4A93F

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
84
structure length
84
Chain Sequence
KAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 28
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.940.10 Alpha Beta Alpha-Beta Complex Eukaryotic RPB6 RNA polymerase subunit Eukaryotic RPB6 RNA polymerase subunit 4a93F00
3RZDF 3GTQF 4ZH4E 5C4JF 3HOUF 2CW0E 4G7OE 4KN4E 5D4CE 2NVTF 3S2HF 4YFKE 4A3BF 2YU9F 3K7AF 1ZYRE 2Y0SI 3HOYF 2BE5E 3WODE 5IP9F 4A3EF 3S15F 3S14F 4G7ZE 4MQ9E 5IYDF 4BY7F 4LJZE 4LLGE 3RZOF 4BXXF 1I6VE 3S1MF 4A3FF 5D4DE 4OIOE 1HQME 2WAQK 3GTOF 4Y52F 4LK1E 4OIRE 3S1QF 5IP7F 2E2IF 5IYCF 4YFXE 4JK1E 3S16F 2NVQF 2VUMF 2A6EE 3HOVF 2R7ZF 4AYBK 2A6HE 2JA6F 4G7HE 3GTLF 5TMCE 3GTPF 4KMUE 2PPBE 4A3DF 2NVYF 5M5XF 1I3QF 3DXJE 3FKIF 4Y7NF 4A3KF 1I50F 3H0GF 1TWAF 4GZYE 2WB1I 2JA7F 5M3FF 4XLNE 5C3EF 4A3MF 3H3VG 2O5IE 1IW7E 2A69E 4OINE 4XSZE 5C44F 5M3MF 1YNJK 4YFNE 3GTJF 4BBSF 2R92F 3HOWF 4A93F 4A3IF 4XSXE 3S2DF 3EQLE 5C4XF 4C3HF 2B63F 4Q4ZE 4LK0E 2JA5F 5M5YF 1YNNK 4C3JF 1Y1WF 3GTKF 5FJ8F 3HOXF 3HOZF 5D4EE 3S1RF 4A3CF 1Y1VF 5E18E 3CQZF 5TMFE 4MEXE 3GTGF 3PO3F 2E2HF 4A3JF 4A3GF 1R9TF 1WCMF 1SFOF 2O5JE 1I6HF 4OIPE 3PO2F 5IYBF 1K83F 2JA8F 1TWCF 4C2MF 3I4NF 5FLMF 2E2JF 4YG2E 5BYHE 2R93F 1TWHF 5IPLE 4Q5SE 4XLPE 4MEYE 1QKLA 1TWGF 4X6AF 2PMZK 4KN7E 5M5WF 2A68E 1SMYE 3M3YF 5E17E 2NVXF 3S17F 4BY1F 1TWFF 3GTMF 3I4MF 3S1NF 4C3IF 4BBRF 4OIQE 4A3LF 3M4OF 3HKZK
chains in the Genus database with same CATH superfamily
3RZDF 3GTQF 4ZH4E 5C4JF 3HOUF 2R92E 2CW0E 4C3IE 5IYCE 2WB1H 5FLME 4Y7NE 2E2JE 4KN4E 3S1ME 3S1QE 4G7OE 3RZOE 4BXXE 1I3QE 5D4CE 4BY1E 5C44E 2NVTF 2WAQH 3S2HF 3PO2E 1DZFA 3M3YE 4YFKE 4A3BF 1I6HE 2YU9F 3K7AF 1ZYRE 2Y0SI 1R9TE 2B63E 5IP9E 3S15E 3HOYF 2BE5E 3WODE 5IP9F 4A3EF 3S15F 4BBRE 4G7ZE 3S14F 2NVQE 3S2DE 5C4XE 4MQ9E 3HOWE 5IYDF 4BY7F 4BBSE 4LJZE 4LLGE 1K83E 3RZOF 4QIWH 4BXXF 1I6VE 3S1MF 4A3FF 5D4DE 4OIOE 3HOUE 3HOVE 1WCME 3HOYE 4C3HE 1HQME 1TWHE 2WAQK 3GTOF 2PMZH 4Y52F 4LK1E 4A3FE 3S1RE 1TWCE 4OIRE 3S1QF 5IP7F 5FJ8E 5IYCF 2E2IF 2JA6E 4YFXE 4JK1E 3GTOE 3S16F 5M5YE 2NVQF 2E2HE 2VUMF 2A6EE 4A3LE 3HOVF 1Y1VE 2R7ZF 3FKIE 4AYBK 2A6HE 2JA6F 4A93E 4G7HE 4A3BE 3GTLF 5TMCE 5M3ME 4KMUE 4C2ME 2PPBE 3GTPF 4A3DF 2NVYF 5M5XF 3GTLE 1I3QF 3DXJE 5IYBE 3FKIF 4Y7NF 2R7ZE 4A3KF 1I50F 3H0GF 1TWAF 1TWGE 2WB1I 5C4JE 4A3ME 2JA7F 4GZYE 1EIKA 5M3FF 4XLNE 5C3EF 4A3JE 3M4OE 4A3MF 3H3VG 2YU9E 3GTJE 1IW7E 2O5IE 2A69E 5IP7E 4OINE 4XSZE 5C44F 2NVTE 2JA8E 5M3MF 1YNJK 4YFNE 3GTJF 4C3JE 1Y1WE 2R92F 3HOWF 4A3IF 4BBSF 4XSXE 4A93F 3S2DF 3EQLE 5M3FE 5C4XF 4C3HF 3PO3E 2B63F 4Q4ZE 4LK0E 4A3KE 2JA5F 4A3CE 5M5YF 1YNNK 4A3IE 3I4ME 3K7AE 2R93E 4C3JF 1Y1WF 3GTKF 5FJ8F 3HOXE 2E2IE 3I4NE 4A3DE 3S2HE 3HOXF 3HOZF 4BY7E 5D4EE 3H3VF 5M5WE 3S1RF 2JA5E 4A3CF 4Y52E 1Y1VF 5E18E 3CQZF 5TMFE 4MEXE 3GTGF 3PO3F 4A3GE 2E2HF 5C3EE 4A3JF 3GTGE 1R9TF 1WCMF 4A3GF 1TWAE 1SFOF 3S16E 1I50E 3H0GE 2Y0SH 1I6HF 2O5JE 4OIPE 3PO2F 3HKZH 4AYBH 5IYBF 1TWFE 3GTME 1K83F 2JA8F 3HOZE 3S1NE 4QIWK 2NVXE 1TWCF 4C2MF 3S17E 3I4NF 5FLMF 2E2JF 4YG2E 5BYHE 2R93F 3RZDE 1TWHF 5IPLE 4X6AE 4Q5SE 4XLPE 2JA7E 4MEYE 1QKLA 1TWGF 3CQZE 2VUME 2PMZK 4X6AF 4KN7E 5M5WF 1SMYE 2A68E 2NVYE 5M5XE 2NVXF 3M3YF 3S17F 3GTPE 5E17E 4BY1F 3GTKE 1TWFF 5IYDE 3GTMF 3I4MF 3S1NF 4C3IF 4BBRF 2KRXA 4OIQE 1SFOE 4A3EE 3S14E 4A3LF 3GTQE 3M4OF 3HKZK
chains in the Genus database with same CATH topology
3RZDF 3GTQF 4ZH4E 5C4JF 3HOUF 2CW0E 4G7OE 4KN4E 5D4CE 2NVTF 3S2HF 4YFKE 4A3BF 2YU9F 3K7AF 1ZYRE 2Y0SI 3HOYF 2BE5E 3WODE 5IP9F 4A3EF 3S15F 3S14F 4G7ZE 4MQ9E 5IYDF 4BY7F 4LJZE 4LLGE 3RZOF 4BXXF 1I6VE 3S1MF 4A3FF 5D4DE 4OIOE 1HQME 2WAQK 3GTOF 4Y52F 4LK1E 4OIRE 3S1QF 5IP7F 2E2IF 5IYCF 4YFXE 4JK1E 3S16F 2NVQF 2VUMF 2A6EE 3HOVF 2R7ZF 4AYBK 2A6HE 2JA6F 4G7HE 3GTLF 5TMCE 3GTPF 4KMUE 2PPBE 4A3DF 2NVYF 5M5XF 1I3QF 3DXJE 3FKIF 4Y7NF 4A3KF 1I50F 3H0GF 1TWAF 4GZYE 2WB1I 2JA7F 5M3FF 4XLNE 5C3EF 4A3MF 3H3VG 2O5IE 1IW7E 2A69E 4OINE 4XSZE 5C44F 5M3MF 1YNJK 4YFNE 3GTJF 4BBSF 2R92F 3HOWF 4A93F 4A3IF 4XSXE 3S2DF 3EQLE 5C4XF 4C3HF 2B63F 4Q4ZE 4LK0E 2JA5F 5M5YF 1YNNK 4C3JF 1Y1WF 3GTKF 5FJ8F 3HOXF 3HOZF 5D4EE 3S1RF 4A3CF 1Y1VF 5E18E 3CQZF 5TMFE 4MEXE 3GTGF 3PO3F 2E2HF 4A3JF 4A3GF 1R9TF 1WCMF 1SFOF 2O5JE 1I6HF 4OIPE 3PO2F 5IYBF 1K83F 2JA8F 4QIWK 1TWCF 4C2MF 3I4NF 5FLMF 2E2JF 4YG2E 5BYHE 2R93F 1TWHF 5IPLE 4Q5SE 4XLPE 4MEYE 1QKLA 1TWGF 4X6AF 2PMZK 4KN7E 5M5WF 2A68E 1SMYE 3M3YF 5E17E 2NVXF 3S17F 4BY1F 1TWFF 3GTMF 3I4MF 3S1NF 4C3IF 4BBRF 2KRXA 4OIQE 4A3LF 3M4OF 3HKZK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZD F;  3GTQ F;  4ZH4 E;  5C4J F;  3HOU F;  2CW0 E;  4G7O E;  4KN4 E;  5D4C E;  2NVT F;  3S2H F;  4YFK E;  4A3B F;  2YU9 F;  3K7A F;  1ZYR E;  2Y0S I;  3HOY F;  2BE5 E;  3WOD E;  5IP9 F;  4A3E F;  3S15 F;  3S14 F;  4G7Z E;  4MQ9 E;  5IYD F;  4BY7 F;  4LJZ E;  4LLG E;  3RZO F;  4BXX F;  1I6V E;  3S1M F;  4A3F F;  5D4D E;  4OIO E;  1HQM E;  2WAQ K;  3GTO F;  4Y52 F;  4LK1 E;  4OIR E;  3S1Q F;  5IP7 F;  2E2I F;  5IYC F;  4YFX E;  4JK1 E;  3S16 F;  2NVQ F;  2VUM F;  2A6E E;  3HOV F;  2R7Z F;  4AYB K;  2A6H E;  2JA6 F;  4G7H E;  3GTL F;  5TMC E;  3GTP F;  4KMU E;  2PPB E;  4A3D F;  2NVY F;  5M5X F;  1I3Q F;  3DXJ E;  3FKI F;  4Y7N F;  4A3K F;  1I50 F;  3H0G F;  1TWA F;  4GZY E;  2WB1 I;  2JA7 F;  5M3F F;  4XLN E;  5C3E F;  4A3M F;  3H3V G;  2O5I E;  1IW7 E;  2A69 E;  4OIN E;  4XSZ E;  5C44 F;  5M3M F;  1YNJ K;  4YFN E;  3GTJ F;  4BBS F;  2R92 F;  3HOW F;  4A93 F;  4A3I F;  4XSX E;  3S2D F;  3EQL E;  5C4X F;  4C3H F;  2B63 F;  4Q4Z E;  4LK0 E;  2JA5 F;  5M5Y F;  1YNN K;  4C3J F;  1Y1W F;  3GTK F;  5FJ8 F;  3HOX F;  3HOZ F;  5D4E E;  3S1R F;  4A3C F;  1Y1V F;  5E18 E;  3CQZ F;  5TMF E;  4MEX E;  3GTG F;  3PO3 F;  2E2H F;  4A3J F;  4A3G F;  1R9T F;  1WCM F;  1SFO F;  2O5J E;  1I6H F;  4OIP E;  3PO2 F;  5IYB F;  1K83 F;  2JA8 F;  1TWC F;  4C2M F;  3I4N F;  5FLM F;  2E2J F;  4YG2 E;  5BYH E;  2R93 F;  1TWH F;  5IPL E;  4Q5S E;  4XLP E;  4MEY E;  1QKL A;  1TWG F;  4X6A F;  2PMZ K;  4KN7 E;  5M5W F;  2A68 E;  1SMY E;  3M3Y F;  5E17 E;  2NVX F;  3S17 F;  4BY1 F;  1TWF F;  3GTM F;  3I4M F;  3S1N F;  4C3I F;  4BBR F;  4OIQ E;  4A3L F;  3M4O F;  3HKZ K; 
#chains in the Genus database with same CATH topology
 3RZD F;  3GTQ F;  4ZH4 E;  5C4J F;  3HOU F;  2R92 E;  2CW0 E;  4C3I E;  5IYC E;  2WB1 H;  5FLM E;  4Y7N E;  2E2J E;  4KN4 E;  3S1M E;  3S1Q E;  4G7O E;  3RZO E;  4BXX E;  1I3Q E;  5D4C E;  4BY1 E;  5C44 E;  2NVT F;  2WAQ H;  3S2H F;  3PO2 E;  1DZF A;  3M3Y E;  4YFK E;  4A3B F;  1I6H E;  2YU9 F;  3K7A F;  1ZYR E;  2Y0S I;  1R9T E;  2B63 E;  5IP9 E;  3S15 E;  3HOY F;  2BE5 E;  3WOD E;  5IP9 F;  4A3E F;  3S15 F;  4BBR E;  4G7Z E;  3S14 F;  2NVQ E;  3S2D E;  5C4X E;  4MQ9 E;  3HOW E;  5IYD F;  4BY7 F;  4BBS E;  4LJZ E;  4LLG E;  1K83 E;  3RZO F;  4QIW H;  4BXX F;  1I6V E;  3S1M F;  4A3F F;  5D4D E;  4OIO E;  3HOU E;  3HOV E;  1WCM E;  3HOY E;  4C3H E;  1HQM E;  1TWH E;  2WAQ K;  3GTO F;  2PMZ H;  4Y52 F;  4LK1 E;  4A3F E;  3S1R E;  1TWC E;  4OIR E;  3S1Q F;  5IP7 F;  5FJ8 E;  5IYC F;  2E2I F;  2JA6 E;  4YFX E;  4JK1 E;  3GTO E;  3S16 F;  5M5Y E;  2NVQ F;  2E2H E;  2VUM F;  2A6E E;  4A3L E;  3HOV F;  1Y1V E;  2R7Z F;  3FKI E;  4AYB K;  2A6H E;  2JA6 F;  4A93 E;  4G7H E;  4A3B E;  3GTL F;  5TMC E;  5M3M E;  4KMU E;  4C2M E;  2PPB E;  3GTP F;  4A3D F;  2NVY F;  5M5X F;  3GTL E;  1I3Q F;  3DXJ E;  5IYB E;  3FKI F;  4Y7N F;  2R7Z E;  4A3K F;  1I50 F;  3H0G F;  1TWA F;  1TWG E;  2WB1 I;  5C4J E;  4A3M E;  2JA7 F;  4GZY E;  1EIK A;  5M3F F;  4XLN E;  5C3E F;  4A3J E;  3M4O E;  4A3M F;  3H3V G;  2YU9 E;  3GTJ E;  1IW7 E;  2O5I E;  2A69 E;  5IP7 E;  4OIN E;  4XSZ E;  5C44 F;  2NVT E;  2JA8 E;  5M3M F;  1YNJ K;  4YFN E;  3GTJ F;  4C3J E;  1Y1W E;  2R92 F;  3HOW F;  4A3I F;  4BBS F;  4XSX E;  4A93 F;  3S2D F;  3EQL E;  5M3F E;  5C4X F;  4C3H F;  3PO3 E;  2B63 F;  4Q4Z E;  4LK0 E;  4A3K E;  2JA5 F;  4A3C E;  5M5Y F;  1YNN K;  4A3I E;  3I4M E;  3K7A E;  2R93 E;  4C3J F;  1Y1W F;  3GTK F;  5FJ8 F;  3HOX E;  2E2I E;  3I4N E;  4A3D E;  3S2H E;  3HOX F;  3HOZ F;  4BY7 E;  5D4E E;  3H3V F;  5M5W E;  3S1R F;  2JA5 E;  4A3C F;  4Y52 E;  1Y1V F;  5E18 E;  3CQZ F;  5TMF E;  4MEX E;  3GTG F;  3PO3 F;  4A3G E;  2E2H F;  5C3E E;  4A3J F;  3GTG E;  1R9T F;  1WCM F;  4A3G F;  1TWA E;  1SFO F;  3S16 E;  1I50 E;  3H0G E;  2Y0S H;  1I6H F;  2O5J E;  4OIP E;  3PO2 F;  3HKZ H;  4AYB H;  5IYB F;  1TWF E;  3GTM E;  1K83 F;  2JA8 F;  3HOZ E;  3S1N E;  4QIW K;  2NVX E;  1TWC F;  4C2M F;  3S17 E;  3I4N F;  5FLM F;  2E2J F;  4YG2 E;  5BYH E;  2R93 F;  3RZD E;  1TWH F;  5IPL E;  4X6A E;  4Q5S E;  4XLP E;  2JA7 E;  4MEY E;  1QKL A;  1TWG F;  3CQZ E;  2VUM E;  2PMZ K;  4X6A F;  4KN7 E;  5M5W F;  1SMY E;  2A68 E;  2NVY E;  5M5X E;  2NVX F;  3M3Y F;  3S17 F;  3GTP E;  5E17 E;  4BY1 F;  3GTK E;  1TWF F;  5IYD E;  3GTM F;  3I4M F;  3S1N F;  4C3I F;  4BBR F;  2KRX A;  4OIQ E;  1SFO E;  4A3E E;  3S14 E;  4A3L F;  3GTQ E;  3M4O F;  3HKZ K; 
#chains in the Genus database with same CATH homology
 3RZD F;  3GTQ F;  4ZH4 E;  5C4J F;  3HOU F;  2CW0 E;  4G7O E;  4KN4 E;  5D4C E;  2NVT F;  3S2H F;  4YFK E;  4A3B F;  2YU9 F;  3K7A F;  1ZYR E;  2Y0S I;  3HOY F;  2BE5 E;  3WOD E;  5IP9 F;  4A3E F;  3S15 F;  3S14 F;  4G7Z E;  4MQ9 E;  5IYD F;  4BY7 F;  4LJZ E;  4LLG E;  3RZO F;  4BXX F;  1I6V E;  3S1M F;  4A3F F;  5D4D E;  4OIO E;  1HQM E;  2WAQ K;  3GTO F;  4Y52 F;  4LK1 E;  4OIR E;  3S1Q F;  5IP7 F;  2E2I F;  5IYC F;  4YFX E;  4JK1 E;  3S16 F;  2NVQ F;  2VUM F;  2A6E E;  3HOV F;  2R7Z F;  4AYB K;  2A6H E;  2JA6 F;  4G7H E;  3GTL F;  5TMC E;  3GTP F;  4KMU E;  2PPB E;  4A3D F;  2NVY F;  5M5X F;  1I3Q F;  3DXJ E;  3FKI F;  4Y7N F;  4A3K F;  1I50 F;  3H0G F;  1TWA F;  4GZY E;  2WB1 I;  2JA7 F;  5M3F F;  4XLN E;  5C3E F;  4A3M F;  3H3V G;  2O5I E;  1IW7 E;  2A69 E;  4OIN E;  4XSZ E;  5C44 F;  5M3M F;  1YNJ K;  4YFN E;  3GTJ F;  4BBS F;  2R92 F;  3HOW F;  4A93 F;  4A3I F;  4XSX E;  3S2D F;  3EQL E;  5C4X F;  4C3H F;  2B63 F;  4Q4Z E;  4LK0 E;  2JA5 F;  5M5Y F;  1YNN K;  4C3J F;  1Y1W F;  3GTK F;  5FJ8 F;  3HOX F;  3HOZ F;  5D4E E;  3S1R F;  4A3C F;  1Y1V F;  5E18 E;  3CQZ F;  5TMF E;  4MEX E;  3GTG F;  3PO3 F;  2E2H F;  4A3J F;  4A3G F;  1R9T F;  1WCM F;  1SFO F;  2O5J E;  1I6H F;  4OIP E;  3PO2 F;  5IYB F;  1K83 F;  2JA8 F;  4QIW K;  1TWC F;  4C2M F;  3I4N F;  5FLM F;  2E2J F;  4YG2 E;  5BYH E;  2R93 F;  1TWH F;  5IPL E;  4Q5S E;  4XLP E;  4MEY E;  1QKL A;  1TWG F;  4X6A F;  2PMZ K;  4KN7 E;  5M5W F;  2A68 E;  1SMY E;  3M3Y F;  5E17 E;  2NVX F;  3S17 F;  4BY1 F;  1TWF F;  3GTM F;  3I4M F;  3S1N F;  4C3I F;  4BBR F;  2KRX A;  4OIQ E;  4A3L F;  3M4O F;  3HKZ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...