4A93I

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a93I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a93I02
2E2JI 4NB9A 3VMGA 2B63I 4QTTA 3S15I 2J6AA 3LUSA 2HF1A 5IP9I 1K83I 3M3YI 1USPB 3S1NI 2KPIA 4BXXI 3VB9A 1TFIA 1TWFI 2DE7A 3VMIA 2R7ZI 1WCMI 2R92I 3VMHA 4BY1I 2BJOA 2F4OA 2R93I 3GTGI 4NBEA 3GTKI 3GTMS 3S1RI 2RBLA 2JA6I 1RLYA 3I4MI 3D6WA 2E2HI 1TWHI 5C44I 4NBHA 3HOWI 3S14I 4QTUA 4A3MI 1TWCI 3HOVI 5C4XI 3HOUI 1YUAA 4BBSI 2JS4A 1X3ZA 4NBGA 1QYPA 3GTMI 1ZB9A 4A3FI 3S2HI 1Y1VS 3HOZI 5C4JI 1L1OC 4NB8A 2JA8I 2K5RA 1ZB8A 2F4MA 1NUIA 2NVYI 1USPA 3GTLI 4A3LI 3GKQA 3PO3S 3S17I 1DL6A 4A3GI 4NBCA 4NOZA 2JA7I 4NBBA 1I6HI 1Y1VI 2YU9I 1WW9A 3S2DI 1ML8A 1VLAA 1LQLA 4A3II 3S16I 2AKLA 4NBFA 3I4NI 3RZOI 3HOXI 1SFOI 2NVXI 5CM2M 1I3QI 2NVTI 3EERA 2DE6A 2P3YA 1Y1WI 1RO4A 1X3WA 1R9TI 3HOYI 3FKII 1N2FA 2E2II 3GTQI 3RZDI 4A3BI 2JA5I 4A3DI 1TWAI 3PO2I 3S1MI 3GCFA 3Q87A 3K7AI 3U50C 5FLMI 3ESWA 2JNYA 2NVQI 4XX2A 2VUMI 4Y7NI 3H3VJ 4A93I 3S1QI 3H0GI 3M4OI 3PO3I 2DE5A 5C3EI 4NBDA 4A3KI 1I50I 4Y52I 1TWGI 4BY7I 4NBAA 4A3CI 3CQZI 4BBRI 3I07A 4A3EI 4MH4A 3GTPI 1PFTA 2PK7A 3GTJI 5IP7I 2JR6A 3GTOI 4A3JI 4X6AI
chains in the Genus database with same CATH superfamily
3CCL1 1JWHC 2AYDA 1Q812 2J6AA 5IP9I 2HF1A 2E7ZA 1S7MA 2P28A 3CCS1 3CMEZ 1TFIA 1S72Z 2QR1B 3CC4Z 2BJOA 2F4OA 3GTGI 4NBEA 2RBLA 1NP6A 3I561 1RO0A 1VQMZ 2QRCB 3D6WA 4NFRA 1QVFZ 1S721 1TWHI 4MD8A 4QTUA 3JAMb 1YITZ 1X3ZA 1Q821 3CMA1 1ZB9A 1Y1VS 3HOZI 5C4JI 3G71Z 2F4MA 3GTLI 4A3LI 4E2ZA 3OW2Z 2O4HA 3G6E1 1KQSY 4NBCA 1VQNZ 3S2DI 1VLAA 2JIQA 3QWUA 2AKLA 3RZOI 2H85A 2LIYA 4DGLA 3CCVZ 1FDOA 4RS4A 1QVGY 1X3WA 1R9TI 3FKII 3RZDI 2JA5I 5A2Qb 3J81b 3GCFA 1FDIA 3K7AI 2IV2X 3F3PC 1X0TA 4XX2A 2VUMI 4A93I 3F3FC 1M1K1 2K3RA 3MZLB 1NJI2 3CMAZ 2DE5A 5C3EI 2PMZA 4NBDA 1K8A1 1RO2A 4Y52I 4A3CI 1YJ91 4HGZA 3CXCY 3CCRZ 3CC2Z 3I07A 1VQ71 3BG0B 4MONA 2PK7A 1YJN1 3GTJI 5IP7I 3J81f 3NH5A 3GTOI 1VQ5Z 5A2Qf 2E2JI 2M48A 3VMGA 1VQ61 3S15I 1YHQZ 2VPXA 3CCSZ 1WJ2A 3S1NI 3CCJZ 4AYBA 1TWFI 4MD9A 1YIJZ 3VMHA 4BY1I 1VQ91 4HGYA 3VTNA 1Q811 3CCE1 1Z03A 5T64A 3GTMS 3S1RI 4CL1A 1VQM1 1K9M1 2JA6I 1M901 3HOWI 4A3MI 2V3VA 3IF8A 5C4XI 3HOUI 1YUAA 2JUBA 4NBGA 1QYPA 2RIQA 3GTMI 3NDIA 4E33A 1YI21 1KC81 5FLXb 5FLXf 1Z01A 1Q7Y1 2QA41 2VUGA 3CCQZ 1NUIA 2NVYI 3S17I 2V45A 2JA7I 2YU9I 4HH4A 1LQLA 2OTL1 2IZ3A 1I3QI 3G6EZ 3EERA 1YJNZ 1YIT1 3FQMA 3CCEZ 2RT9A 3CC41 3CCLZ 1VQ6Z 1KD11 4A3DI 1Q861 3PO2I 3S1MI 2JMOA 1RQFA 2NVQI 3J80f 2QEXZ 3CCU1 3H3VJ 2W03A 1M1K2 3CC21 2JIOA 3S1QI 3JAMf 3CC71 4A3KI 3D2LA 1QVFY 2JIMA 2V8IA 1TWGI 2WB1A 4NBAA 1YJ9Z 3J7A4 2I3CA 1VQ4Z 2OTLZ 4MH4A 3I56Z 3CME1 3EEDA 3IFUA 1PFTA 2VF1A 1W2BZ 4A3JI 1YUKA 4NB9A 5D1PA 4RVFA 2GU2A 1VQ8Z 3LUSA 1K83I 1VQ41 3M3YI 1USPB 4E30A 1VQK1 2KPIA 1KQSZ 4BXXI 2QLVB 3VB9A 1QXFA 2DE7A 2R7ZI 2OTJ1 4E2WA 3G711 3GTKI 1YHQ1 4MRIA 3CCMZ 3CD61 1RLYA 3CCV1 2GTIA 2G2KA 2QEX1 1QVGZ 4S1TA 2Q4ZA 5C44I 2E2HI 1VQL1 4RVGA 3CCQ1 4BBSI 1VQ9Z 2OOYB 1Z02A 1ZH1A 2JIPA 2VPWA 2QA4Z 2R6MA 3S2HI 1W2BY 2KI7B 3CCUZ 1YJW1 2QRDB 1USPA 1SIWA 3CCR1 3GKQA 3MZKB 4A3GI 3TDHB 4NOZA 4E2XA 4NBBA 3NDJA 3IR7A 4A3II 3S16I 3I4NI 4NBFA 3CXCZ 1N8R1 3HOXI 1SFOI 3KIHA 1K8A2 5CM2M 1Q822 2P3YA 1K732 4E31A 1Y1WI 1KC82 1RNIA 3NH8A 3KIFA 1VQO1 1N2FA 2E2II 3GTQI 1VQ7Z 4A3BI 1TWAI 2GTHA 3Q87A 3U50C 3ESWA 4Y7NI 2Y0SA 1NJI1 2W04A 5D1OA 5LL6f 3M4OI 1VQKZ 2OZKA 3PO3I 3G4SZ 3HKZA 1I50I 5T6BA 5IT9b 1VQPZ 4BY7I 4MXUA 3I551 3CQZI 4BBRI 2M6NA 4A3EI 3NH4A 3GTPI 3TE5B 2PM9A 2JR6A 2LFUA 2RPRA 3OW2Y 4X6AI 2HU9A 1VQP1 1JJ2Z 2YADA 2B63I 4QTTA 2IZ4A 3BG1B 3CCM1 4MD7A 3CPWY 4DQYB 5AN9F 3VMIA 2OTJZ 1WCMI 2R92I 1VQLZ 1VQ51 2EGTA 4E32A 3I55Z 2RHBA 2R93I 4TNUA 2E9HA 3CC7Z 2LEXA 3T4NB 3I4MI 4NBHA 3S14I 1TWCI 3HOVI 1KRLA 2JS4A 2JIRA 5D1OB 3G4S1 1AA6A 4A3FI 4DK1A 1YIJ1 1Q7Y2 2O53A 1L1OC 2VPZA 4NB8A 1VQOZ 1QF8A 2JA8I 2K5RA 1ZB8A 3MONA 3PO3S 1DL6A 4RVHA 2V8JA 2QKDA 1I6HI 1Y1VI 3IX0A 1WW9A 1ML8A 1KD12 2VPYA 3J80b 2NVXI 1JJ2Y 2NVTI 2ZAEB 2DE6A 1WZNA 2NAPA 1RO4A 3HOYI 2OOXB 1YJWZ 4E2YA 4EWCA 3FQQA 1YI2Z 5FLMI 1K731 1Y8CA 2JNYA 1VQN1 2WAQA 1WIIA 3P5JB 3H0GI 3D9XA 1Q862 2V8KA 4NH1C 5IT9f 1M902 4RV9A 1Q16A 2QREB 3CPWZ 4RVDA 1VQ81 1N8R2 1K9M2 1P9NA 3CCJ1 5T67A 3CD6Z 2Q51A 3NFZA
chains in the Genus database with same CATH topology
3CCL1 1JWHC 1Q812 2J6AA 5IP9I 2HF1A 1S7MA 2P28A 3CCS1 3CMEZ 1TFIA 1S72Z 2QR1B 3CC4Z 2BJOA 2F4OA 3GTGI 4NBEA 2RBLA 1NP6A 3I561 1RO0A 1VQMZ 2QRCB 3D6WA 4NFRA 1QVFZ 1S721 1TWHI 4MD8A 4QTUA 3JAMb 1YITZ 1X3ZA 1Q821 3CMA1 1ZB9A 1Y1VS 3HOZI 5C4JI 3G71Z 2F4MA 3GTLI 4A3LI 4E2ZA 3OW2Z 2O4HA 3G6E1 1KQSY 4NBCA 1VQNZ 3S2DI 1VLAA 3QWUA 2AKLA 3RZOI 2H85A 2LIYA 4DGLA 3CCVZ 1QVGY 4RS4A 1X3WA 1R9TI 3FKII 3RZDI 2JA5I 5A2Qb 3J81b 3GCFA 3K7AI 3F3PC 1X0TA 4XX2A 2VUMI 4A93I 3F3FC 1M1K1 2K3RA 3MZLB 1NJI2 3CMAZ 2DE5A 5C3EI 2PMZA 4NBDA 1K8A1 1RO2A 4Y52I 4A3CI 1YJ91 4HGZA 3CXCY 3CCRZ 3CC2Z 3I07A 1VQ71 3BG0B 4MONA 2PK7A 1YJN1 3GTJI 5IP7I 3J81f 3NH5A 3GTOI 1VQ5Z 5A2Qf 2E2JI 2M48A 3VMGA 1VQ61 3S15I 1YHQZ 3CCSZ 3S1NI 3CCJZ 4AYBA 1TWFI 4MD9A 1YIJZ 3VMHA 4BY1I 1VQ91 4HGYA 3VTNA 1Q811 3CCE1 1Z03A 5T64A 3GTMS 3S1RI 4CL1A 1VQM1 1K9M1 2JA6I 1M901 3HOWI 4A3MI 3IF8A 5C4XI 3HOUI 1YUAA 2JUBA 4NBGA 1QYPA 2RIQA 3GTMI 3NDIA 4E33A 1YI21 1KC81 5FLXb 5FLXf 1Z01A 1Q7Y1 2QA41 2VUGA 3CCQZ 1NUIA 2NVYI 3S17I 2JA7I 2YU9I 4HH4A 1LQLA 2OTL1 2IZ3A 1I3QI 3G6EZ 3EERA 1YJNZ 1YIT1 3FQMA 3CCEZ 2RT9A 3CC41 3CCLZ 1VQ6Z 1KD11 4A3DI 1Q861 3PO2I 3S1MI 2JMOA 1RQFA 2NVQI 3J80f 2QEXZ 3CCU1 3H3VJ 2W03A 1M1K2 3CC21 3S1QI 3JAMf 3CC71 4A3KI 1QVFY 2V8IA 1TWGI 2WB1A 4NBAA 1YJ9Z 3J7A4 2I3CA 1VQ4Z 2OTLZ 4MH4A 3I56Z 3CME1 3EEDA 3IFUA 1PFTA 2VF1A 1W2BZ 4A3JI 1YUKA 4NB9A 5D1PA 4RVFA 2GU2A 1VQ8Z 3LUSA 1K83I 1VQ41 3M3YI 1USPB 4E30A 1VQK1 2KPIA 1KQSZ 4BXXI 2QLVB 3VB9A 2DE7A 2R7ZI 2OTJ1 4E2WA 3G711 3GTKI 1YHQ1 4MRIA 3CCMZ 3CD61 1RLYA 3CCV1 2GTIA 2G2KA 2QEX1 1QVGZ 4S1TA 2Q4ZA 5C44I 2E2HI 1VQL1 4RVGA 3CCQ1 4BBSI 1VQ9Z 2OOYB 1Z02A 1ZH1A 2QA4Z 2R6MA 3S2HI 1W2BY 2KI7B 3CCUZ 1YJW1 2QRDB 1USPA 3CCR1 3GKQA 3MZKB 4A3GI 3TDHB 4NOZA 4E2XA 4NBBA 3NDJA 4A3II 3S16I 3I4NI 4NBFA 3CXCZ 1N8R1 3HOXI 1SFOI 3KIHA 1K8A2 5CM2M 1Q822 2P3YA 1K732 4E31A 1Y1WI 1KC82 1RNIA 3NH8A 3KIFA 1VQO1 1N2FA 2E2II 3GTQI 1VQ7Z 4A3BI 1TWAI 2GTHA 3Q87A 3U50C 3ESWA 4Y7NI 2Y0SA 1NJI1 2W04A 5D1OA 5LL6f 3M4OI 1VQKZ 2OZKA 3PO3I 3G4SZ 3HKZA 1I50I 5T6BA 5IT9b 1VQPZ 4BY7I 4MXUA 3I551 3CQZI 4BBRI 2M6NA 4A3EI 3NH4A 3GTPI 3TE5B 2PM9A 2JR6A 2LFUA 2RPRA 3OW2Y 4X6AI 2HU9A 1VQP1 1JJ2Z 2YADA 2B63I 4QTTA 2IZ4A 3BG1B 3CCM1 4MD7A 3CPWY 4DQYB 5AN9F 3VMIA 2OTJZ 1WCMI 2R92I 1VQLZ 1VQ51 2EGTA 4E32A 3I55Z 2RHBA 2R93I 4TNUA 2E9HA 3CC7Z 3T4NB 3I4MI 4NBHA 3S14I 1TWCI 3HOVI 1KRLA 2JS4A 5D1OB 3G4S1 4A3FI 4DK1A 1YIJ1 1Q7Y2 2O53A 1L1OC 4NB8A 1VQOZ 1QF8A 2JA8I 2K5RA 1ZB8A 3MONA 3PO3S 1DL6A 4RVHA 2V8JA 2QKDA 1I6HI 1Y1VI 3IX0A 1WW9A 1ML8A 1KD12 3J80b 2NVXI 1JJ2Y 2NVTI 2ZAEB 2DE6A 1RO4A 3HOYI 2OOXB 1YJWZ 4E2YA 4EWCA 3FQQA 1YI2Z 5FLMI 1K731 2JNYA 1VQN1 2WAQA 1WIIA 3P5JB 3H0GI 3D9XA 1Q862 2V8KA 4NH1C 5IT9f 1M902 4RV9A 2QREB 3CPWZ 4RVDA 1VQ81 1N8R2 1K9M2 1P9NA 3CCJ1 5T67A 3CD6Z 2Q51A 3NFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2J I;  4NB9 A;  3VMG A;  2B63 I;  4QTT A;  3S15 I;  2J6A A;  3LUS A;  2HF1 A;  5IP9 I;  1K83 I;  3M3Y I;  1USP B;  3S1N I;  2KPI A;  4BXX I;  3VB9 A;  1TFI A;  1TWF I;  2DE7 A;  3VMI A;  2R7Z I;  1WCM I;  2R92 I;  3VMH A;  4BY1 I;  2BJO A;  2F4O A;  2R93 I;  3GTG I;  4NBE A;  3GTK I;  3GTM S;  3S1R I;  2RBL A;  2JA6 I;  1RLY A;  3I4M I;  3D6W A;  2E2H I;  1TWH I;  5C44 I;  4NBH A;  3HOW I;  3S14 I;  4QTU A;  4A3M I;  1TWC I;  3HOV I;  5C4X I;  3HOU I;  1YUA A;  4BBS I;  2JS4 A;  1X3Z A;  4NBG A;  1QYP A;  3GTM I;  1ZB9 A;  4A3F I;  3S2H I;  1Y1V S;  3HOZ I;  5C4J I;  1L1O C;  4NB8 A;  2JA8 I;  2K5R A;  1ZB8 A;  2F4M A;  1NUI A;  2NVY I;  1USP A;  3GTL I;  4A3L I;  3GKQ A;  3PO3 S;  3S17 I;  1DL6 A;  4A3G I;  4NBC A;  4NOZ A;  2JA7 I;  4NBB A;  1I6H I;  1Y1V I;  2YU9 I;  1WW9 A;  3S2D I;  1ML8 A;  1VLA A;  1LQL A;  4A3I I;  3S16 I;  2AKL A;  4NBF A;  3I4N I;  3RZO I;  3HOX I;  1SFO I;  2NVX I;  5CM2 M;  1I3Q I;  2NVT I;  3EER A;  2DE6 A;  2P3Y A;  1Y1W I;  1RO4 A;  1X3W A;  1R9T I;  3HOY I;  3FKI I;  1N2F A;  2E2I I;  3GTQ I;  3RZD I;  4A3B I;  2JA5 I;  4A3D I;  1TWA I;  3PO2 I;  3S1M I;  3GCF A;  3Q87 A;  3K7A I;  3U50 C;  5FLM I;  3ESW A;  2JNY A;  2NVQ I;  4XX2 A;  2VUM I;  4Y7N I;  3H3V J;  4A93 I;  3S1Q I;  3H0G I;  3M4O I;  3PO3 I;  2DE5 A;  5C3E I;  4NBD A;  4A3K I;  1I50 I;  4Y52 I;  1TWG I;  4BY7 I;  4NBA A;  4A3C I;  3CQZ I;  4BBR I;  3I07 A;  4A3E I;  4MH4 A;  3GTP I;  1PFT A;  2PK7 A;  3GTJ I;  5IP7 I;  2JR6 A;  3GTO I;  4A3J I;  4X6A I; 
#chains in the Genus database with same CATH topology
 3CCL 1;  1JWH C;  2AYD A;  1Q81 2;  2J6A A;  5IP9 I;  2HF1 A;  2E7Z A;  1S7M A;  2P28 A;  3CCS 1;  3CME Z;  1TFI A;  1S72 Z;  2QR1 B;  3CC4 Z;  2BJO A;  2F4O A;  3GTG I;  4NBE A;  2RBL A;  1NP6 A;  3I56 1;  1RO0 A;  1VQM Z;  2QRC B;  3D6W A;  4NFR A;  1QVF Z;  1S72 1;  1TWH I;  4MD8 A;  4QTU A;  3JAM b;  1YIT Z;  1X3Z A;  1Q82 1;  3CMA 1;  1ZB9 A;  1Y1V S;  3HOZ I;  5C4J I;  3G71 Z;  2F4M A;  3GTL I;  4A3L I;  4E2Z A;  3OW2 Z;  2O4H A;  3G6E 1;  1KQS Y;  4NBC A;  1VQN Z;  3S2D I;  1VLA A;  2JIQ A;  3QWU A;  2AKL A;  3RZO I;  2H85 A;  2LIY A;  4DGL A;  3CCV Z;  1FDO A;  4RS4 A;  1QVG Y;  1X3W A;  1R9T I;  3FKI I;  3RZD I;  2JA5 I;  5A2Q b;  3J81 b;  3GCF A;  1FDI A;  3K7A I;  2IV2 X;  3F3P C;  1X0T A;  4XX2 A;  2VUM I;  4A93 I;  3F3F C;  1M1K 1;  2K3R A;  3MZL B;  1NJI 2;  3CMA Z;  2DE5 A;  5C3E I;  2PMZ A;  4NBD A;  1K8A 1;  1RO2 A;  4Y52 I;  4A3C I;  1YJ9 1;  4HGZ A;  3CXC Y;  3CCR Z;  3CC2 Z;  3I07 A;  1VQ7 1;  3BG0 B;  4MON A;  2PK7 A;  1YJN 1;  3GTJ I;  5IP7 I;  3J81 f;  3NH5 A;  3GTO I;  1VQ5 Z;  5A2Q f;  2E2J I;  2M48 A;  3VMG A;  1VQ6 1;  3S15 I;  1YHQ Z;  2VPX A;  3CCS Z;  1WJ2 A;  3S1N I;  3CCJ Z;  4AYB A;  1TWF I;  4MD9 A;  1YIJ Z;  3VMH A;  4BY1 I;  1VQ9 1;  4HGY A;  3VTN A;  1Q81 1;  3CCE 1;  1Z03 A;  5T64 A;  3GTM S;  3S1R I;  4CL1 A;  1VQM 1;  1K9M 1;  2JA6 I;  1M90 1;  3HOW I;  4A3M I;  2V3V A;  3IF8 A;  5C4X I;  3HOU I;  1YUA A;  2JUB A;  4NBG A;  1QYP A;  2RIQ A;  3GTM I;  3NDI A;  4E33 A;  1YI2 1;  1KC8 1;  5FLX b;  5FLX f;  1Z01 A;  1Q7Y 1;  2QA4 1;  2VUG A;  3CCQ Z;  1NUI A;  2NVY I;  3S17 I;  2V45 A;  2JA7 I;  2YU9 I;  4HH4 A;  1LQL A;  2OTL 1;  2IZ3 A;  1I3Q I;  3G6E Z;  3EER A;  1YJN Z;  1YIT 1;  3FQM A;  3CCE Z;  2RT9 A;  3CC4 1;  3CCL Z;  1VQ6 Z;  1KD1 1;  4A3D I;  1Q86 1;  3PO2 I;  3S1M I;  2JMO A;  1RQF A;  2NVQ I;  3J80 f;  2QEX Z;  3CCU 1;  3H3V J;  2W03 A;  1M1K 2;  3CC2 1;  2JIO A;  3S1Q I;  3JAM f;  3CC7 1;  4A3K I;  3D2L A;  1QVF Y;  2JIM A;  2V8I A;  1TWG I;  2WB1 A;  4NBA A;  1YJ9 Z;  3J7A 4;  2I3C A;  1VQ4 Z;  2OTL Z;  4MH4 A;  3I56 Z;  3CME 1;  3EED A;  3IFU A;  1PFT A;  2VF1 A;  1W2B Z;  4A3J I;  1YUK A;  4NB9 A;  5D1P A;  4RVF A;  2GU2 A;  1VQ8 Z;  3LUS A;  1K83 I;  1VQ4 1;  3M3Y I;  1USP B;  4E30 A;  1VQK 1;  2KPI A;  1KQS Z;  4BXX I;  2QLV B;  3VB9 A;  1QXF A;  2DE7 A;  2R7Z I;  2OTJ 1;  4E2W A;  3G71 1;  3GTK I;  1YHQ 1;  4MRI A;  3CCM Z;  3CD6 1;  1RLY A;  3CCV 1;  2GTI A;  2G2K A;  2QEX 1;  1QVG Z;  4S1T A;  2Q4Z A;  5C44 I;  2E2H I;  1VQL 1;  4RVG A;  3CCQ 1;  4BBS I;  1VQ9 Z;  2OOY B;  1Z02 A;  1ZH1 A;  2JIP A;  2VPW A;  2QA4 Z;  2R6M A;  3S2H I;  1W2B Y;  2KI7 B;  3CCU Z;  1YJW 1;  2QRD B;  1USP A;  1SIW A;  3CCR 1;  3GKQ A;  3MZK B;  4A3G I;  3TDH B;  4NOZ A;  4E2X A;  4NBB A;  3NDJ A;  3IR7 A;  4A3I I;  3S16 I;  3I4N I;  4NBF A;  3CXC Z;  1N8R 1;  3HOX I;  1SFO I;  3KIH A;  1K8A 2;  5CM2 M;  1Q82 2;  2P3Y A;  1K73 2;  4E31 A;  1Y1W I;  1KC8 2;  1RNI A;  3NH8 A;  3KIF A;  1VQO 1;  1N2F A;  2E2I I;  3GTQ I;  1VQ7 Z;  4A3B I;  1TWA I;  2GTH A;  3Q87 A;  3U50 C;  3ESW A;  4Y7N I;  2Y0S A;  1NJI 1;  2W04 A;  5D1O A;  5LL6 f;  3M4O I;  1VQK Z;  2OZK A;  3PO3 I;  3G4S Z;  3HKZ A;  1I50 I;  5T6B A;  5IT9 b;  1VQP Z;  4BY7 I;  4MXU A;  3I55 1;  3CQZ I;  4BBR I;  2M6N A;  4A3E I;  3NH4 A;  3GTP I;  3TE5 B;  2PM9 A;  2JR6 A;  2LFU A;  2RPR A;  3OW2 Y;  4X6A I;  2HU9 A;  1VQP 1;  1JJ2 Z;  2YAD A;  2B63 I;  4QTT A;  2IZ4 A;  3BG1 B;  3CCM 1;  4MD7 A;  3CPW Y;  4DQY B;  5AN9 F;  3VMI A;  2OTJ Z;  1WCM I;  2R92 I;  1VQL Z;  1VQ5 1;  2EGT A;  4E32 A;  3I55 Z;  2RHB A;  2R93 I;  4TNU A;  2E9H A;  3CC7 Z;  2LEX A;  3T4N B;  3I4M I;  4NBH A;  3S14 I;  1TWC I;  3HOV I;  1KRL A;  2JS4 A;  2JIR A;  5D1O B;  3G4S 1;  1AA6 A;  4A3F I;  4DK1 A;  1YIJ 1;  1Q7Y 2;  2O53 A;  1L1O C;  2VPZ A;  4NB8 A;  1VQO Z;  1QF8 A;  2JA8 I;  2K5R A;  1ZB8 A;  3MON A;  3PO3 S;  1DL6 A;  4RVH A;  2V8J A;  2QKD A;  1I6H I;  1Y1V I;  3IX0 A;  1WW9 A;  1ML8 A;  1KD1 2;  2VPY A;  3J80 b;  2NVX I;  1JJ2 Y;  2NVT I;  2ZAE B;  2DE6 A;  1WZN A;  2NAP A;  1RO4 A;  3HOY I;  2OOX B;  1YJW Z;  4E2Y A;  4EWC A;  3FQQ A;  1YI2 Z;  5FLM I;  1K73 1;  1Y8C A;  2JNY A;  1VQN 1;  2WAQ A;  1WII A;  3P5J B;  3H0G I;  3D9X A;  1Q86 2;  2V8K A;  4NH1 C;  5IT9 f;  1M90 2;  4RV9 A;  1Q16 A;  2QRE B;  3CPW Z;  4RVD A;  1VQ8 1;  1N8R 2;  1K9M 2;  1P9N A;  3CCJ 1;  5T67 A;  3CD6 Z;  2Q51 A;  3NFZ A; 
#chains in the Genus database with same CATH homology
 3CCL 1;  1JWH C;  1Q81 2;  2J6A A;  5IP9 I;  2HF1 A;  1S7M A;  2P28 A;  3CCS 1;  3CME Z;  1TFI A;  1S72 Z;  2QR1 B;  3CC4 Z;  2BJO A;  2F4O A;  3GTG I;  4NBE A;  2RBL A;  1NP6 A;  3I56 1;  1RO0 A;  1VQM Z;  2QRC B;  3D6W A;  4NFR A;  1QVF Z;  1S72 1;  1TWH I;  4MD8 A;  4QTU A;  3JAM b;  1YIT Z;  1X3Z A;  1Q82 1;  3CMA 1;  1ZB9 A;  1Y1V S;  3HOZ I;  5C4J I;  3G71 Z;  2F4M A;  3GTL I;  4A3L I;  4E2Z A;  3OW2 Z;  2O4H A;  3G6E 1;  1KQS Y;  4NBC A;  1VQN Z;  3S2D I;  1VLA A;  3QWU A;  2AKL A;  3RZO I;  2H85 A;  2LIY A;  4DGL A;  3CCV Z;  1QVG Y;  4RS4 A;  1X3W A;  1R9T I;  3FKI I;  3RZD I;  2JA5 I;  5A2Q b;  3J81 b;  3GCF A;  3K7A I;  3F3P C;  1X0T A;  4XX2 A;  2VUM I;  4A93 I;  3F3F C;  1M1K 1;  2K3R A;  3MZL B;  1NJI 2;  3CMA Z;  2DE5 A;  5C3E I;  2PMZ A;  4NBD A;  1K8A 1;  1RO2 A;  4Y52 I;  4A3C I;  1YJ9 1;  4HGZ A;  3CXC Y;  3CCR Z;  3CC2 Z;  3I07 A;  1VQ7 1;  3BG0 B;  4MON A;  2PK7 A;  1YJN 1;  3GTJ I;  5IP7 I;  3J81 f;  3NH5 A;  3GTO I;  1VQ5 Z;  5A2Q f;  2E2J I;  2M48 A;  3VMG A;  1VQ6 1;  3S15 I;  1YHQ Z;  3CCS Z;  3S1N I;  3CCJ Z;  4AYB A;  1TWF I;  4MD9 A;  1YIJ Z;  3VMH A;  4BY1 I;  1VQ9 1;  4HGY A;  3VTN A;  1Q81 1;  3CCE 1;  1Z03 A;  5T64 A;  3GTM S;  3S1R I;  4CL1 A;  1VQM 1;  1K9M 1;  2JA6 I;  1M90 1;  3HOW I;  4A3M I;  3IF8 A;  5C4X I;  3HOU I;  1YUA A;  2JUB A;  4NBG A;  1QYP A;  2RIQ A;  3GTM I;  3NDI A;  4E33 A;  1YI2 1;  1KC8 1;  5FLX b;  5FLX f;  1Z01 A;  1Q7Y 1;  2QA4 1;  2VUG A;  3CCQ Z;  1NUI A;  2NVY I;  3S17 I;  2JA7 I;  2YU9 I;  4HH4 A;  1LQL A;  2OTL 1;  2IZ3 A;  1I3Q I;  3G6E Z;  3EER A;  1YJN Z;  1YIT 1;  3FQM A;  3CCE Z;  2RT9 A;  3CC4 1;  3CCL Z;  1VQ6 Z;  1KD1 1;  4A3D I;  1Q86 1;  3PO2 I;  3S1M I;  2JMO A;  1RQF A;  2NVQ I;  3J80 f;  2QEX Z;  3CCU 1;  3H3V J;  2W03 A;  1M1K 2;  3CC2 1;  3S1Q I;  3JAM f;  3CC7 1;  4A3K I;  1QVF Y;  2V8I A;  1TWG I;  2WB1 A;  4NBA A;  1YJ9 Z;  3J7A 4;  2I3C A;  1VQ4 Z;  2OTL Z;  4MH4 A;  3I56 Z;  3CME 1;  3EED A;  3IFU A;  1PFT A;  2VF1 A;  1W2B Z;  4A3J I;  1YUK A;  4NB9 A;  5D1P A;  4RVF A;  2GU2 A;  1VQ8 Z;  3LUS A;  1K83 I;  1VQ4 1;  3M3Y I;  1USP B;  4E30 A;  1VQK 1;  2KPI A;  1KQS Z;  4BXX I;  2QLV B;  3VB9 A;  2DE7 A;  2R7Z I;  2OTJ 1;  4E2W A;  3G71 1;  3GTK I;  1YHQ 1;  4MRI A;  3CCM Z;  3CD6 1;  1RLY A;  3CCV 1;  2GTI A;  2G2K A;  2QEX 1;  1QVG Z;  4S1T A;  2Q4Z A;  5C44 I;  2E2H I;  1VQL 1;  4RVG A;  3CCQ 1;  4BBS I;  1VQ9 Z;  2OOY B;  1Z02 A;  1ZH1 A;  2QA4 Z;  2R6M A;  3S2H I;  1W2B Y;  2KI7 B;  3CCU Z;  1YJW 1;  2QRD B;  1USP A;  3CCR 1;  3GKQ A;  3MZK B;  4A3G I;  3TDH B;  4NOZ A;  4E2X A;  4NBB A;  3NDJ A;  4A3I I;  3S16 I;  3I4N I;  4NBF A;  3CXC Z;  1N8R 1;  3HOX I;  1SFO I;  3KIH A;  1K8A 2;  5CM2 M;  1Q82 2;  2P3Y A;  1K73 2;  4E31 A;  1Y1W I;  1KC8 2;  1RNI A;  3NH8 A;  3KIF A;  1VQO 1;  1N2F A;  2E2I I;  3GTQ I;  1VQ7 Z;  4A3B I;  1TWA I;  2GTH A;  3Q87 A;  3U50 C;  3ESW A;  4Y7N I;  2Y0S A;  1NJI 1;  2W04 A;  5D1O A;  5LL6 f;  3M4O I;  1VQK Z;  2OZK A;  3PO3 I;  3G4S Z;  3HKZ A;  1I50 I;  5T6B A;  5IT9 b;  1VQP Z;  4BY7 I;  4MXU A;  3I55 1;  3CQZ I;  4BBR I;  2M6N A;  4A3E I;  3NH4 A;  3GTP I;  3TE5 B;  2PM9 A;  2JR6 A;  2LFU A;  2RPR A;  3OW2 Y;  4X6A I;  2HU9 A;  1VQP 1;  1JJ2 Z;  2YAD A;  2B63 I;  4QTT A;  2IZ4 A;  3BG1 B;  3CCM 1;  4MD7 A;  3CPW Y;  4DQY B;  5AN9 F;  3VMI A;  2OTJ Z;  1WCM I;  2R92 I;  1VQL Z;  1VQ5 1;  2EGT A;  4E32 A;  3I55 Z;  2RHB A;  2R93 I;  4TNU A;  2E9H A;  3CC7 Z;  3T4N B;  3I4M I;  4NBH A;  3S14 I;  1TWC I;  3HOV I;  1KRL A;  2JS4 A;  5D1O B;  3G4S 1;  4A3F I;  4DK1 A;  1YIJ 1;  1Q7Y 2;  2O53 A;  1L1O C;  4NB8 A;  1VQO Z;  1QF8 A;  2JA8 I;  2K5R A;  1ZB8 A;  3MON A;  3PO3 S;  1DL6 A;  4RVH A;  2V8J A;  2QKD A;  1I6H I;  1Y1V I;  3IX0 A;  1WW9 A;  1ML8 A;  1KD1 2;  3J80 b;  2NVX I;  1JJ2 Y;  2NVT I;  2ZAE B;  2DE6 A;  1RO4 A;  3HOY I;  2OOX B;  1YJW Z;  4E2Y A;  4EWC A;  3FQQ A;  1YI2 Z;  5FLM I;  1K73 1;  2JNY A;  1VQN 1;  2WAQ A;  1WII A;  3P5J B;  3H0G I;  3D9X A;  1Q86 2;  2V8K A;  4NH1 C;  5IT9 f;  1M90 2;  4RV9 A;  2QRE B;  3CPW Z;  4RVD A;  1VQ8 1;  1N8R 2;  1K9M 2;  1P9N A;  3CCJ 1;  5T67 A;  3CD6 Z;  2Q51 A;  3NFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...