4AEAA

Dimeric alpha-cobratoxin x-ray structure: localization of intermolecular disulfides and possible mode of binding to nicotinic acetylcholine receptors
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
67
structure length
67
Chain Sequence
IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimeric Alpha-Cobratoxin X-Ray Structure: Localization of Intermolecular Disulfides and Possible Mode of Binding to Nicotinic Acetylcholine Receptors.
pubmed doi rcsb
molecule tags Toxin
molecule keywords LONG NEUROTOXIN 1
total genus 5
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4aeaA00
2VLWA 1CHVS 2QJBC 1B41B 2H5FA 2H7ZB 1F8UB 2H7ZA 1H0JA 1LSIA 1CDRA 1HC9B 3HH7A 2L5SA 2MHYA 5IMYC 1ZADA 1BTEA 1REWC 1I02A 1QM7A 1CDSA 1RL5A 4LFTA 5DZ5A 2FD6U 4QTIU 2BTXA 5IMTD 1PLOA 3EVSC 1FSSB 1NTXA 1NYUA 1CXNA 1IJCA 1TGXA 1FASA 2H64C 3NDSA 2MJYA 1W6BA 4BDTB 1RGJA 2GOOB 1XT3A 2LA1A 1QKEA 2JVEA 2ABXA 2H64B 2X8BB 1KBTA 4FAOC 2UWRA 1KC4A 1CCQA 4XJJA 2HLQA 1L4WA 1CDTA 2CTXA 4OM5A 2ERAA 4FAOE 1CDQA 1HOYA 1QKDA 1YWHA 2H62C 4UY2C 1KXIA 2JQPA 3ERAA 1JBDA 1UG4A 1V6PA 2CDXA 1S4YA 1BXPA 1JGKA 4OM4A 1NTNA 2NBTA 2BHIA 3FEVA 1MAHF 2QJAC 2QJ9C 2K3GA 3NH7A 1IDIA 2MJ4A 1ERAA 1TXBA 1IDGA 1HAJA 1FSCA 3NEQA 2J8BA 1TXAA 2MFAA 4RUDA 1G6MA 3BT2U 2CCXA 5EBXA 2CRSA 3EBXA 4ZQYA 1LXGA 2UX2A 4BIKB 1KS6A 4DO8A 1ABTA 1IK8A 4HQPF 1KL8A 3BT1U 2N99A 2MUOA 1IDHA 3KFDI 1FFJA 1MR6A 3U74U 1JE9A 1CREA 4AEAA 1F94A 2PJYB 2QC1A 3KFDE 3QB4B 4P7UA 1NORA 2CRTA 3PLCA 2HLRA 1KFHA 1VB0A 1LJZA 2PJYC 2MJ0A 2OFSA 1LXHA 1IDLA 1LX5B 1CRFA 4EY8B 1KBSA 1CVOA 1IQ9A 2MUPA 1HC9A 2H62D 1NXBA 2I9BE 1DRSA 1ES7B 1KTZB 1TFSA 1KU6B 1CXOA 1HAAA 2L03A 3VTSA 2H8UA 1IKCA 1KBAA 1NEAA 3LAQU 2LCRA 4IYEA 1FRAA 5DO6A 3U73U 1ONJA 5DU1A 1FF4A 1NYSA 2GOOC 1ERGA 1M9ZA 1CB9A 1CODA 6EBXA 1CTXA 1COEA
chains in the Genus database with same CATH superfamily
2VLWA 1CHVS 2QJBC 1B41B 2H5FA 2H7ZB 1F8UB 2H7ZA 1H0JA 1LSIA 1CDRA 1HC9B 3HH7A 2L5SA 2MHYA 5IMYC 1ZADA 1BTEA 1REWC 1I02A 1QM7A 1CDSA 1RL5A 4LFTA 5DZ5A 2FD6U 4QTIU 2BTXA 5IMTD 1PLOA 3EVSC 1FSSB 1NTXA 1NYUA 1CXNA 1IJCA 1TGXA 1FASA 2H64C 3NDSA 2MJYA 1W6BA 4BDTB 1RGJA 2GOOB 1XT3A 2LA1A 1QKEA 2JVEA 2ABXA 2H64B 2X8BB 1KBTA 4FAOC 2UWRA 1KC4A 1CCQA 4XJJA 2HLQA 1L4WA 1CDTA 2CTXA 4OM5A 2ERAA 4FAOE 1CDQA 1HOYA 1QKDA 1YWHA 2H62C 4UY2C 1KXIA 2JQPA 3ERAA 1JBDA 1UG4A 1V6PA 2CDXA 1S4YA 1BXPA 1JGKA 4OM4A 1NTNA 2NBTA 2BHIA 3FEVA 1MAHF 2QJAC 2QJ9C 2K3GA 3NH7A 1IDIA 2MJ4A 1ERAA 1TXBA 1IDGA 1HAJA 1FSCA 3NEQA 2J8BA 1TXAA 2MFAA 4RUDA 1G6MA 3BT2U 2CCXA 5EBXA 2CRSA 3EBXA 4ZQYA 1LXGA 2UX2A 4BIKB 1KS6A 4DO8A 1ABTA 1IK8A 4HQPF 1KL8A 3BT1U 2N99A 2MUOA 1IDHA 3KFDI 1FFJA 1MR6A 3U74U 1JE9A 1CREA 4AEAA 1F94A 2PJYB 2QC1A 3KFDE 3QB4B 4P7UA 1NORA 2CRTA 3PLCA 2HLRA 1KFHA 1VB0A 1LJZA 2PJYC 2MJ0A 2OFSA 1LXHA 1IDLA 1LX5B 1CRFA 4EY8B 1KBSA 1CVOA 1IQ9A 2MUPA 1HC9A 2H62D 1NXBA 2I9BE 1DRSA 1ES7B 1KTZB 1TFSA 1KU6B 1CXOA 1HAAA 2L03A 3VTSA 2H8UA 1IKCA 1KBAA 1NEAA 3LAQU 4KSNA 2LCRA 4IYEA 1FRAA 5DO6A 3U73U 1ONJA 5DU1A 1FF4A 1NYSA 2GOOC 1ERGA 1M9ZA 1CB9A 1CODA 6EBXA 1CTXA 1COEA
chains in the Genus database with same CATH topology
2VLWA 1CHVS 2QJBC 1B41B 2H5FA 2H7ZB 1F8UB 2H7ZA 1H0JA 1LSIA 1CDRA 1HC9B 3HH7A 2L5SA 2MHYA 5IMYC 1ZADA 1BTEA 1REWC 1I02A 1QM7A 1CDSA 1RL5A 4LFTA 5DZ5A 2FD6U 4QTIU 2BTXA 5IMTD 1PLOA 3EVSC 1FSSB 1NTXA 1NYUA 1CXNA 1IJCA 1TGXA 1FASA 2H64C 3NDSA 2MJYA 1W6BA 4BDTB 1RGJA 2GOOB 1XT3A 2LA1A 1QKEA 2JVEA 2ABXA 2H64B 2X8BB 1KBTA 4FAOC 2UWRA 1KC4A 1CCQA 4XJJA 2HLQA 1L4WA 1CDTA 2CTXA 4OM5A 2ERAA 4FAOE 1CDQA 1HOYA 1QKDA 1YWHA 2H62C 4UY2C 1KXIA 2JQPA 3ERAA 1JBDA 1UG4A 1V6PA 2CDXA 1S4YA 1BXPA 1JGKA 4OM4A 1NTNA 2NBTA 2BHIA 3FEVA 1MAHF 2QJAC 2QJ9C 2K3GA 3NH7A 1IDIA 2MJ4A 1ERAA 1TXBA 1IDGA 1HAJA 1FSCA 3NEQA 2J8BA 1TXAA 2MFAA 4RUDA 1G6MA 3BT2U 2CCXA 5EBXA 2CRSA 3EBXA 4ZQYA 1LXGA 2UX2A 4BIKB 1KS6A 4DO8A 1ABTA 1IK8A 4HQPF 1KL8A 3BT1U 2N99A 2MUOA 1IDHA 3KFDI 1FFJA 1MR6A 3U74U 1JE9A 1CREA 4AEAA 1F94A 2PJYB 2QC1A 3KFDE 3QB4B 4P7UA 1NORA 2CRTA 3PLCA 2HLRA 1KFHA 1VB0A 1LJZA 2PJYC 2MJ0A 2OFSA 1LXHA 1IDLA 1LX5B 1CRFA 4EY8B 1KBSA 1CVOA 1IQ9A 2MUPA 1HC9A 2H62D 1NXBA 2I9BE 1DRSA 1ES7B 1KTZB 1TFSA 1KU6B 1CXOA 1HAAA 2L03A 3VTSA 2H8UA 1IKCA 1KBAA 1NEAA 3LAQU 4KSNA 2LCRA 4IYEA 1FRAA 5DO6A 3U73U 1ONJA 5DU1A 1FF4A 1NYSA 2GOOC 1ERGA 1M9ZA 1CB9A 1CODA 6EBXA 1CTXA 1COEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLW A;  1CHV S;  2QJB C;  1B41 B;  2H5F A;  2H7Z B;  1F8U B;  2H7Z A;  1H0J A;  1LSI A;  1CDR A;  1HC9 B;  3HH7 A;  2L5S A;  2MHY A;  5IMY C;  1ZAD A;  1BTE A;  1REW C;  1I02 A;  1QM7 A;  1CDS A;  1RL5 A;  4LFT A;  5DZ5 A;  2FD6 U;  4QTI U;  2BTX A;  5IMT D;  1PLO A;  3EVS C;  1FSS B;  1NTX A;  1NYU A;  1CXN A;  1IJC A;  1TGX A;  1FAS A;  2H64 C;  3NDS A;  2MJY A;  1W6B A;  4BDT B;  1RGJ A;  2GOO B;  1XT3 A;  2LA1 A;  1QKE A;  2JVE A;  2ABX A;  2H64 B;  2X8B B;  1KBT A;  4FAO C;  2UWR A;  1KC4 A;  1CCQ A;  4XJJ A;  2HLQ A;  1L4W A;  1CDT A;  2CTX A;  4OM5 A;  2ERA A;  4FAO E;  1CDQ A;  1HOY A;  1QKD A;  1YWH A;  2H62 C;  4UY2 C;  1KXI A;  2JQP A;  3ERA A;  1JBD A;  1UG4 A;  1V6P A;  2CDX A;  1S4Y A;  1BXP A;  1JGK A;  4OM4 A;  1NTN A;  2NBT A;  2BHI A;  3FEV A;  1MAH F;  2QJA C;  2QJ9 C;  2K3G A;  3NH7 A;  1IDI A;  2MJ4 A;  1ERA A;  1TXB A;  1IDG A;  1HAJ A;  1FSC A;  3NEQ A;  2J8B A;  1TXA A;  2MFA A;  4RUD A;  1G6M A;  3BT2 U;  2CCX A;  5EBX A;  2CRS A;  3EBX A;  4ZQY A;  1LXG A;  2UX2 A;  4BIK B;  1KS6 A;  4DO8 A;  1ABT A;  1IK8 A;  4HQP F;  1KL8 A;  3BT1 U;  2N99 A;  2MUO A;  1IDH A;  3KFD I;  1FFJ A;  1MR6 A;  3U74 U;  1JE9 A;  1CRE A;  4AEA A;  1F94 A;  2PJY B;  2QC1 A;  3KFD E;  3QB4 B;  4P7U A;  1NOR A;  2CRT A;  3PLC A;  2HLR A;  1KFH A;  1VB0 A;  1LJZ A;  2PJY C;  2MJ0 A;  2OFS A;  1LXH A;  1IDL A;  1LX5 B;  1CRF A;  4EY8 B;  1KBS A;  1CVO A;  1IQ9 A;  2MUP A;  1HC9 A;  2H62 D;  1NXB A;  2I9B E;  1DRS A;  1ES7 B;  1KTZ B;  1TFS A;  1KU6 B;  1CXO A;  1HAA A;  2L03 A;  3VTS A;  2H8U A;  1IKC A;  1KBA A;  1NEA A;  3LAQ U;  2LCR A;  4IYE A;  1FRA A;  5DO6 A;  3U73 U;  1ONJ A;  5DU1 A;  1FF4 A;  1NYS A;  2GOO C;  1ERG A;  1M9Z A;  1CB9 A;  1COD A;  6EBX A;  1CTX A;  1COE A; 
#chains in the Genus database with same CATH topology
 2VLW A;  1CHV S;  2QJB C;  1B41 B;  2H5F A;  2H7Z B;  1F8U B;  2H7Z A;  1H0J A;  1LSI A;  1CDR A;  1HC9 B;  3HH7 A;  2L5S A;  2MHY A;  5IMY C;  1ZAD A;  1BTE A;  1REW C;  1I02 A;  1QM7 A;  1CDS A;  1RL5 A;  4LFT A;  5DZ5 A;  2FD6 U;  4QTI U;  2BTX A;  5IMT D;  1PLO A;  3EVS C;  1FSS B;  1NTX A;  1NYU A;  1CXN A;  1IJC A;  1TGX A;  1FAS A;  2H64 C;  3NDS A;  2MJY A;  1W6B A;  4BDT B;  1RGJ A;  2GOO B;  1XT3 A;  2LA1 A;  1QKE A;  2JVE A;  2ABX A;  2H64 B;  2X8B B;  1KBT A;  4FAO C;  2UWR A;  1KC4 A;  1CCQ A;  4XJJ A;  2HLQ A;  1L4W A;  1CDT A;  2CTX A;  4OM5 A;  2ERA A;  4FAO E;  1CDQ A;  1HOY A;  1QKD A;  1YWH A;  2H62 C;  4UY2 C;  1KXI A;  2JQP A;  3ERA A;  1JBD A;  1UG4 A;  1V6P A;  2CDX A;  1S4Y A;  1BXP A;  1JGK A;  4OM4 A;  1NTN A;  2NBT A;  2BHI A;  3FEV A;  1MAH F;  2QJA C;  2QJ9 C;  2K3G A;  3NH7 A;  1IDI A;  2MJ4 A;  1ERA A;  1TXB A;  1IDG A;  1HAJ A;  1FSC A;  3NEQ A;  2J8B A;  1TXA A;  2MFA A;  4RUD A;  1G6M A;  3BT2 U;  2CCX A;  5EBX A;  2CRS A;  3EBX A;  4ZQY A;  1LXG A;  2UX2 A;  4BIK B;  1KS6 A;  4DO8 A;  1ABT A;  1IK8 A;  4HQP F;  1KL8 A;  3BT1 U;  2N99 A;  2MUO A;  1IDH A;  3KFD I;  1FFJ A;  1MR6 A;  3U74 U;  1JE9 A;  1CRE A;  4AEA A;  1F94 A;  2PJY B;  2QC1 A;  3KFD E;  3QB4 B;  4P7U A;  1NOR A;  2CRT A;  3PLC A;  2HLR A;  1KFH A;  1VB0 A;  1LJZ A;  2PJY C;  2MJ0 A;  2OFS A;  1LXH A;  1IDL A;  1LX5 B;  1CRF A;  4EY8 B;  1KBS A;  1CVO A;  1IQ9 A;  2MUP A;  1HC9 A;  2H62 D;  1NXB A;  2I9B E;  1DRS A;  1ES7 B;  1KTZ B;  1TFS A;  1KU6 B;  1CXO A;  1HAA A;  2L03 A;  3VTS A;  2H8U A;  1IKC A;  1KBA A;  1NEA A;  3LAQ U;  4KSN A;  2LCR A;  4IYE A;  1FRA A;  5DO6 A;  3U73 U;  1ONJ A;  5DU1 A;  1FF4 A;  1NYS A;  2GOO C;  1ERG A;  1M9Z A;  1CB9 A;  1COD A;  6EBX A;  1CTX A;  1COE A; 
#chains in the Genus database with same CATH homology
 2VLW A;  1CHV S;  2QJB C;  1B41 B;  2H5F A;  2H7Z B;  1F8U B;  2H7Z A;  1H0J A;  1LSI A;  1CDR A;  1HC9 B;  3HH7 A;  2L5S A;  2MHY A;  5IMY C;  1ZAD A;  1BTE A;  1REW C;  1I02 A;  1QM7 A;  1CDS A;  1RL5 A;  4LFT A;  5DZ5 A;  2FD6 U;  4QTI U;  2BTX A;  5IMT D;  1PLO A;  3EVS C;  1FSS B;  1NTX A;  1NYU A;  1CXN A;  1IJC A;  1TGX A;  1FAS A;  2H64 C;  3NDS A;  2MJY A;  1W6B A;  4BDT B;  1RGJ A;  2GOO B;  1XT3 A;  2LA1 A;  1QKE A;  2JVE A;  2ABX A;  2H64 B;  2X8B B;  1KBT A;  4FAO C;  2UWR A;  1KC4 A;  1CCQ A;  4XJJ A;  2HLQ A;  1L4W A;  1CDT A;  2CTX A;  4OM5 A;  2ERA A;  4FAO E;  1CDQ A;  1HOY A;  1QKD A;  1YWH A;  2H62 C;  4UY2 C;  1KXI A;  2JQP A;  3ERA A;  1JBD A;  1UG4 A;  1V6P A;  2CDX A;  1S4Y A;  1BXP A;  1JGK A;  4OM4 A;  1NTN A;  2NBT A;  2BHI A;  3FEV A;  1MAH F;  2QJA C;  2QJ9 C;  2K3G A;  3NH7 A;  1IDI A;  2MJ4 A;  1ERA A;  1TXB A;  1IDG A;  1HAJ A;  1FSC A;  3NEQ A;  2J8B A;  1TXA A;  2MFA A;  4RUD A;  1G6M A;  3BT2 U;  2CCX A;  5EBX A;  2CRS A;  3EBX A;  4ZQY A;  1LXG A;  2UX2 A;  4BIK B;  1KS6 A;  4DO8 A;  1ABT A;  1IK8 A;  4HQP F;  1KL8 A;  3BT1 U;  2N99 A;  2MUO A;  1IDH A;  3KFD I;  1FFJ A;  1MR6 A;  3U74 U;  1JE9 A;  1CRE A;  4AEA A;  1F94 A;  2PJY B;  2QC1 A;  3KFD E;  3QB4 B;  4P7U A;  1NOR A;  2CRT A;  3PLC A;  2HLR A;  1KFH A;  1VB0 A;  1LJZ A;  2PJY C;  2MJ0 A;  2OFS A;  1LXH A;  1IDL A;  1LX5 B;  1CRF A;  4EY8 B;  1KBS A;  1CVO A;  1IQ9 A;  2MUP A;  1HC9 A;  2H62 D;  1NXB A;  2I9B E;  1DRS A;  1ES7 B;  1KTZ B;  1TFS A;  1KU6 B;  1CXO A;  1HAA A;  2L03 A;  3VTS A;  2H8U A;  1IKC A;  1KBA A;  1NEA A;  3LAQ U;  4KSN A;  2LCR A;  4IYE A;  1FRA A;  5DO6 A;  3U73 U;  1ONJ A;  5DU1 A;  1FF4 A;  1NYS A;  2GOO C;  1ERG A;  1M9Z A;  1CB9 A;  1COD A;  6EBX A;  1CTX A;  1COE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...