4A3GI

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3gI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3gI02
3PO3I 3EERA 2E2JI 5C4XI 3VMHA 3I4MI 3HOXI 1X3WA 4A3FI 2JA5I 4A3KI 2DE7A 1VLAA 2RBLA 1RO4A 3GTGI 4A93I 3S1QI 1Y1WI 3H0GI 3VB9A 5C4JI 4NBEA 3S17I 2R92I 4NBFA 3FKII 4X6AI 1PFTA 3D6WA 3PO3S 3GTKI 3GTOI 2NVYI 3RZOI 3CQZI 2PK7A 3VMGA 1Y1VS 1I3QI 4NBCA 3GTPI 2R7ZI 1RLYA 4A3DI 3M4OI 4BY7I 1I50I 3I07A 4BXXI 5C44I 1NUIA 2BJOA 3HOVI 1Y1VI 4A3GI 4BY1I 1USPA 3GTMI 4NB9A 2DE5A 4NBDA 3Q87A 1TWHI 2YU9I 2R93I 2K5RA 1LQLA 2VUMI 4NBHA 3S16I 2HF1A 4MH4A 1DL6A 1ZB9A 2JA8I 4A3EI 2JA7I 3M3YI 2J6AA 1USPB 4NB8A 2JNYA 3LUSA 3S1RI 1TFIA 3HOZI 4A3LI 3GTJI 2F4MA 4QTUA 1ML8A 4A3II 4Y52I 3S2HI 1TWCI 4A3JI 3H3VJ 3U50C 1WCMI 5IP7I 2P3YA 1L1OC 2JA6I 2NVTI 3HOYI 3S1MI 5C3EI 2E2HI 3GTMS 1TWGI 3RZDI 3K7AI 3S1NI 3GCFA 4BBSI 1QYPA 2JS4A 1SFOI 1I6HI 3I4NI 2NVXI 4A3MI 3PO2I 1YUAA 3HOUI 2NVQI 1TWAI 5IP9I 5FLMI 2KPIA 3GTQI 4NBAA 1K83I 1X3ZA 4NBGA 2JR6A 4QTTA 1R9TI 5CM2M 3ESWA 4Y7NI 1WW9A 2E2II 1TWFI 4A3BI 4NOZA 4XX2A 2DE6A 3HOWI 2B63I 3GKQA 4BBRI 4A3CI 4NBBA 1N2FA 3S15I 2AKLA 3VMIA 3GTLI 2F4OA 3S14I 1ZB8A 3S2DI
chains in the Genus database with same CATH superfamily
3EERA 5C4XI 2QEX1 4TNUA 1W2BY 1VQ8Z 4A3KI 2V3VA 2JUBA 1RO4A 1NP6A 1YI2Z 3J81b 3S1QI 3J81f 1JJ2Z 4NH1C 4NFRA 1VQ7Z 4HGZA 4E2ZA 1NJI1 1K8A1 3TDHB 4NBFA 3FKII 1QVGY 2JIOA 4DQYB 1WJ2A 3CCQZ 1YJW1 2Q51A 1Z02A 3GTOI 3FQQA 2NVYI 3F3FC 2PK7A 1YJNZ 1I3QI 4E2XA 3GTPI 2R7ZI 4A3DI 3M4OI 4BY7I 1I50I 5C44I 4A3GI 1YI21 4E31A 2G2KA 2DE5A 2YADA 1KQSZ 2OOXB 1VQPZ 2VUMI 2QEXZ 3S16I 2HF1A 4MH4A 1DL6A 1VQO1 2GTIA 3LUSA 1TFIA 3HOZI 4A3LI 2ZAEB 3GTJI 2I3CA 4A3JI 1WCMI 3S1MI 1L1OC 3HOYI 4E2YA 3CC21 2VF1A 5C3EI 1KRLA 2QREB 3K7AI 1Z03A 1SFOI 3I4NI 1M902 2W03A 3PO2I 1YJ91 1YUAA 2IV2X 1VQNZ 2OTJ1 1Q811 5IP9I 1K732 2V45A 1YUKA 3OW2Y 2JR6A 4QTTA 5CM2M 2JIRA 2AYDA 1WW9A 2QRDB 2RHBA 2E2II 4A3BI 1YIJ1 2GU2A 1Q16A 2V8KA 4A3CI 2PM9A 4MONA 3VMIA 1Q861 2JIQA 2F4OA 3S2DI 3I55Z 3G71Z 1VQ41 2QA4Z 3I56Z 3G4SZ 1Z01A 4A3FI 2H85A 1VQN1 1KC81 3JAMb 2RBLA 3CPWZ 1VQ51 1VQK1 1Q821 3CCJZ 3BG0B 3IF8A 1YJN1 1N8R1 3CMA1 1M1K1 4NBEA 3S17I 5D1PA 2GTHA 1RO2A 4E33A 3CXCZ 2LEXA 1VQP1 1KC82 1VQ5Z 3RZOI 1W2BZ 2QR1B 3CCRZ 1N8R2 1Y8CA 1NUIA 2BJOA 3JAMf 3BG1B 1VQ9Z 3IFUA 4AYBA 1YIJZ 1JJ2Y 2V8IA 4RVFA 2YU9I 2K5RA 3CCM1 3EEDA 4NBHA 4HGYA 1QVGZ 2JA7I 3CCJ1 3S1RI 1VQKZ 3CCL1 1WIIA 4QTUA 1X0TA 1VQ91 1ZH1A 4RVGA 3S2HI 1QF8A 1KD11 2R6MA 5A2Qb 4E30A 3CC2Z 3GTMS 2E2HI 1TWGI 4RV9A 3GCFA 3T4NB 4MD7A 1KQSY 4E2WA 3IR7A 4A3MI 1S721 4RS4A 3VTNA 3GTQI 4NBAA 1K83I 2E7ZA 4Y7NI 1M1K2 1SIWA 3HOWI 5T64A 4E32A 2B63I 2E9HA 3MONA 1VQMZ 2RPRA 1VQ71 2VUGA 1KD12 1VQM1 3CD6Z 5T67A 1YHQ1 1VQ4Z 3MZLB 3VMHA 2W04A 3HOXI 4DGLA 3CCV1 3J7A4 4RVHA 2JA5I 1VLAA 3HKZA 3OW2Z 3CCS1 3CMAZ 1K8A2 4A93I 1M901 1Y1WI 3H0GI 3VB9A 2Y0SA 2VPWA 3CC41 3FQMA 5C4JI 4MRIA 1Q822 1WZNA 1RO0A 1YITZ 4MD8A 2QA41 4RVDA 1PFTA 3PO3S 1VQ81 3CCR1 1VQ61 3CQZI 3KIFA 1RNIA 1Y1VS 3CPWY 1P9NA 3CCLZ 4BXXI 4BY1I 5IT9b 1USPA 1QVFY 5IT9f 3GTMI 4NB9A 3F3PC 4NBDA 1TWHI 2R93I 5FLXf 1K731 1LQLA 1YJ9Z 1Q812 3CCVZ 2JA8I 3TE5B 2VPYA 3IX0A 4MXUA 3I551 1Q7Y2 3M3YI 3D2LA 3CCU1 2JNYA 3CMEZ 2F4MA 4Y52I 3CME1 2JIPA 1TWCI 3H3VJ 3U50C 3MZKB 5LL6f 3NH5A 1QYPA 1RQFA 2QRCB 2QKDA 2NVXI 2OOYB 3CCQ1 1YJWZ 2JIMA 1AA6A 2NVQI 2OTJZ 1TWAI 5FLMI 3CC7Z 1X3ZA 3KIHA 5D1OB 1K9M1 1TWFI 4XX2A 2DE6A 3GKQA 4BBRI 2OTL1 4NBBA 1N2FA 3S15I 2WAQA 3GTLI 1FDIA 2EGTA 2WB1A 1YIT1 1FDOA 3PO3I 2E2JI 3I4MI 1VQOZ 1X3WA 1Q862 2DE7A 2O53A 2P28A 3CCSZ 3J80f 3GTGI 2NAPA 5A2Qf 2LIYA 5T6BA 5FLXb 1VQL1 3G6EZ 2R92I 4X6AI 3NH4A 4S1TA 3D6WA 3P5JB 1QXFA 3GTKI 4MD9A 2Q4ZA 4EWCA 4DK1A 3VMGA 4NBCA 1RLYA 2V8JA 4HH4A 3I07A 5AN9F 3NH8A 2OZKA 3NDJA 1K9M2 3HOVI 1Y1VI 2M6NA 2IZ4A 1VQLZ 3Q87A 2VPZA 2PMZA 3G4S1 3G6E1 1JWHC 1ZB9A 2RIQA 3G711 4A3EI 3CCUZ 2J6AA 1USPB 4NB8A 2QLVB 1ML8A 4A3II 2M48A 2LFUA 2VPXA 5IP7I 2P3YA 2NVTI 2JA6I 2K3RA 1QVFZ 3RZDI 2OTLZ 3S1NI 4BBSI 3NFZA 2JS4A 1I6HI 1YHQZ 4CL1A 2IZ3A 3CD61 3QWUA 3HOUI 3CCE1 3CCEZ 3I561 1VQ6Z 1NJI2 2KPIA 2KI7B 3CC71 3J80b 4NBGA 1R9TI 2JMOA 2O4HA 3ESWA 5D1OA 3D9XA 4NOZA 1Q7Y1 3CC4Z 2AKLA 3CCMZ 1S7MA 2RT9A 1S72Z 3NDIA 2HU9A 3CXCY 3S14I 1ZB8A
chains in the Genus database with same CATH topology
3EERA 5C4XI 2QEX1 4TNUA 1W2BY 1VQ8Z 4A3KI 2JUBA 1RO4A 1NP6A 1YI2Z 3J81b 3S1QI 3J81f 1JJ2Z 4NH1C 4NFRA 1VQ7Z 4HGZA 4E2ZA 1NJI1 1K8A1 3TDHB 4NBFA 3FKII 1QVGY 4DQYB 3CCQZ 1YJW1 2Q51A 1Z02A 3GTOI 3FQQA 2NVYI 3F3FC 2PK7A 1YJNZ 1I3QI 4E2XA 3GTPI 2R7ZI 4A3DI 3M4OI 4BY7I 1I50I 5C44I 4A3GI 1YI21 4E31A 2G2KA 2DE5A 2YADA 1KQSZ 2OOXB 1VQPZ 2VUMI 2QEXZ 3S16I 2HF1A 4MH4A 1DL6A 1VQO1 2GTIA 3LUSA 1TFIA 3HOZI 4A3LI 2ZAEB 3GTJI 2I3CA 4A3JI 1WCMI 3S1MI 1L1OC 3HOYI 4E2YA 3CC21 2VF1A 5C3EI 1KRLA 2QREB 3K7AI 1Z03A 1SFOI 3I4NI 1M902 2W03A 3PO2I 1YJ91 1YUAA 1VQNZ 2OTJ1 1Q811 5IP9I 1K732 1YUKA 3OW2Y 2JR6A 4QTTA 5CM2M 1WW9A 2QRDB 2RHBA 2E2II 4A3BI 1YIJ1 2GU2A 2V8KA 4A3CI 2PM9A 4MONA 3VMIA 1Q861 2F4OA 3S2DI 3I55Z 3G71Z 1VQ41 2QA4Z 3I56Z 3G4SZ 1Z01A 4A3FI 2H85A 1VQN1 1KC81 3JAMb 2RBLA 3CPWZ 1VQ51 1VQK1 1Q821 3CCJZ 3BG0B 3IF8A 1YJN1 1N8R1 3CMA1 1M1K1 4NBEA 3S17I 5D1PA 2GTHA 1RO2A 4E33A 3CXCZ 1VQP1 1KC82 1VQ5Z 3RZOI 1W2BZ 2QR1B 3CCRZ 1N8R2 1NUIA 2BJOA 3JAMf 3BG1B 1VQ9Z 3IFUA 4AYBA 1YIJZ 1JJ2Y 2V8IA 4RVFA 2YU9I 2K5RA 3CCM1 3EEDA 4NBHA 4HGYA 1QVGZ 2JA7I 3CCJ1 3S1RI 1VQKZ 3CCL1 1WIIA 4QTUA 1X0TA 1VQ91 1ZH1A 4RVGA 3S2HI 1QF8A 1KD11 2R6MA 5A2Qb 4E30A 3CC2Z 3GTMS 2E2HI 1TWGI 4RV9A 3GCFA 3T4NB 4MD7A 1KQSY 4E2WA 4A3MI 1S721 4RS4A 3VTNA 3GTQI 4NBAA 1K83I 4Y7NI 1M1K2 3HOWI 5T64A 4E32A 2B63I 2E9HA 3MONA 1VQMZ 2RPRA 1VQ71 2VUGA 1KD12 1VQM1 3CD6Z 5T67A 1YHQ1 1VQ4Z 3MZLB 3VMHA 2W04A 3HOXI 4DGLA 3CCV1 3J7A4 4RVHA 2JA5I 1VLAA 3HKZA 3OW2Z 3CCS1 3CMAZ 1K8A2 4A93I 1M901 1Y1WI 3H0GI 3VB9A 2Y0SA 3CC41 3FQMA 5C4JI 4MRIA 1Q822 1RO0A 1YITZ 4MD8A 2QA41 4RVDA 1PFTA 3PO3S 1VQ81 3CCR1 1VQ61 3CQZI 3KIFA 1RNIA 1Y1VS 3CPWY 1P9NA 3CCLZ 4BXXI 4BY1I 5IT9b 1USPA 1QVFY 5IT9f 3GTMI 4NB9A 3F3PC 4NBDA 1TWHI 2R93I 5FLXf 1K731 1LQLA 1YJ9Z 1Q812 3CCVZ 2JA8I 3TE5B 3IX0A 1Q7Y2 4MXUA 3I551 3M3YI 3CCU1 2JNYA 3CMEZ 2F4MA 4Y52I 3CME1 1TWCI 3H3VJ 3U50C 3MZKB 5LL6f 3NH5A 1QYPA 1RQFA 2QRCB 2QKDA 2NVXI 2OOYB 3CCQ1 1YJWZ 2NVQI 2OTJZ 1TWAI 5FLMI 3CC7Z 1X3ZA 3KIHA 5D1OB 1K9M1 1TWFI 4XX2A 2DE6A 3GKQA 4BBRI 2OTL1 4NBBA 1N2FA 3S15I 2WAQA 3GTLI 2EGTA 2WB1A 1YIT1 3PO3I 2E2JI 3I4MI 1VQOZ 1X3WA 1Q862 2DE7A 2O53A 2P28A 3CCSZ 3J80f 3GTGI 5A2Qf 2LIYA 5T6BA 5FLXb 1VQL1 3G6EZ 2R92I 4X6AI 3NH4A 4S1TA 3D6WA 3P5JB 3GTKI 4MD9A 2Q4ZA 4EWCA 4DK1A 3VMGA 4NBCA 1RLYA 2V8JA 4HH4A 3I07A 5AN9F 3NH8A 2OZKA 3NDJA 1K9M2 3HOVI 1Y1VI 2M6NA 2IZ4A 1VQLZ 3Q87A 2PMZA 3G4S1 3G6E1 1JWHC 1ZB9A 2RIQA 3G711 4A3EI 3CCUZ 2J6AA 1USPB 4NB8A 2QLVB 1ML8A 4A3II 2M48A 2LFUA 5IP7I 2P3YA 2NVTI 2JA6I 2K3RA 1QVFZ 3RZDI 2OTLZ 3S1NI 4BBSI 3NFZA 2JS4A 1I6HI 1YHQZ 4CL1A 2IZ3A 3CD61 3QWUA 3HOUI 3CCE1 3CCEZ 3I561 1VQ6Z 1NJI2 2KPIA 2KI7B 3CC71 3J80b 4NBGA 1R9TI 2JMOA 2O4HA 3ESWA 5D1OA 3D9XA 4NOZA 1Q7Y1 3CC4Z 2AKLA 3CCMZ 1S7MA 2RT9A 1S72Z 3NDIA 2HU9A 3CXCY 3S14I 1ZB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO3 I;  3EER A;  2E2J I;  5C4X I;  3VMH A;  3I4M I;  3HOX I;  1X3W A;  4A3F I;  2JA5 I;  4A3K I;  2DE7 A;  1VLA A;  2RBL A;  1RO4 A;  3GTG I;  4A93 I;  3S1Q I;  1Y1W I;  3H0G I;  3VB9 A;  5C4J I;  4NBE A;  3S17 I;  2R92 I;  4NBF A;  3FKI I;  4X6A I;  1PFT A;  3D6W A;  3PO3 S;  3GTK I;  3GTO I;  2NVY I;  3RZO I;  3CQZ I;  2PK7 A;  3VMG A;  1Y1V S;  1I3Q I;  4NBC A;  3GTP I;  2R7Z I;  1RLY A;  4A3D I;  3M4O I;  4BY7 I;  1I50 I;  3I07 A;  4BXX I;  5C44 I;  1NUI A;  2BJO A;  3HOV I;  1Y1V I;  4A3G I;  4BY1 I;  1USP A;  3GTM I;  4NB9 A;  2DE5 A;  4NBD A;  3Q87 A;  1TWH I;  2YU9 I;  2R93 I;  2K5R A;  1LQL A;  2VUM I;  4NBH A;  3S16 I;  2HF1 A;  4MH4 A;  1DL6 A;  1ZB9 A;  2JA8 I;  4A3E I;  2JA7 I;  3M3Y I;  2J6A A;  1USP B;  4NB8 A;  2JNY A;  3LUS A;  3S1R I;  1TFI A;  3HOZ I;  4A3L I;  3GTJ I;  2F4M A;  4QTU A;  1ML8 A;  4A3I I;  4Y52 I;  3S2H I;  1TWC I;  4A3J I;  3H3V J;  3U50 C;  1WCM I;  5IP7 I;  2P3Y A;  1L1O C;  2JA6 I;  2NVT I;  3HOY I;  3S1M I;  5C3E I;  2E2H I;  3GTM S;  1TWG I;  3RZD I;  3K7A I;  3S1N I;  3GCF A;  4BBS I;  1QYP A;  2JS4 A;  1SFO I;  1I6H I;  3I4N I;  2NVX I;  4A3M I;  3PO2 I;  1YUA A;  3HOU I;  2NVQ I;  1TWA I;  5IP9 I;  5FLM I;  2KPI A;  3GTQ I;  4NBA A;  1K83 I;  1X3Z A;  4NBG A;  2JR6 A;  4QTT A;  1R9T I;  5CM2 M;  3ESW A;  4Y7N I;  1WW9 A;  2E2I I;  1TWF I;  4A3B I;  4NOZ A;  4XX2 A;  2DE6 A;  3HOW I;  2B63 I;  3GKQ A;  4BBR I;  4A3C I;  4NBB A;  1N2F A;  3S15 I;  2AKL A;  3VMI A;  3GTL I;  2F4O A;  3S14 I;  1ZB8 A;  3S2D I; 
#chains in the Genus database with same CATH topology
 3EER A;  5C4X I;  2QEX 1;  4TNU A;  1W2B Y;  1VQ8 Z;  4A3K I;  2V3V A;  2JUB A;  1RO4 A;  1NP6 A;  1YI2 Z;  3J81 b;  3S1Q I;  3J81 f;  1JJ2 Z;  4NH1 C;  4NFR A;  1VQ7 Z;  4HGZ A;  4E2Z A;  1NJI 1;  1K8A 1;  3TDH B;  4NBF A;  3FKI I;  1QVG Y;  2JIO A;  4DQY B;  1WJ2 A;  3CCQ Z;  1YJW 1;  2Q51 A;  1Z02 A;  3GTO I;  3FQQ A;  2NVY I;  3F3F C;  2PK7 A;  1YJN Z;  1I3Q I;  4E2X A;  3GTP I;  2R7Z I;  4A3D I;  3M4O I;  4BY7 I;  1I50 I;  5C44 I;  4A3G I;  1YI2 1;  4E31 A;  2G2K A;  2DE5 A;  2YAD A;  1KQS Z;  2OOX B;  1VQP Z;  2VUM I;  2QEX Z;  3S16 I;  2HF1 A;  4MH4 A;  1DL6 A;  1VQO 1;  2GTI A;  3LUS A;  1TFI A;  3HOZ I;  4A3L I;  2ZAE B;  3GTJ I;  2I3C A;  4A3J I;  1WCM I;  3S1M I;  1L1O C;  3HOY I;  4E2Y A;  3CC2 1;  2VF1 A;  5C3E I;  1KRL A;  2QRE B;  3K7A I;  1Z03 A;  1SFO I;  3I4N I;  1M90 2;  2W03 A;  3PO2 I;  1YJ9 1;  1YUA A;  2IV2 X;  1VQN Z;  2OTJ 1;  1Q81 1;  5IP9 I;  1K73 2;  2V45 A;  1YUK A;  3OW2 Y;  2JR6 A;  4QTT A;  5CM2 M;  2JIR A;  2AYD A;  1WW9 A;  2QRD B;  2RHB A;  2E2I I;  4A3B I;  1YIJ 1;  2GU2 A;  1Q16 A;  2V8K A;  4A3C I;  2PM9 A;  4MON A;  3VMI A;  1Q86 1;  2JIQ A;  2F4O A;  3S2D I;  3I55 Z;  3G71 Z;  1VQ4 1;  2QA4 Z;  3I56 Z;  3G4S Z;  1Z01 A;  4A3F I;  2H85 A;  1VQN 1;  1KC8 1;  3JAM b;  2RBL A;  3CPW Z;  1VQ5 1;  1VQK 1;  1Q82 1;  3CCJ Z;  3BG0 B;  3IF8 A;  1YJN 1;  1N8R 1;  3CMA 1;  1M1K 1;  4NBE A;  3S17 I;  5D1P A;  2GTH A;  1RO2 A;  4E33 A;  3CXC Z;  2LEX A;  1VQP 1;  1KC8 2;  1VQ5 Z;  3RZO I;  1W2B Z;  2QR1 B;  3CCR Z;  1N8R 2;  1Y8C A;  1NUI A;  2BJO A;  3JAM f;  3BG1 B;  1VQ9 Z;  3IFU A;  4AYB A;  1YIJ Z;  1JJ2 Y;  2V8I A;  4RVF A;  2YU9 I;  2K5R A;  3CCM 1;  3EED A;  4NBH A;  4HGY A;  1QVG Z;  2JA7 I;  3CCJ 1;  3S1R I;  1VQK Z;  3CCL 1;  1WII A;  4QTU A;  1X0T A;  1VQ9 1;  1ZH1 A;  4RVG A;  3S2H I;  1QF8 A;  1KD1 1;  2R6M A;  5A2Q b;  4E30 A;  3CC2 Z;  3GTM S;  2E2H I;  1TWG I;  4RV9 A;  3GCF A;  3T4N B;  4MD7 A;  1KQS Y;  4E2W A;  3IR7 A;  4A3M I;  1S72 1;  4RS4 A;  3VTN A;  3GTQ I;  4NBA A;  1K83 I;  2E7Z A;  4Y7N I;  1M1K 2;  1SIW A;  3HOW I;  5T64 A;  4E32 A;  2B63 I;  2E9H A;  3MON A;  1VQM Z;  2RPR A;  1VQ7 1;  2VUG A;  1KD1 2;  1VQM 1;  3CD6 Z;  5T67 A;  1YHQ 1;  1VQ4 Z;  3MZL B;  3VMH A;  2W04 A;  3HOX I;  4DGL A;  3CCV 1;  3J7A 4;  4RVH A;  2JA5 I;  1VLA A;  3HKZ A;  3OW2 Z;  3CCS 1;  3CMA Z;  1K8A 2;  4A93 I;  1M90 1;  1Y1W I;  3H0G I;  3VB9 A;  2Y0S A;  2VPW A;  3CC4 1;  3FQM A;  5C4J I;  4MRI A;  1Q82 2;  1WZN A;  1RO0 A;  1YIT Z;  4MD8 A;  2QA4 1;  4RVD A;  1PFT A;  3PO3 S;  1VQ8 1;  3CCR 1;  1VQ6 1;  3CQZ I;  3KIF A;  1RNI A;  1Y1V S;  3CPW Y;  1P9N A;  3CCL Z;  4BXX I;  4BY1 I;  5IT9 b;  1USP A;  1QVF Y;  5IT9 f;  3GTM I;  4NB9 A;  3F3P C;  4NBD A;  1TWH I;  2R93 I;  5FLX f;  1K73 1;  1LQL A;  1YJ9 Z;  1Q81 2;  3CCV Z;  2JA8 I;  3TE5 B;  2VPY A;  3IX0 A;  4MXU A;  3I55 1;  1Q7Y 2;  3M3Y I;  3D2L A;  3CCU 1;  2JNY A;  3CME Z;  2F4M A;  4Y52 I;  3CME 1;  2JIP A;  1TWC I;  3H3V J;  3U50 C;  3MZK B;  5LL6 f;  3NH5 A;  1QYP A;  1RQF A;  2QRC B;  2QKD A;  2NVX I;  2OOY B;  3CCQ 1;  1YJW Z;  2JIM A;  1AA6 A;  2NVQ I;  2OTJ Z;  1TWA I;  5FLM I;  3CC7 Z;  1X3Z A;  3KIH A;  5D1O B;  1K9M 1;  1TWF I;  4XX2 A;  2DE6 A;  3GKQ A;  4BBR I;  2OTL 1;  4NBB A;  1N2F A;  3S15 I;  2WAQ A;  3GTL I;  1FDI A;  2EGT A;  2WB1 A;  1YIT 1;  1FDO A;  3PO3 I;  2E2J I;  3I4M I;  1VQO Z;  1X3W A;  1Q86 2;  2DE7 A;  2O53 A;  2P28 A;  3CCS Z;  3J80 f;  3GTG I;  2NAP A;  5A2Q f;  2LIY A;  5T6B A;  5FLX b;  1VQL 1;  3G6E Z;  2R92 I;  4X6A I;  3NH4 A;  4S1T A;  3D6W A;  3P5J B;  1QXF A;  3GTK I;  4MD9 A;  2Q4Z A;  4EWC A;  4DK1 A;  3VMG A;  4NBC A;  1RLY A;  2V8J A;  4HH4 A;  3I07 A;  5AN9 F;  3NH8 A;  2OZK A;  3NDJ A;  1K9M 2;  3HOV I;  1Y1V I;  2M6N A;  2IZ4 A;  1VQL Z;  3Q87 A;  2VPZ A;  2PMZ A;  3G4S 1;  3G6E 1;  1JWH C;  1ZB9 A;  2RIQ A;  3G71 1;  4A3E I;  3CCU Z;  2J6A A;  1USP B;  4NB8 A;  2QLV B;  1ML8 A;  4A3I I;  2M48 A;  2LFU A;  2VPX A;  5IP7 I;  2P3Y A;  2NVT I;  2JA6 I;  2K3R A;  1QVF Z;  3RZD I;  2OTL Z;  3S1N I;  4BBS I;  3NFZ A;  2JS4 A;  1I6H I;  1YHQ Z;  4CL1 A;  2IZ3 A;  3CD6 1;  3QWU A;  3HOU I;  3CCE 1;  3CCE Z;  3I56 1;  1VQ6 Z;  1NJI 2;  2KPI A;  2KI7 B;  3CC7 1;  3J80 b;  4NBG A;  1R9T I;  2JMO A;  2O4H A;  3ESW A;  5D1O A;  3D9X A;  4NOZ A;  1Q7Y 1;  3CC4 Z;  2AKL A;  3CCM Z;  1S7M A;  2RT9 A;  1S72 Z;  3NDI A;  2HU9 A;  3CXC Y;  3S14 I;  1ZB8 A; 
#chains in the Genus database with same CATH homology
 3EER A;  5C4X I;  2QEX 1;  4TNU A;  1W2B Y;  1VQ8 Z;  4A3K I;  2JUB A;  1RO4 A;  1NP6 A;  1YI2 Z;  3J81 b;  3S1Q I;  3J81 f;  1JJ2 Z;  4NH1 C;  4NFR A;  1VQ7 Z;  4HGZ A;  4E2Z A;  1NJI 1;  1K8A 1;  3TDH B;  4NBF A;  3FKI I;  1QVG Y;  4DQY B;  3CCQ Z;  1YJW 1;  2Q51 A;  1Z02 A;  3GTO I;  3FQQ A;  2NVY I;  3F3F C;  2PK7 A;  1YJN Z;  1I3Q I;  4E2X A;  3GTP I;  2R7Z I;  4A3D I;  3M4O I;  4BY7 I;  1I50 I;  5C44 I;  4A3G I;  1YI2 1;  4E31 A;  2G2K A;  2DE5 A;  2YAD A;  1KQS Z;  2OOX B;  1VQP Z;  2VUM I;  2QEX Z;  3S16 I;  2HF1 A;  4MH4 A;  1DL6 A;  1VQO 1;  2GTI A;  3LUS A;  1TFI A;  3HOZ I;  4A3L I;  2ZAE B;  3GTJ I;  2I3C A;  4A3J I;  1WCM I;  3S1M I;  1L1O C;  3HOY I;  4E2Y A;  3CC2 1;  2VF1 A;  5C3E I;  1KRL A;  2QRE B;  3K7A I;  1Z03 A;  1SFO I;  3I4N I;  1M90 2;  2W03 A;  3PO2 I;  1YJ9 1;  1YUA A;  1VQN Z;  2OTJ 1;  1Q81 1;  5IP9 I;  1K73 2;  1YUK A;  3OW2 Y;  2JR6 A;  4QTT A;  5CM2 M;  1WW9 A;  2QRD B;  2RHB A;  2E2I I;  4A3B I;  1YIJ 1;  2GU2 A;  2V8K A;  4A3C I;  2PM9 A;  4MON A;  3VMI A;  1Q86 1;  2F4O A;  3S2D I;  3I55 Z;  3G71 Z;  1VQ4 1;  2QA4 Z;  3I56 Z;  3G4S Z;  1Z01 A;  4A3F I;  2H85 A;  1VQN 1;  1KC8 1;  3JAM b;  2RBL A;  3CPW Z;  1VQ5 1;  1VQK 1;  1Q82 1;  3CCJ Z;  3BG0 B;  3IF8 A;  1YJN 1;  1N8R 1;  3CMA 1;  1M1K 1;  4NBE A;  3S17 I;  5D1P A;  2GTH A;  1RO2 A;  4E33 A;  3CXC Z;  1VQP 1;  1KC8 2;  1VQ5 Z;  3RZO I;  1W2B Z;  2QR1 B;  3CCR Z;  1N8R 2;  1NUI A;  2BJO A;  3JAM f;  3BG1 B;  1VQ9 Z;  3IFU A;  4AYB A;  1YIJ Z;  1JJ2 Y;  2V8I A;  4RVF A;  2YU9 I;  2K5R A;  3CCM 1;  3EED A;  4NBH A;  4HGY A;  1QVG Z;  2JA7 I;  3CCJ 1;  3S1R I;  1VQK Z;  3CCL 1;  1WII A;  4QTU A;  1X0T A;  1VQ9 1;  1ZH1 A;  4RVG A;  3S2H I;  1QF8 A;  1KD1 1;  2R6M A;  5A2Q b;  4E30 A;  3CC2 Z;  3GTM S;  2E2H I;  1TWG I;  4RV9 A;  3GCF A;  3T4N B;  4MD7 A;  1KQS Y;  4E2W A;  4A3M I;  1S72 1;  4RS4 A;  3VTN A;  3GTQ I;  4NBA A;  1K83 I;  4Y7N I;  1M1K 2;  3HOW I;  5T64 A;  4E32 A;  2B63 I;  2E9H A;  3MON A;  1VQM Z;  2RPR A;  1VQ7 1;  2VUG A;  1KD1 2;  1VQM 1;  3CD6 Z;  5T67 A;  1YHQ 1;  1VQ4 Z;  3MZL B;  3VMH A;  2W04 A;  3HOX I;  4DGL A;  3CCV 1;  3J7A 4;  4RVH A;  2JA5 I;  1VLA A;  3HKZ A;  3OW2 Z;  3CCS 1;  3CMA Z;  1K8A 2;  4A93 I;  1M90 1;  1Y1W I;  3H0G I;  3VB9 A;  2Y0S A;  3CC4 1;  3FQM A;  5C4J I;  4MRI A;  1Q82 2;  1RO0 A;  1YIT Z;  4MD8 A;  2QA4 1;  4RVD A;  1PFT A;  3PO3 S;  1VQ8 1;  3CCR 1;  1VQ6 1;  3CQZ I;  3KIF A;  1RNI A;  1Y1V S;  3CPW Y;  1P9N A;  3CCL Z;  4BXX I;  4BY1 I;  5IT9 b;  1USP A;  1QVF Y;  5IT9 f;  3GTM I;  4NB9 A;  3F3P C;  4NBD A;  1TWH I;  2R93 I;  5FLX f;  1K73 1;  1LQL A;  1YJ9 Z;  1Q81 2;  3CCV Z;  2JA8 I;  3TE5 B;  3IX0 A;  1Q7Y 2;  4MXU A;  3I55 1;  3M3Y I;  3CCU 1;  2JNY A;  3CME Z;  2F4M A;  4Y52 I;  3CME 1;  1TWC I;  3H3V J;  3U50 C;  3MZK B;  5LL6 f;  3NH5 A;  1QYP A;  1RQF A;  2QRC B;  2QKD A;  2NVX I;  2OOY B;  3CCQ 1;  1YJW Z;  2NVQ I;  2OTJ Z;  1TWA I;  5FLM I;  3CC7 Z;  1X3Z A;  3KIH A;  5D1O B;  1K9M 1;  1TWF I;  4XX2 A;  2DE6 A;  3GKQ A;  4BBR I;  2OTL 1;  4NBB A;  1N2F A;  3S15 I;  2WAQ A;  3GTL I;  2EGT A;  2WB1 A;  1YIT 1;  3PO3 I;  2E2J I;  3I4M I;  1VQO Z;  1X3W A;  1Q86 2;  2DE7 A;  2O53 A;  2P28 A;  3CCS Z;  3J80 f;  3GTG I;  5A2Q f;  2LIY A;  5T6B A;  5FLX b;  1VQL 1;  3G6E Z;  2R92 I;  4X6A I;  3NH4 A;  4S1T A;  3D6W A;  3P5J B;  3GTK I;  4MD9 A;  2Q4Z A;  4EWC A;  4DK1 A;  3VMG A;  4NBC A;  1RLY A;  2V8J A;  4HH4 A;  3I07 A;  5AN9 F;  3NH8 A;  2OZK A;  3NDJ A;  1K9M 2;  3HOV I;  1Y1V I;  2M6N A;  2IZ4 A;  1VQL Z;  3Q87 A;  2PMZ A;  3G4S 1;  3G6E 1;  1JWH C;  1ZB9 A;  2RIQ A;  3G71 1;  4A3E I;  3CCU Z;  2J6A A;  1USP B;  4NB8 A;  2QLV B;  1ML8 A;  4A3I I;  2M48 A;  2LFU A;  5IP7 I;  2P3Y A;  2NVT I;  2JA6 I;  2K3R A;  1QVF Z;  3RZD I;  2OTL Z;  3S1N I;  4BBS I;  3NFZ A;  2JS4 A;  1I6H I;  1YHQ Z;  4CL1 A;  2IZ3 A;  3CD6 1;  3QWU A;  3HOU I;  3CCE 1;  3CCE Z;  3I56 1;  1VQ6 Z;  1NJI 2;  2KPI A;  2KI7 B;  3CC7 1;  3J80 b;  4NBG A;  1R9T I;  2JMO A;  2O4H A;  3ESW A;  5D1O A;  3D9X A;  4NOZ A;  1Q7Y 1;  3CC4 Z;  2AKL A;  3CCM Z;  1S7M A;  2RT9 A;  1S72 Z;  3NDI A;  2HU9 A;  3CXC Y;  3S14 I;  1ZB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...