4AFGA

Capitella teleta achbp in complex with varenicline
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
212
Chain Sequence
b'NGLMAKRLRRELLNTYEQLGKSGLPFLDDIGKVDVKFGLSLQLLKSIEQRGMGFNSIGTFKAIVKLSWVDTILRWDPEPPFDFQKIEISPDEIWTPDIKLFNSVDLDMTLDRTTQAIVFSNGTVLWIPPAVLKVLCVSQDDVDSCHFQFGSWVYSVDEVDIHFMDDKAEVLLDFYQDSLEILENSAQRQEVVYPCCESAYVEMKYLLALRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAPITELLA TELETA ACHBP
publication title Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
pubmed doi rcsb
source organism Capitella teleta
molecule tags Acetylcholine-binding protein
total genus 48
structure length 212
sequence length 212
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4afgA00
3SH1A 2XNVA 3JAEA 3C84A 4A98A 4XHEA 4QABA 3U8NA 4A97A 5AFLA 2ZJUA 2PGZA 4ZR6A 2BR8A 4HFDA 3T4MA 3IGQA 5HEGA 2BG9C 3WTHA 1UX2A 4ZRUA 4XK9A 3TLVA 3GUAA 2WZYA 4ILBA 4D01A 4ZZBA 3U8LA 2XQ5A 5KE4A 2XQ3A 2VL0A 5HEJA 5AFNA 3EI0A 4HFHA 4QACA 3TLTA 3ZDGA 3ZKRA 4QAAA 3RIAA 5BP0A 2XZ6A 3U8JA 3PEOA 4ZK4A 4ILAA 2BG9B 3UU6A 3TLUA 4QH4A 4QH5A 3RQWA 4ZJTA 3UQ7A 3RI5A 5BW2A 2XQ6A 5AFKA 2BYNA 4HFIA 4QH1A 3U8KA 5CO5A 5LG3A 1UW6A 2BYQA 3JADA 3JAFA 5L4EA 3SQ9A 4HQPA 4NPPA 4AFGA 2XZ5A 4HFEA 4DBMA 4LMLA 2W8GA 4FRRA 2YKSA 4AFHA 4TWDA 5J5GA 2QC1B 3WTJA 4UM3S 2YN6A 3SQ6A 1UV6A 2XYSA 5J5HA 2Y7YA 2PH9A 2XNUA 4TNWA 2Y56A 3PMZA 5KZUA 2WNJA 2XQ8A 2X00A 3RHWA 5BRXA 3WTOA 5AINA 3UU3A 4LMKA 3P50A 5IUXA 4F8HA 5HEOA 2Y58A 4IL4A 5AFMA 2YMEA 2BYPA 3LSVA 2WNLA 5SYOA 5J0ZA 4TWHA 4HFBA 2BYSA 2XYTA 4UY2A 4ALXA 4HFCA 3UU4A 5L4HA 5L47A 5J5FA 4UM3A 4ZJSA 1I9BA 3TLWA 5CFBA 2YOEA 2Y54A 2WNCA 3C79A 2BG9E 4IL9A 3UQ4A 3WTMA 2W8FA 2WN9A 5AFJA 4IREA 2X00D 3TLSA 3UUBA 5HEUA 3WIPA 5AFHA 2BJ0A 2Y57A 2UZ6A 3U8MA 2C9TA 2YMDA 5HCMA 2ZJVA 5HCJA 4ZZCA 4LMJA 4WV9A 3RIFA 2BG9A 3WTIA 4BQTA 4UM3P 3UU8A 2XNTA 5HEHA 2XQ9A 3WTLA 3P4WA 2BR7A 4PIRA 4X5TA 4AFTA 3EHZA 2XQ7A 3WTNA 4UM1A 3WTKA 4Z90A 3RQUA 4TWFA 3ZDHA 5FJVA 4BFQA 4UXUA 3SIOA 4ZK1A 2XQ4A 3UU5A 4ILCA 4B5DA 4COFA 5J5IA 4NZBA 4Z91A 4EZ1A 2BYRA 5AFMB 4TNVA 3EAMA 5JMEA 5LXBA 2XQAA 5TVCA
chains in the Genus database with same CATH superfamily
3SH1A 2XNVA 3JAEA 3C84A 4A98A 4XHEA 4QABA 3U8NA 4A97A 5AFLA 2ZJUA 2PGZA 4ZR6A 2BR8A 4HFDA 3T4MA 3IGQA 5HEGA 2BG9C 3WTHA 1UX2A 4ZRUA 4XK9A 3TLVA 3GUAA 2WZYA 4ILBA 4D01A 4ZZBA 3U8LA 2XQ5A 5KE4A 2XQ3A 2VL0A 5HEJA 5AFNA 3EI0A 4HFHA 4QACA 3TLTA 3ZDGA 3ZKRA 4QAAA 3RIAA 5BP0A 2XZ6A 3U8JA 3PEOA 4ZK4A 4ILAA 2BG9B 3UU6A 3TLUA 4QH4A 4QH5A 3RQWA 4ZJTA 3UQ7A 3RI5A 5BW2A 2XQ6A 5AFKA 2BYNA 4HFIA 4QH1A 3U8KA 5CO5A 5LG3A 1UW6A 2BYQA 3JADA 3JAFA 5L4EA 3SQ9A 4HQPA 4NPPA 4AFGA 2XZ5A 4HFEA 4DBMA 4LMLA 2W8GA 4FRRA 2YKSA 4AFHA 4TWDA 5J5GA 2QC1B 3WTJA 4UM3S 2YN6A 3SQ6A 1UV6A 2XYSA 5J5HA 2Y7YA 2PH9A 2XNUA 4TNWA 2Y56A 3PMZA 5KZUA 2WNJA 2XQ8A 2X00A 3RHWA 5BRXA 3WTOA 5AINA 3UU3A 4LMKA 3P50A 5IUXA 4F8HA 5HEOA 2Y58A 4IL4A 5AFMA 2YMEA 2BYPA 3LSVA 2WNLA 5SYOA 5J0ZA 4TWHA 4HFBA 2BYSA 2XYTA 4UY2A 4ALXA 4HFCA 3UU4A 5L4HA 5L47A 5J5FA 4UM3A 4ZJSA 1I9BA 3TLWA 5CFBA 2YOEA 2Y54A 2WNCA 3C79A 2BG9E 4IL9A 3UQ4A 3WTMA 2W8FA 2WN9A 5AFJA 4IREA 2X00D 3TLSA 3UUBA 5HEUA 3WIPA 5AFHA 2BJ0A 2Y57A 2UZ6A 3U8MA 2C9TA 2YMDA 5HCMA 2ZJVA 5HCJA 4ZZCA 4LMJA 4WV9A 3RIFA 2BG9A 3WTIA 4BQTA 4UM3P 3UU8A 2XNTA 5HEHA 2XQ9A 3WTLA 3P4WA 2BR7A 4PIRA 4X5TA 4AFTA 3EHZA 2XQ7A 3WTNA 4UM1A 3WTKA 4Z90A 3RQUA 4TWFA 3ZDHA 5FJVA 4BFQA 4UXUA 3SIOA 4ZK1A 2XQ4A 3UU5A 4ILCA 4B5DA 4COFA 5J5IA 4NZBA 4Z91A 4EZ1A 2BYRA 5AFMB 4TNVA 3EAMA 5JMEA 5LXBA 2XQAA 5TVCA
chains in the Genus database with same CATH topology
3SH1A 2XNVA 3JAEA 3C84A 4A98A 4XHEA 4QABA 3U8NA 4A97A 5AFLA 2ZJUA 2PGZA 4ZR6A 2BR8A 4HFDA 3T4MA 3IGQA 5HEGA 2BG9C 3WTHA 1UX2A 4ZRUA 4XK9A 3TLVA 3GUAA 2WZYA 4ILBA 4D01A 4ZZBA 3U8LA 2XQ5A 5KE4A 2XQ3A 2VL0A 5HEJA 5AFNA 3EI0A 4HFHA 4QACA 3TLTA 3ZDGA 3ZKRA 4QAAA 3RIAA 5BP0A 2XZ6A 3U8JA 3PEOA 4ZK4A 4ILAA 2BG9B 3UU6A 3TLUA 4QH4A 4QH5A 3RQWA 4ZJTA 3UQ7A 3RI5A 5BW2A 2XQ6A 5AFKA 2BYNA 4HFIA 4QH1A 3U8KA 5CO5A 5LG3A 1UW6A 2BYQA 3JADA 3JAFA 5L4EA 3SQ9A 4HQPA 4NPPA 4AFGA 2XZ5A 4HFEA 4DBMA 4LMLA 2W8GA 4FRRA 2YKSA 4AFHA 4TWDA 5J5GA 2QC1B 3WTJA 4UM3S 2YN6A 3SQ6A 1UV6A 2XYSA 5J5HA 2Y7YA 2PH9A 2XNUA 4TNWA 2Y56A 3PMZA 5KZUA 2WNJA 2XQ8A 2X00A 3RHWA 5BRXA 3WTOA 5AINA 3UU3A 4LMKA 3P50A 5IUXA 4F8HA 5HEOA 2Y58A 4IL4A 5AFMA 2YMEA 2BYPA 3LSVA 2WNLA 5SYOA 5J0ZA 4TWHA 4HFBA 2BYSA 2XYTA 4UY2A 4ALXA 4HFCA 3UU4A 5L4HA 5L47A 5J5FA 4UM3A 4ZJSA 1I9BA 3TLWA 5CFBA 2YOEA 2Y54A 2WNCA 3C79A 2BG9E 4IL9A 3UQ4A 3WTMA 2W8FA 2WN9A 5AFJA 4IREA 2X00D 3TLSA 3UUBA 5HEUA 3WIPA 5AFHA 2BJ0A 2Y57A 2UZ6A 3U8MA 2C9TA 2YMDA 5HCMA 2ZJVA 5HCJA 4ZZCA 4LMJA 4WV9A 3RIFA 2BG9A 3WTIA 4BQTA 4UM3P 3UU8A 2XNTA 5HEHA 2XQ9A 3WTLA 3P4WA 2BR7A 4PIRA 4X5TA 4AFTA 3EHZA 2XQ7A 3WTNA 4UM1A 3WTKA 4Z90A 3RQUA 4TWFA 3ZDHA 5FJVA 4BFQA 4UXUA 3SIOA 4ZK1A 2XQ4A 3UU5A 4ILCA 4B5DA 4COFA 5J5IA 4NZBA 4Z91A 4EZ1A 2BYRA 5AFMB 4TNVA 3EAMA 5JMEA 5LXBA 2XQAA 5TVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SH1 A;  2XNV A;  3JAE A;  3C84 A;  4A98 A;  4XHE A;  4QAB A;  3U8N A;  4A97 A;  5AFL A;  2ZJU A;  2PGZ A;  4ZR6 A;  2BR8 A;  4HFD A;  3T4M A;  3IGQ A;  5HEG A;  2BG9 C;  3WTH A;  1UX2 A;  4ZRU A;  4XK9 A;  3TLV A;  3GUA A;  2WZY A;  4ILB A;  4D01 A;  4ZZB A;  3U8L A;  2XQ5 A;  5KE4 A;  2XQ3 A;  2VL0 A;  5HEJ A;  5AFN A;  3EI0 A;  4HFH A;  4QAC A;  3TLT A;  3ZDG A;  3ZKR A;  4QAA A;  3RIA A;  5BP0 A;  2XZ6 A;  3U8J A;  3PEO A;  4ZK4 A;  4ILA A;  2BG9 B;  3UU6 A;  3TLU A;  4QH4 A;  4QH5 A;  3RQW A;  4ZJT A;  3UQ7 A;  3RI5 A;  5BW2 A;  2XQ6 A;  5AFK A;  2BYN A;  4HFI A;  4QH1 A;  3U8K A;  5CO5 A;  5LG3 A;  1UW6 A;  2BYQ A;  3JAD A;  3JAF A;  5L4E A;  3SQ9 A;  4HQP A;  4NPP A;  4AFG A;  2XZ5 A;  4HFE A;  4DBM A;  4LML A;  2W8G A;  4FRR A;  2YKS A;  4AFH A;  4TWD A;  5J5G A;  2QC1 B;  3WTJ A;  4UM3 S;  2YN6 A;  3SQ6 A;  1UV6 A;  2XYS A;  5J5H A;  2Y7Y A;  2PH9 A;  2XNU A;  4TNW A;  2Y56 A;  3PMZ A;  5KZU A;  2WNJ A;  2XQ8 A;  2X00 A;  3RHW A;  5BRX A;  3WTO A;  5AIN A;  3UU3 A;  4LMK A;  3P50 A;  5IUX A;  4F8H A;  5HEO A;  2Y58 A;  4IL4 A;  5AFM A;  2YME A;  2BYP A;  3LSV A;  2WNL A;  5SYO A;  5J0Z A;  4TWH A;  4HFB A;  2BYS A;  2XYT A;  4UY2 A;  4ALX A;  4HFC A;  3UU4 A;  5L4H A;  5L47 A;  5J5F A;  4UM3 A;  4ZJS A;  1I9B A;  3TLW A;  5CFB A;  2YOE A;  2Y54 A;  2WNC A;  3C79 A;  2BG9 E;  4IL9 A;  3UQ4 A;  3WTM A;  2W8F A;  2WN9 A;  5AFJ A;  4IRE A;  2X00 D;  3TLS A;  3UUB A;  5HEU A;  3WIP A;  5AFH A;  2BJ0 A;  2Y57 A;  2UZ6 A;  3U8M A;  2C9T A;  2YMD A;  5HCM A;  2ZJV A;  5HCJ A;  4ZZC A;  4LMJ A;  4WV9 A;  3RIF A;  2BG9 A;  3WTI A;  4BQT A;  4UM3 P;  3UU8 A;  2XNT A;  5HEH A;  2XQ9 A;  3WTL A;  3P4W A;  2BR7 A;  4PIR A;  4X5T A;  4AFT A;  3EHZ A;  2XQ7 A;  3WTN A;  4UM1 A;  3WTK A;  4Z90 A;  3RQU A;  4TWF A;  3ZDH A;  5FJV A;  4BFQ A;  4UXU A;  3SIO A;  4ZK1 A;  2XQ4 A;  3UU5 A;  4ILC A;  4B5D A;  4COF A;  5J5I A;  4NZB A;  4Z91 A;  4EZ1 A;  2BYR A;  5AFM B;  4TNV A;  3EAM A;  5JME A;  5LXB A;  2XQA A;  5TVC A; 
#chains in the Genus database with same CATH topology
 3SH1 A;  2XNV A;  3JAE A;  3C84 A;  4A98 A;  4XHE A;  4QAB A;  3U8N A;  4A97 A;  5AFL A;  2ZJU A;  2PGZ A;  4ZR6 A;  2BR8 A;  4HFD A;  3T4M A;  3IGQ A;  5HEG A;  2BG9 C;  3WTH A;  1UX2 A;  4ZRU A;  4XK9 A;  3TLV A;  3GUA A;  2WZY A;  4ILB A;  4D01 A;  4ZZB A;  3U8L A;  2XQ5 A;  5KE4 A;  2XQ3 A;  2VL0 A;  5HEJ A;  5AFN A;  3EI0 A;  4HFH A;  4QAC A;  3TLT A;  3ZDG A;  3ZKR A;  4QAA A;  3RIA A;  5BP0 A;  2XZ6 A;  3U8J A;  3PEO A;  4ZK4 A;  4ILA A;  2BG9 B;  3UU6 A;  3TLU A;  4QH4 A;  4QH5 A;  3RQW A;  4ZJT A;  3UQ7 A;  3RI5 A;  5BW2 A;  2XQ6 A;  5AFK A;  2BYN A;  4HFI A;  4QH1 A;  3U8K A;  5CO5 A;  5LG3 A;  1UW6 A;  2BYQ A;  3JAD A;  3JAF A;  5L4E A;  3SQ9 A;  4HQP A;  4NPP A;  4AFG A;  2XZ5 A;  4HFE A;  4DBM A;  4LML A;  2W8G A;  4FRR A;  2YKS A;  4AFH A;  4TWD A;  5J5G A;  2QC1 B;  3WTJ A;  4UM3 S;  2YN6 A;  3SQ6 A;  1UV6 A;  2XYS A;  5J5H A;  2Y7Y A;  2PH9 A;  2XNU A;  4TNW A;  2Y56 A;  3PMZ A;  5KZU A;  2WNJ A;  2XQ8 A;  2X00 A;  3RHW A;  5BRX A;  3WTO A;  5AIN A;  3UU3 A;  4LMK A;  3P50 A;  5IUX A;  4F8H A;  5HEO A;  2Y58 A;  4IL4 A;  5AFM A;  2YME A;  2BYP A;  3LSV A;  2WNL A;  5SYO A;  5J0Z A;  4TWH A;  4HFB A;  2BYS A;  2XYT A;  4UY2 A;  4ALX A;  4HFC A;  3UU4 A;  5L4H A;  5L47 A;  5J5F A;  4UM3 A;  4ZJS A;  1I9B A;  3TLW A;  5CFB A;  2YOE A;  2Y54 A;  2WNC A;  3C79 A;  2BG9 E;  4IL9 A;  3UQ4 A;  3WTM A;  2W8F A;  2WN9 A;  5AFJ A;  4IRE A;  2X00 D;  3TLS A;  3UUB A;  5HEU A;  3WIP A;  5AFH A;  2BJ0 A;  2Y57 A;  2UZ6 A;  3U8M A;  2C9T A;  2YMD A;  5HCM A;  2ZJV A;  5HCJ A;  4ZZC A;  4LMJ A;  4WV9 A;  3RIF A;  2BG9 A;  3WTI A;  4BQT A;  4UM3 P;  3UU8 A;  2XNT A;  5HEH A;  2XQ9 A;  3WTL A;  3P4W A;  2BR7 A;  4PIR A;  4X5T A;  4AFT A;  3EHZ A;  2XQ7 A;  3WTN A;  4UM1 A;  3WTK A;  4Z90 A;  3RQU A;  4TWF A;  3ZDH A;  5FJV A;  4BFQ A;  4UXU A;  3SIO A;  4ZK1 A;  2XQ4 A;  3UU5 A;  4ILC A;  4B5D A;  4COF A;  5J5I A;  4NZB A;  4Z91 A;  4EZ1 A;  2BYR A;  5AFM B;  4TNV A;  3EAM A;  5JME A;  5LXB A;  2XQA A;  5TVC A; 
#chains in the Genus database with same CATH homology
 3SH1 A;  2XNV A;  3JAE A;  3C84 A;  4A98 A;  4XHE A;  4QAB A;  3U8N A;  4A97 A;  5AFL A;  2ZJU A;  2PGZ A;  4ZR6 A;  2BR8 A;  4HFD A;  3T4M A;  3IGQ A;  5HEG A;  2BG9 C;  3WTH A;  1UX2 A;  4ZRU A;  4XK9 A;  3TLV A;  3GUA A;  2WZY A;  4ILB A;  4D01 A;  4ZZB A;  3U8L A;  2XQ5 A;  5KE4 A;  2XQ3 A;  2VL0 A;  5HEJ A;  5AFN A;  3EI0 A;  4HFH A;  4QAC A;  3TLT A;  3ZDG A;  3ZKR A;  4QAA A;  3RIA A;  5BP0 A;  2XZ6 A;  3U8J A;  3PEO A;  4ZK4 A;  4ILA A;  2BG9 B;  3UU6 A;  3TLU A;  4QH4 A;  4QH5 A;  3RQW A;  4ZJT A;  3UQ7 A;  3RI5 A;  5BW2 A;  2XQ6 A;  5AFK A;  2BYN A;  4HFI A;  4QH1 A;  3U8K A;  5CO5 A;  5LG3 A;  1UW6 A;  2BYQ A;  3JAD A;  3JAF A;  5L4E A;  3SQ9 A;  4HQP A;  4NPP A;  4AFG A;  2XZ5 A;  4HFE A;  4DBM A;  4LML A;  2W8G A;  4FRR A;  2YKS A;  4AFH A;  4TWD A;  5J5G A;  2QC1 B;  3WTJ A;  4UM3 S;  2YN6 A;  3SQ6 A;  1UV6 A;  2XYS A;  5J5H A;  2Y7Y A;  2PH9 A;  2XNU A;  4TNW A;  2Y56 A;  3PMZ A;  5KZU A;  2WNJ A;  2XQ8 A;  2X00 A;  3RHW A;  5BRX A;  3WTO A;  5AIN A;  3UU3 A;  4LMK A;  3P50 A;  5IUX A;  4F8H A;  5HEO A;  2Y58 A;  4IL4 A;  5AFM A;  2YME A;  2BYP A;  3LSV A;  2WNL A;  5SYO A;  5J0Z A;  4TWH A;  4HFB A;  2BYS A;  2XYT A;  4UY2 A;  4ALX A;  4HFC A;  3UU4 A;  5L4H A;  5L47 A;  5J5F A;  4UM3 A;  4ZJS A;  1I9B A;  3TLW A;  5CFB A;  2YOE A;  2Y54 A;  2WNC A;  3C79 A;  2BG9 E;  4IL9 A;  3UQ4 A;  3WTM A;  2W8F A;  2WN9 A;  5AFJ A;  4IRE A;  2X00 D;  3TLS A;  3UUB A;  5HEU A;  3WIP A;  5AFH A;  2BJ0 A;  2Y57 A;  2UZ6 A;  3U8M A;  2C9T A;  2YMD A;  5HCM A;  2ZJV A;  5HCJ A;  4ZZC A;  4LMJ A;  4WV9 A;  3RIF A;  2BG9 A;  3WTI A;  4BQT A;  4UM3 P;  3UU8 A;  2XNT A;  5HEH A;  2XQ9 A;  3WTL A;  3P4W A;  2BR7 A;  4PIR A;  4X5T A;  4AFT A;  3EHZ A;  2XQ7 A;  3WTN A;  4UM1 A;  3WTK A;  4Z90 A;  3RQU A;  4TWF A;  3ZDH A;  5FJV A;  4BFQ A;  4UXU A;  3SIO A;  4ZK1 A;  2XQ4 A;  3UU5 A;  4ILC A;  4B5D A;  4COF A;  5J5I A;  4NZB A;  4Z91 A;  4EZ1 A;  2BYR A;  5AFM B;  4TNV A;  3EAM A;  5JME A;  5LXB A;  2XQA A;  5TVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...