4AAYB

Crystal structure of the arsenite oxidase protein complex from rhizobium species strain nt-26
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
132
structure length
132
Chain Sequence
AAGVEYPANRLANISELTLNEPLDVAYPDEDAAGVLLKLGTRVEGGVGPDGDIVGFSTICPHKGFPLSYSADNKTFNCPGHFSVFDPEKGGQQVWGQATQNLPQYVLRVADNGDIFAEGVDELIYGRLSNVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Respiratory Arsenite Oxidase: Structure and the Role of Residues Surrounding the Rieske Cluster.
pubmed doi rcsb
source organism Arsenite-oxidising bacterium nt-26
molecule tags Oxidoreductase
molecule keywords AROA
total genus 26
structure length 132
sequence length 132
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4aayB00
4HM1A 1NTZE 2XSOA 2XRXA 2CKFA 1EG9A 2ZYLA 1VM9A 2E74D 4H44D 4H0LD 2JO6A 3GZYA 4AAYB 2E4QA 1SQPE 1UUWA 2YFLA 4HM7A 4QDDA 1L0LE 1UUVA 4P1BH 2BMOA 1SQXE 2HMOA 3GKEA 1PPJE 1SQQE 4QDCA 4NBHD 2DE5D 2B1XA 4EMJB 1NTKE 2QJKC 1NTME 1O7MA 2E75D 3VMID 2DE6D 4QCKA 3GB4A 5KKZC 2NUKA 3C0DA 3L71E 2HMNA 2E76D 4NBAD 2Q3WA 1ULIA 3GTEA 1G8JB 2YFIA 2YVJB 1Q90C 1SQBE 1G8KB 4QDFB 2B24A 4HM0A 1RFSA 2ZT9D 4NBCD 3H1HE 3BCCE 5KLIC 4NBFD 3L75E 4HJLA 5KLVE 2NVFA 4HM4A 2QPZA 1BCCE 2NVEA 2BMRA 2FYNC 1RIEA 1O7WA 1SJGA 3EQQA 4PV1D 2HMKA 1NU1E 1P84E 2BCCE 3EN1A 3L74E 4AIVA 5AEWA 3L72E 2I7FA 2QJYC 3N0QA 1ULJA 3VMHD 4HKVA 3GL0A 1VCKA 1WQLA 1O7GA 4QUQA 2JZAA 4OGQD 1NYKA 3VCAA 2NWFA 3CXHE 3VCPA 3H1JE 5CXMA 2YFJA 2QJPC 4NB9D 4HM8A 1PP9E 2FYUE 2XSHA 3H1KE 3CX5E 5HL4A 4HM5A 2D2CD 4QDFA 3DQYA 1L0NE 3GOBA 3H1LE 2GBWA 3H1IE 1BE3E 2YIUC 4QURA 2BMQA 2DE7D 2HMMA 4NBGD 2IBZE 3CWBE 3GL2A 4H13D 4U3FE 4PD4E 2HMLA 1O7PA 2E4PA 4NB8D 5AEUA 4NBDD 1O7NA 1KYOE 3GTSA 1NDOA 2NUMA 3TGUE 1FQTA 3D89A 3L73E 1ZRTE 4HM6A 4HM2A 3GZXA 2GBXA 2NVGA 2XR8A 3L70E 3GCEA 1EZVE 2HMJA 4P1CH 3AZCA 4NBED 1JM1A 4QUPA 1O7HA 4HM3A 4NBBD 1KB9E 2A06E 1SQVE 3FOUA 3VMGD 5BOKA 1VF5D
chains in the Genus database with same CATH superfamily
4HM1A 1NTZE 2XSOA 2XRXA 2CKFA 1EG9A 2ZYLA 1VM9A 2E74D 4H44D 4H0LD 2JO6A 3GZYA 4AAYB 2E4QA 1SQPE 1UUWA 2YFLA 4HM7A 4QDDA 1L0LE 1UUVA 4P1BH 2BMOA 1SQXE 2HMOA 3GKEA 1PPJE 1SQQE 4QDCA 4NBHD 2DE5D 2B1XA 4EMJB 1NTKE 2QJKC 1NTME 1O7MA 2E75D 3VMID 2DE6D 4QCKA 3GB4A 5KKZC 2NUKA 3C0DA 3L71E 2HMNA 2E76D 4NBAD 2Q3WA 1ULIA 3GTEA 1G8JB 2YFIA 2YVJB 1Q90C 1SQBE 1G8KB 4QDFB 2B24A 4HM0A 1RFSA 2ZT9D 4NBCD 3H1HE 3BCCE 5KLIC 4NBFD 3L75E 4HJLA 5KLVE 2NVFA 4HM4A 2QPZA 1BCCE 2NVEA 2BMRA 2FYNC 1RIEA 1O7WA 1SJGA 3EQQA 4PV1D 2HMKA 1NU1E 1P84E 2BCCE 3EN1A 3L74E 4AIVA 5AEWA 3L72E 2I7FA 2QJYC 3N0QA 1ULJA 3VMHD 4HKVA 3GL0A 1VCKA 1WQLA 1O7GA 4QUQA 2JZAA 4OGQD 1NYKA 3VCAA 2NWFA 3CXHE 3VCPA 3H1JE 5CXMA 2YFJA 2QJPC 4NB9D 4HM8A 1PP9E 2FYUE 2XSHA 3H1KE 3CX5E 5HL4A 4HM5A 2D2CD 4QDFA 3DQYA 1L0NE 3GOBA 3H1LE 2GBWA 3H1IE 1BE3E 2YIUC 4QURA 2BMQA 2DE7D 2HMMA 4NBGD 2IBZE 3CWBE 3GL2A 4H13D 4U3FE 4PD4E 2HMLA 1O7PA 2E4PA 4NB8D 5AEUA 4NBDD 1O7NA 1KYOE 3GTSA 1NDOA 2NUMA 3TGUE 1FQTA 3D89A 3L73E 1ZRTE 4HM6A 4HM2A 3GZXA 2GBXA 2NVGA 2XR8A 3L70E 3GCEA 1EZVE 2HMJA 4P1CH 3AZCA 4NBED 1JM1A 4QUPA 1O7HA 4HM3A 4NBBD 1KB9E 2A06E 1SQVE 3FOUA 3VMGD 5BOKA 1VF5D
chains in the Genus database with same CATH topology
4HM1A 1NTZE 2XSOA 2XRXA 2CKFA 1EG9A 2ZYLA 1VM9A 2E74D 4H44D 4H0LD 2JO6A 3GZYA 4AAYB 2E4QA 1SQPE 1UUWA 2YFLA 4HM7A 4QDDA 1L0LE 1UUVA 4P1BH 2BMOA 1SQXE 2HMOA 3GKEA 1PPJE 1SQQE 4QDCA 4NBHD 2DE5D 2B1XA 4EMJB 1NTKE 2QJKC 1NTME 1O7MA 2E75D 3VMID 2DE6D 4QCKA 3GB4A 5KKZC 2NUKA 3C0DA 3L71E 2HMNA 2E76D 4NBAD 2Q3WA 1ULIA 3GTEA 1G8JB 2YFIA 2YVJB 1Q90C 1SQBE 1G8KB 4QDFB 2B24A 4HM0A 1RFSA 2ZT9D 4NBCD 3H1HE 3BCCE 5KLIC 4NBFD 3L75E 4HJLA 5KLVE 2NVFA 4HM4A 2QPZA 1BCCE 2NVEA 2BMRA 2FYNC 1RIEA 1O7WA 1SJGA 3EQQA 4PV1D 2HMKA 1NU1E 1P84E 2BCCE 3EN1A 3L74E 4AIVA 5AEWA 3L72E 2I7FA 2QJYC 3N0QA 1ULJA 3VMHD 4HKVA 3GL0A 1VCKA 1WQLA 1O7GA 4QUQA 2JZAA 4OGQD 1NYKA 3VCAA 2NWFA 3CXHE 3VCPA 3H1JE 5CXMA 2YFJA 2QJPC 4NB9D 4HM8A 1PP9E 2FYUE 2XSHA 3H1KE 3CX5E 5HL4A 4HM5A 2D2CD 4QDFA 3DQYA 1L0NE 3GOBA 3H1LE 2GBWA 3H1IE 1BE3E 2YIUC 4QURA 2BMQA 2DE7D 2HMMA 4NBGD 2IBZE 3CWBE 3GL2A 4H13D 4U3FE 4PD4E 2HMLA 1O7PA 2E4PA 4NB8D 5AEUA 4NBDD 1O7NA 1KYOE 3GTSA 1NDOA 2NUMA 3TGUE 1FQTA 3D89A 3L73E 1ZRTE 4HM6A 4HM2A 3GZXA 2GBXA 2NVGA 2XR8A 3L70E 3GCEA 1EZVE 2HMJA 4P1CH 3AZCA 4NBED 1JM1A 4QUPA 1O7HA 4HM3A 4NBBD 1KB9E 2A06E 1SQVE 3FOUA 3VMGD 5BOKA 1VF5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM1 A;  1NTZ E;  2XSO A;  2XRX A;  2CKF A;  1EG9 A;  2ZYL A;  1VM9 A;  2E74 D;  4H44 D;  4H0L D;  2JO6 A;  3GZY A;  4AAY B;  2E4Q A;  1SQP E;  1UUW A;  2YFL A;  4HM7 A;  4QDD A;  1L0L E;  1UUV A;  4P1B H;  2BMO A;  1SQX E;  2HMO A;  3GKE A;  1PPJ E;  1SQQ E;  4QDC A;  4NBH D;  2DE5 D;  2B1X A;  4EMJ B;  1NTK E;  2QJK C;  1NTM E;  1O7M A;  2E75 D;  3VMI D;  2DE6 D;  4QCK A;  3GB4 A;  5KKZ C;  2NUK A;  3C0D A;  3L71 E;  2HMN A;  2E76 D;  4NBA D;  2Q3W A;  1ULI A;  3GTE A;  1G8J B;  2YFI A;  2YVJ B;  1Q90 C;  1SQB E;  1G8K B;  4QDF B;  2B24 A;  4HM0 A;  1RFS A;  2ZT9 D;  4NBC D;  3H1H E;  3BCC E;  5KLI C;  4NBF D;  3L75 E;  4HJL A;  5KLV E;  2NVF A;  4HM4 A;  2QPZ A;  1BCC E;  2NVE A;  2BMR A;  2FYN C;  1RIE A;  1O7W A;  1SJG A;  3EQQ A;  4PV1 D;  2HMK A;  1NU1 E;  1P84 E;  2BCC E;  3EN1 A;  3L74 E;  4AIV A;  5AEW A;  3L72 E;  2I7F A;  2QJY C;  3N0Q A;  1ULJ A;  3VMH D;  4HKV A;  3GL0 A;  1VCK A;  1WQL A;  1O7G A;  4QUQ A;  2JZA A;  4OGQ D;  1NYK A;  3VCA A;  2NWF A;  3CXH E;  3VCP A;  3H1J E;  5CXM A;  2YFJ A;  2QJP C;  4NB9 D;  4HM8 A;  1PP9 E;  2FYU E;  2XSH A;  3H1K E;  3CX5 E;  5HL4 A;  4HM5 A;  2D2C D;  4QDF A;  3DQY A;  1L0N E;  3GOB A;  3H1L E;  2GBW A;  3H1I E;  1BE3 E;  2YIU C;  4QUR A;  2BMQ A;  2DE7 D;  2HMM A;  4NBG D;  2IBZ E;  3CWB E;  3GL2 A;  4H13 D;  4U3F E;  4PD4 E;  2HML A;  1O7P A;  2E4P A;  4NB8 D;  5AEU A;  4NBD D;  1O7N A;  1KYO E;  3GTS A;  1NDO A;  2NUM A;  3TGU E;  1FQT A;  3D89 A;  3L73 E;  1ZRT E;  4HM6 A;  4HM2 A;  3GZX A;  2GBX A;  2NVG A;  2XR8 A;  3L70 E;  3GCE A;  1EZV E;  2HMJ A;  4P1C H;  3AZC A;  4NBE D;  1JM1 A;  4QUP A;  1O7H A;  4HM3 A;  4NBB D;  1KB9 E;  2A06 E;  1SQV E;  3FOU A;  3VMG D;  5BOK A;  1VF5 D; 
#chains in the Genus database with same CATH topology
 4HM1 A;  1NTZ E;  2XSO A;  2XRX A;  2CKF A;  1EG9 A;  2ZYL A;  1VM9 A;  2E74 D;  4H44 D;  4H0L D;  2JO6 A;  3GZY A;  4AAY B;  2E4Q A;  1SQP E;  1UUW A;  2YFL A;  4HM7 A;  4QDD A;  1L0L E;  1UUV A;  4P1B H;  2BMO A;  1SQX E;  2HMO A;  3GKE A;  1PPJ E;  1SQQ E;  4QDC A;  4NBH D;  2DE5 D;  2B1X A;  4EMJ B;  1NTK E;  2QJK C;  1NTM E;  1O7M A;  2E75 D;  3VMI D;  2DE6 D;  4QCK A;  3GB4 A;  5KKZ C;  2NUK A;  3C0D A;  3L71 E;  2HMN A;  2E76 D;  4NBA D;  2Q3W A;  1ULI A;  3GTE A;  1G8J B;  2YFI A;  2YVJ B;  1Q90 C;  1SQB E;  1G8K B;  4QDF B;  2B24 A;  4HM0 A;  1RFS A;  2ZT9 D;  4NBC D;  3H1H E;  3BCC E;  5KLI C;  4NBF D;  3L75 E;  4HJL A;  5KLV E;  2NVF A;  4HM4 A;  2QPZ A;  1BCC E;  2NVE A;  2BMR A;  2FYN C;  1RIE A;  1O7W A;  1SJG A;  3EQQ A;  4PV1 D;  2HMK A;  1NU1 E;  1P84 E;  2BCC E;  3EN1 A;  3L74 E;  4AIV A;  5AEW A;  3L72 E;  2I7F A;  2QJY C;  3N0Q A;  1ULJ A;  3VMH D;  4HKV A;  3GL0 A;  1VCK A;  1WQL A;  1O7G A;  4QUQ A;  2JZA A;  4OGQ D;  1NYK A;  3VCA A;  2NWF A;  3CXH E;  3VCP A;  3H1J E;  5CXM A;  2YFJ A;  2QJP C;  4NB9 D;  4HM8 A;  1PP9 E;  2FYU E;  2XSH A;  3H1K E;  3CX5 E;  5HL4 A;  4HM5 A;  2D2C D;  4QDF A;  3DQY A;  1L0N E;  3GOB A;  3H1L E;  2GBW A;  3H1I E;  1BE3 E;  2YIU C;  4QUR A;  2BMQ A;  2DE7 D;  2HMM A;  4NBG D;  2IBZ E;  3CWB E;  3GL2 A;  4H13 D;  4U3F E;  4PD4 E;  2HML A;  1O7P A;  2E4P A;  4NB8 D;  5AEU A;  4NBD D;  1O7N A;  1KYO E;  3GTS A;  1NDO A;  2NUM A;  3TGU E;  1FQT A;  3D89 A;  3L73 E;  1ZRT E;  4HM6 A;  4HM2 A;  3GZX A;  2GBX A;  2NVG A;  2XR8 A;  3L70 E;  3GCE A;  1EZV E;  2HMJ A;  4P1C H;  3AZC A;  4NBE D;  1JM1 A;  4QUP A;  1O7H A;  4HM3 A;  4NBB D;  1KB9 E;  2A06 E;  1SQV E;  3FOU A;  3VMG D;  5BOK A;  1VF5 D; 
#chains in the Genus database with same CATH homology
 4HM1 A;  1NTZ E;  2XSO A;  2XRX A;  2CKF A;  1EG9 A;  2ZYL A;  1VM9 A;  2E74 D;  4H44 D;  4H0L D;  2JO6 A;  3GZY A;  4AAY B;  2E4Q A;  1SQP E;  1UUW A;  2YFL A;  4HM7 A;  4QDD A;  1L0L E;  1UUV A;  4P1B H;  2BMO A;  1SQX E;  2HMO A;  3GKE A;  1PPJ E;  1SQQ E;  4QDC A;  4NBH D;  2DE5 D;  2B1X A;  4EMJ B;  1NTK E;  2QJK C;  1NTM E;  1O7M A;  2E75 D;  3VMI D;  2DE6 D;  4QCK A;  3GB4 A;  5KKZ C;  2NUK A;  3C0D A;  3L71 E;  2HMN A;  2E76 D;  4NBA D;  2Q3W A;  1ULI A;  3GTE A;  1G8J B;  2YFI A;  2YVJ B;  1Q90 C;  1SQB E;  1G8K B;  4QDF B;  2B24 A;  4HM0 A;  1RFS A;  2ZT9 D;  4NBC D;  3H1H E;  3BCC E;  5KLI C;  4NBF D;  3L75 E;  4HJL A;  5KLV E;  2NVF A;  4HM4 A;  2QPZ A;  1BCC E;  2NVE A;  2BMR A;  2FYN C;  1RIE A;  1O7W A;  1SJG A;  3EQQ A;  4PV1 D;  2HMK A;  1NU1 E;  1P84 E;  2BCC E;  3EN1 A;  3L74 E;  4AIV A;  5AEW A;  3L72 E;  2I7F A;  2QJY C;  3N0Q A;  1ULJ A;  3VMH D;  4HKV A;  3GL0 A;  1VCK A;  1WQL A;  1O7G A;  4QUQ A;  2JZA A;  4OGQ D;  1NYK A;  3VCA A;  2NWF A;  3CXH E;  3VCP A;  3H1J E;  5CXM A;  2YFJ A;  2QJP C;  4NB9 D;  4HM8 A;  1PP9 E;  2FYU E;  2XSH A;  3H1K E;  3CX5 E;  5HL4 A;  4HM5 A;  2D2C D;  4QDF A;  3DQY A;  1L0N E;  3GOB A;  3H1L E;  2GBW A;  3H1I E;  1BE3 E;  2YIU C;  4QUR A;  2BMQ A;  2DE7 D;  2HMM A;  4NBG D;  2IBZ E;  3CWB E;  3GL2 A;  4H13 D;  4U3F E;  4PD4 E;  2HML A;  1O7P A;  2E4P A;  4NB8 D;  5AEU A;  4NBD D;  1O7N A;  1KYO E;  3GTS A;  1NDO A;  2NUM A;  3TGU E;  1FQT A;  3D89 A;  3L73 E;  1ZRT E;  4HM6 A;  4HM2 A;  3GZX A;  2GBX A;  2NVG A;  2XR8 A;  3L70 E;  3GCE A;  1EZV E;  2HMJ A;  4P1C H;  3AZC A;  4NBE D;  1JM1 A;  4QUP A;  1O7H A;  4HM3 A;  4NBB D;  1KB9 E;  2A06 E;  1SQV E;  3FOU A;  3VMG D;  5BOK A;  1VF5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...