BJIA 2UZ3A 2DIPA 2ERWA 1WGTA 1FARA 1R0RI 3FC3A 1Z2IA 4UXIA 4A24A 3OXGA 3SGQI 5CCLA 2FNFX 2KCXA 1UHAA 1X74A 1OMTA 1Y1BA 1Z7KB 2CWFA 2YQPA 1LR9A 1TBOA 5HI7A 7WGAA 5E3RA 2CWGA 4GI3C 1DS3I 1X4SA 3QWPA 1KBFA 3GOXA 5JHWC 2XRCA 5FUWA 5EX3A 5E3QA 3OL0A 1N13A 2LB7A 3UGDA 2NU3I 1M8CA 1NXUA 2J87A 2DKVA 3PDNA 3UGLA 1AN1I 1ULNA 2L7XA 9WGAA 2SGQI 4JCVE 1K7TA 1P9GA 2N71A 2OD1A 5HQ8A 3R5BA 2L8EA 3R5DA 4HGUA 1IY6A 2JW6A 2SGPI 3UEYA 5J8FA 1XA6A 3VDPA 5DAEA 3TOAA 1CT0I 2BUSA 1TGSI 1S20A 2NU4I 1CT4I 1LR8A 3E59A 3TOBA 2RIJA 2WVJA 3UFFA 2VRWB 5CCMA 2GKTI 2ELIA 1OYVI 1ULKA 4L9MA 3UOEA 1BMOA 3TJQA 3VDUA 3R5CA 2F3CI 1KMAA 2X3TA 1RFHA 2GKVA 2QQEA 4UXJA 5FUVA 1MT1A 5EX0A 1DS2I 1V1HA 1Y1CA 3QTLD 1TOTA 1M8BA 3OVOA 3SGBI 2NU0I 1SGNI 1UVFA 4SGBI 1K7VA 3CXLA 2KMPA 2Y0MA 1HEVA 1TIHA 1OMUA 1SGDI 1SGYI 1WTJA 1CGJI 2ENZA 2K9HA 2KMRA 1CE3A 5E3PA 1MJ9A 5FUXA 1U5KA 2QPOA 2LEOA 1P9ZA 1PJUA 1SGEI 3OXLA 3TO9A 4AMLA 2ORWA 1NUBA 2V53A 3KY9A 1Q9BA 1IY5A 1W3SA 2ORVA 2KMQA 1H0ZA 2KMOA 1TBQR 2QQ0A 4E1RA 3UEJA 1SGQI 2B0UC 2WCYA 1CSOI 2QQCA 3UGIA 2SGFI 2OZUA 2CWHA 1KBEA 3R5AA 1CHOI 2NU1I 1ULMA 2GKRI 3FSXA 3TO7A 2E73A 1FY7A 1XBTA
chains in the Genus database with same CATH topology
2N1AB 2YUUA 4FKDA 1TUSA 2LUYA 1HDLA 1TURA 2W0TA 5FUYA 2JA1A 2B8TA 3HH2C 1SGRI 1PCEA 4OVOA 3MEKA 1UVGA 2QQDA 2V1CC 3E2IA 1FYBA 2ODDA 1PPFI 2JZMA 1TBRR 1FAQA 2ENNA 1VDDA 2JYYA 2M5XA 2NU2I 1CT2I 1R79A 2N52A 3SEKC 1PTQA 1TBNA 1XX6A 2E5RA 3OXFA 1Y8FA 1HJAI 4B6DA 4E1PA 2JXDA 1W4RA 2OVOA 3RU0A 1BUSA 2ROWA 1SGPI 2N17A 1OVOA 1PTRA 1CGII 2ARPF 2A20A 1UUCA 2DB6A 1V1IA 2SGEI 3B4VC 2CJSC 4UXHA 1LR7A 3VE5A 2J9RA 1HPTA 2GVIA 1IW4A 1YU6C 1YTPA 3D00A 2P6AC 2V1CA 2SGDI 3BJIA 2UZ3A 2DIPA 2ERWA 1FARA 1R0RI 3FC3A 4A24A 4UXIA 3OXGA 3SGQI 5CCLA 2FNFX 2KCXA 1Z7KB 1X74A 1OMTA 1Y1BA 2YQPA 5HI7A 1CE3A 1LR9A 1TBOA 4GI3C 1DS3I 1X4SA 3QWPA 1KBFA 3GOXA 5JHWC 2XRCA 5FUWA 5EX3A 3OL0A 1N13A 3UGDA 2NU3I 1M8CA 2J87A 3PDNA 3UGLA 1AN1I 2L7XA 2SGQI 4JCVE 2OD1A 2N71A 5HQ8A 2L8EA 4HGUA 1IY6A 2JW6A 2SGPI 3UEYA 1XA6A 3VDPA 5DAEA 1CT0I 2BUSA 1TGSI 2NU4I 1CT4I 1LR8A 3E59A 3UFFA 2WVJA 2VRWB 5CCMA 2GKTI 2ELIA 1OYVI 4L9MA 1BMOA 3TJQA 3VDUA 2F3CI 1KMAA 1RFHA 2GKVA 2QQEA 4UXJA 5FUVA 1MT1A 5EX0A 1DS2I 1V1HA 1Y1CA 3QTLD 1TOTA 1M8BA 3OVOA 3SGBI 2NU0I 1SGNI 1UVFA 4SGBI 3CXLA 2KMPA 1TIHA 1OMUA 1SGDI 1SGYI 2ENZA 1CGJI 2K9HA 2KMRA 5FUXA 1U5KA 2QPOA 2LEOA 1PJUA 1SGEI 3OXLA 2ORWA 1NUBA 2V53A 3KY9A 1IY5A 1W3SA 2ORVA 2KMQA 1H0ZA 2KMOA 1TBQR 2QQ0A 4E1RA 3UEJA 1SGQI 2B0UC 2WCYA 1CSOI 2QQCA 3UGIA 2SGFI 1KBEA 1CHOI 2NU1I 2GKRI 2E73A 1XBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OXG A;  5CCL A;  2JW6 A;  3MEK A;  3OXF A;  5HI7 A;  3QWP A;  2ODD A;  3PDN A;  5EX0 A;  3RU0 A;  5CCM A;  2OD1 A;  5HQ8 A;  3OXL A;  4A24 A;  5EX3 A; 
#chains in the Genus database with same CATH topology
 1MJB A;  2N1A B;  2YUU A;  4FKD A;  1TUS A;  4MPI A;  2LUY A;  2GIV A;  1HDL A;  3TO6 A;  1TUR A;  2W0T A;  5FUY A;  2OU2 A;  1WGC A;  2JA1 A;  2B8T A;  3HH2 C;  1SGR I;  1WKX A;  1PCE A;  4OVO A;  3MEK A;  1UVG A;  2QQD A;  2V1C C;  2X52 A;  3E2I A;  2ODD A;  2UVO A;  1FYB A;  1PPF I;  2JZM A;  1TBR R;  1FAQ A;  4WP4 A;  2ENN A;  1MJA A;  1VDD A;  2JYY A;  2M5X A;  2NU2 I;  1CT2 I;  2PQ8 A;  1R79 A;  2N52 A;  3FSY A;  3SEK C;  1PTQ A;  1TBN A;  1XX6 A;  2E5R A;  3OXF A;  5J8C A;  1Y8F A;  1HJA I;  4B6D A;  4E1P A;  2JXD A;  1W4R A;  2OVO A;  3RU0 A;  1BUS A;  2ROW A;  1SGP I;  2N17 A;  3QAH A;  1OVO A;  1PTR A;  1CGI I;  1UUC A;  2A20 A;  2ARP F;  2DB6 A;  1V1I A;  2WGC A;  2SGE I;  3B4V C;  2CJS C;  4UXH A;  1LR7 A;  3VE5 A;  2J9R A;  1HPT A;  2GVI A;  1IW4 A;  1YU6 C;  1YTP A;  3D00 A;  4DNC A;  2P6A C;  1K7U A;  2V1C A;  2RC4 A;  2SGD I;  3BJI A;  2UZ3 A;  2DIP A;  2ERW A;  1WGT A;  1FAR A;  1R0R I;  3FC3 A;  1Z2I A;  4UXI A;  4A24 A;  3OXG A;  3SGQ I;  5CCL A;  2FNF X;  2KCX A;  1UHA A;  1X74 A;  1OMT A;  1Y1B A;  1Z7K B;  2CWF A;  2YQP A;  1LR9 A;  1TBO A;  5HI7 A;  7WGA A;  5E3R A;  2CWG A;  4GI3 C;  1DS3 I;  1X4S A;  3QWP A;  1KBF A;  3GOX A;  5JHW C;  2XRC A;  5FUW A;  5EX3 A;  5E3Q A;  3OL0 A;  1N13 A;  2LB7 A;  3UGD A;  2NU3 I;  1M8C A;  1NXU A;  2J87 A;  2DKV A;  3PDN A;  3UGL A;  1AN1 I;  1ULN A;  2L7X A;  9WGA A;  2SGQ I;  4JCV E;  1K7T A;  1P9G A;  2N71 A;  2OD1 A;  5HQ8 A;  3R5B A;  2L8E A;  3R5D A;  4HGU A;  1IY6 A;  2JW6 A;  2SGP I;  3UEY A;  5J8F A;  1XA6 A;  3VDP A;  5DAE A;  3TOA A;  1CT0 I;  2BUS A;  1TGS I;  1S20 A;  2NU4 I;  1CT4 I;  1LR8 A;  3E59 A;  3TOB A;  2RIJ A;  2WVJ A;  3UFF A;  2VRW B;  5CCM A;  2GKT I;  2ELI A;  1OYV I;  1ULK A;  4L9M A;  3UOE A;  1BMO A;  3TJQ A;  3VDU A;  3R5C A;  2F3C I;  1KMA A;  2X3T A;  1RFH A;  2GKV A;  2QQE A;  4UXJ A;  5FUV A;  1MT1 A;  5EX0 A;  1DS2 I;  1V1H A;  1Y1C A;  3QTL D;  1TOT A;  1M8B A;  3OVO A;  3SGB I;  2NU0 I;  1SGN I;  1UVF A;  4SGB I;  1K7V A;  3CXL A;  2KMP A;  2Y0M A;  1HEV A;  1TIH A;  1OMU A;  1SGD I;  1SGY I;  1WTJ A;  1CGJ I;  2ENZ A;  2K9H A;  2KMR A;  1CE3 A;  5E3P A;  1MJ9 A;  5FUX A;  1U5K A;  2QPO A;  2LEO A;  1P9Z A;  1PJU A;  1SGE I;  3OXL A;  3TO9 A;  4AML A;  2ORW A;  1NUB A;  2V53 A;  3KY9 A;  1Q9B A;  1IY5 A;  1W3S A;  2ORV A;  2KMQ A;  1H0Z A;  2KMO A;  1TBQ R;  2QQ0 A;  4E1R A;  3UEJ A;  1SGQ I;  2B0U C;  2WCY A;  1CSO I;  2QQC A;  3UGI A;  2SGF I;  2OZU A;  2CWH A;  1KBE A;  3R5A A;  1CHO I;  2NU1 I;  1ULM A;  2GKR I;  3FSX A;  3TO7 A;  2E73 A;  1FY7 A;  1XBT A; 
#chains in the Genus database with same CATH homology
 2N1A B;  2YUU A;  4FKD A;  1TUS A;  2LUY A;  1HDL A;  1TUR A;  2W0T A;  5FUY A;  2JA1 A;  2B8T A;  3HH2 C;  1SGR I;  1PCE A;  4OVO A;  3MEK A;  1UVG A;  2QQD A;  2V1C C;  3E2I A;  1FYB A;  2ODD A;  1PPF I;  2JZM A;  1TBR R;  1FAQ A;  2ENN A;  1VDD A;  2JYY A;  2M5X A;  2NU2 I;  1CT2 I;  1R79 A;  2N52 A;  3SEK C;  1PTQ A;  1TBN A;  1XX6 A;  2E5R A;  3OXF A;  1Y8F A;  1HJA I;  4B6D A;  4E1P A;  2JXD A;  1W4R A;  2OVO A;  3RU0 A;  1BUS A;  2ROW A;  1SGP I;  2N17 A;  1OVO A;  1PTR A;  1CGI I;  2ARP F;  2A20 A;  1UUC A;  2DB6 A;  1V1I A;  2SGE I;  3B4V C;  2CJS C;  4UXH A;  1LR7 A;  3VE5 A;  2J9R A;  1HPT A;  2GVI A;  1IW4 A;  1YU6 C;  1YTP A;  3D00 A;  2P6A C;  2V1C A;  2SGD I;  3BJI A;  2UZ3 A;  2DIP A;  2ERW A;  1FAR A;  1R0R I;  3FC3 A;  4A24 A;  4UXI A;  3OXG A;  3SGQ I;  5CCL A;  2FNF X;  2KCX A;  1Z7K B;  1X74 A;  1OMT A;  1Y1B A;  2YQP A;  5HI7 A;  1CE3 A;  1LR9 A;  1TBO A;  4GI3 C;  1DS3 I;  1X4S A;  3QWP A;  1KBF A;  3GOX A;  5JHW C;  2XRC A;  5FUW A;  5EX3 A;  3OL0 A;  1N13 A;  3UGD A;  2NU3 I;  1M8C A;  2J87 A;  3PDN A;  3UGL A;  1AN1 I;  2L7X A;  2SGQ I;  4JCV E;  2OD1 A;  2N71 A;  5HQ8 A;  2L8E A;  4HGU A;  1IY6 A;  2JW6 A;  2SGP I;  3UEY A;  1XA6 A;  3VDP A;  5DAE A;  1CT0 I;  2BUS A;  1TGS I;  2NU4 I;  1CT4 I;  1LR8 A;  3E59 A;  3UFF A;  2WVJ A;  2VRW B;  5CCM A;  2GKT I;  2ELI A;  1OYV I;  4L9M A;  1BMO A;  3TJQ A;  3VDU A;  2F3C I;  1KMA A;  1RFH A;  2GKV A;  2QQE A;  4UXJ A;  5FUV A;  1MT1 A;  5EX0 A;  1DS2 I;  1V1H A;  1Y1C A;  3QTL D;  1TOT A;  1M8B A;  3OVO A;  3SGB I;  2NU0 I;  1SGN I;  1UVF A;  4SGB I;  3CXL A;  2KMP A;  1TIH A;  1OMU A;  1SGD I;  1SGY I;  2ENZ A;  1CGJ I;  2K9H A;  2KMR A;  5FUX A;  1U5K A;  2QPO A;  2LEO A;  1PJU A;  1SGE I;  3OXL A;  2ORW A;  1NUB A;  2V53 A;  3KY9 A;  1IY5 A;  1W3S A;  2ORV A;  2KMQ A;  1H0Z A;  2KMO A;  1TBQ R;  2QQ0 A;  4E1R A;  3UEJ A;  1SGQ I;  2B0U C;  2WCY A;  1CSO I;  2QQC A;  3UGI A;  2SGF I;  1KBE A;  1CHO I;  2NU1 I;  2GKR I;  2E73 A;  1XBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...