4AFHA

Capitella teleta achbp in complex with lobeline
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
213
structure length
213
Chain Sequence
b'SNGLMAKRLRRELLNTYEQLGKSGLPFLDDIGKVDVKFGLSLQLLKSIEQRGMGFNSIGTFKAIVKLSWVDTILRWDPEPPFDFQKIEISPDEIWTPDIKLFNSVDLDMTLDRTTQAIVFSNGTVLWIPPAVLKVLCVSQDDVDSCHFQFGSWVYSVDEVDIHFMDDKAEVLLDFYQDSLEILENSAQRQEVVYPCCESAYVEMKYLLALRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACHBP
publication title Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
pubmed doi rcsb
source organism Capitella teleta
molecule tags Acetylcholine-binding protein
total genus 47
structure length 213
sequence length 213
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4afhA00
4QH4A 2X00A 3RI5A 4F8HA 4XK9A 4ZK4A 2YKSA 4ILBA 3ZKRA 2VL0A 3TLWA 4AFGA 5HCJA 2ZJUA 5IUXA 5L47A 3PEOA 4TNWA 4DBMA 4QAAA 3WTNA 2YOEA 4LMJA 2BJ0A 5HEGA 3LSVA 5AINA 4QH5A 3ZDGA 2XQ4A 4TNVA 5J5FA 1UX2A 4IREA 2BYRA 2BG9B 2XQ9A 3SH1A 2XZ5A 3PMZA 2XYTA 5HEOA 3UQ4A 3RHWA 4ZZBA 4BFQA 3TLTA 3UU8A 4HFHA 2PH9A 5HEUA 2XQ5A 4EZ1A 3P50A 2W8FA 2PGZA 2UZ6A 3WIPA 4PIRA 4X5TA 3C84A 4LMLA 3SQ6A 2XQ7A 2XQ3A 4BQTA 3UU4A 2W8GA 2BYQA 5HCMA 3TLVA 3UUBA 2WNJA 5AFKA 4XHEA 5AFLA 2QC1B 4HFDA 2WZYA 4ZRUA 4UXUA 4UM3A 3WTJA 5AFNA 2BR8A 4A97A 3RQUA 4QABA 4ZR6A 2XYSA 5AFMB 4ALXA 3SQ9A 3RIAA 4ILCA 3WTMA 5CO5A 2Y57A 4ILAA 5J0ZA 2XQAA 2XQ6A 4ZK1A 5L4HA 2BYNA 2YMEA 5HEHA 5TVCA 4LMKA 4UM3P 3TLSA 3EI0A 5AFMA 2Y58A 3SIOA 3U8MA 3WTLA 4ZJTA 3U8JA 2Y54A 5SYOA 5BW2A 4HFCA 4QH1A 5BRXA 4TWFA 2BYSA 3T4MA 4IL4A 4B5DA 3WTHA 4UM3S 3TLUA 4A98A 5J5GA 4IL9A 2XNTA 3U8KA 5KE4A 4HFBA 2C9TA 5KZUA 3IGQA 5AFJA 2XZ6A 5J5IA 2YN6A 3JAFA 3WTIA 3ZDHA 2X00D 4ZZCA 3WTKA 4ZJSA 5LG3A 2XNUA 4UY2A 5CFBA 5J5HA 3UU3A 3RQWA 3UU6A 1I9BA 2Y7YA 4NPPA 4TWDA 5JMEA 4AFHA 3RIFA 2BYPA 2BG9E 4AFTA 3EHZA 4Z91A 5AFHA 2XNVA 3U8NA 3GUAA 2XQ8A 2Y56A 5LXBA 2BG9C 1UW6A 4HFEA 2YMDA 3UQ7A 4WV9A 1UV6A 3EAMA 4Z90A 3UU5A 4HFIA 2BR7A 5HEJA 2WNCA 4COFA 4HQPA 4QACA 3WTOA 3C79A 4TWHA 3P4WA 3JAEA 4D01A 4NZBA 5L4EA 4FRRA 3U8LA 2ZJVA 5FJVA 2WN9A 2WNLA 4UM1A 3JADA 2BG9A 5BP0A
chains in the Genus database with same CATH superfamily
4QH4A 2X00A 3RI5A 4F8HA 4XK9A 4ZK4A 2YKSA 4ILBA 3ZKRA 2VL0A 3TLWA 4AFGA 5HCJA 2ZJUA 5IUXA 5L47A 3PEOA 4TNWA 4DBMA 4QAAA 3WTNA 2YOEA 4LMJA 2BJ0A 5HEGA 3LSVA 5AINA 4QH5A 3ZDGA 2XQ4A 4TNVA 5J5FA 1UX2A 4IREA 2BYRA 2BG9B 2XQ9A 3SH1A 2XZ5A 3PMZA 2XYTA 5HEOA 3UQ4A 3RHWA 4ZZBA 4BFQA 3TLTA 3UU8A 4HFHA 2PH9A 5HEUA 2XQ5A 4EZ1A 3P50A 2W8FA 2PGZA 2UZ6A 3WIPA 4PIRA 4X5TA 3C84A 4LMLA 3SQ6A 2XQ7A 2XQ3A 4BQTA 3UU4A 2W8GA 2BYQA 5HCMA 3TLVA 3UUBA 2WNJA 5AFKA 4XHEA 5AFLA 2QC1B 4HFDA 2WZYA 4ZRUA 4UXUA 4UM3A 3WTJA 5AFNA 2BR8A 4A97A 3RQUA 4QABA 4ZR6A 2XYSA 5AFMB 4ALXA 3SQ9A 3RIAA 4ILCA 3WTMA 5CO5A 2Y57A 4ILAA 5J0ZA 2XQAA 2XQ6A 4ZK1A 5L4HA 2BYNA 2YMEA 5HEHA 5TVCA 4LMKA 4UM3P 3TLSA 3EI0A 5AFMA 2Y58A 3SIOA 3U8MA 3WTLA 4ZJTA 3U8JA 2Y54A 5SYOA 5BW2A 4HFCA 4QH1A 5BRXA 4TWFA 2BYSA 3T4MA 4IL4A 4B5DA 3WTHA 4UM3S 3TLUA 4A98A 5J5GA 4IL9A 2XNTA 3U8KA 5KE4A 4HFBA 2C9TA 5KZUA 3IGQA 5AFJA 2XZ6A 5J5IA 2YN6A 3JAFA 3WTIA 3ZDHA 2X00D 4ZZCA 3WTKA 4ZJSA 5LG3A 2XNUA 4UY2A 5CFBA 5J5HA 3UU3A 3RQWA 3UU6A 1I9BA 2Y7YA 4NPPA 4TWDA 5JMEA 4AFHA 3RIFA 2BYPA 2BG9E 4AFTA 3EHZA 4Z91A 5AFHA 2XNVA 3U8NA 3GUAA 2XQ8A 2Y56A 5LXBA 2BG9C 1UW6A 4HFEA 2YMDA 3UQ7A 4WV9A 1UV6A 3EAMA 4Z90A 3UU5A 4HFIA 2BR7A 5HEJA 2WNCA 4COFA 4HQPA 4QACA 3WTOA 3C79A 4TWHA 3P4WA 3JAEA 4D01A 4NZBA 5L4EA 4FRRA 3U8LA 2ZJVA 5FJVA 2WN9A 2WNLA 4UM1A 3JADA 2BG9A 5BP0A
chains in the Genus database with same CATH topology
4QH4A 2X00A 3RI5A 4F8HA 4XK9A 4ZK4A 2YKSA 4ILBA 3ZKRA 2VL0A 3TLWA 4AFGA 5HCJA 2ZJUA 5IUXA 5L47A 3PEOA 4TNWA 4DBMA 4QAAA 3WTNA 2YOEA 4LMJA 2BJ0A 5HEGA 3LSVA 5AINA 4QH5A 3ZDGA 2XQ4A 4TNVA 5J5FA 1UX2A 4IREA 2BYRA 2BG9B 2XQ9A 3SH1A 2XZ5A 3PMZA 2XYTA 5HEOA 3UQ4A 3RHWA 4ZZBA 4BFQA 3TLTA 3UU8A 4HFHA 2PH9A 5HEUA 2XQ5A 4EZ1A 3P50A 2W8FA 2PGZA 2UZ6A 3WIPA 4PIRA 4X5TA 3C84A 4LMLA 3SQ6A 2XQ7A 2XQ3A 4BQTA 3UU4A 2W8GA 2BYQA 5HCMA 3TLVA 3UUBA 2WNJA 5AFKA 4XHEA 5AFLA 2QC1B 4HFDA 2WZYA 4ZRUA 4UXUA 4UM3A 3WTJA 5AFNA 2BR8A 4A97A 3RQUA 4QABA 4ZR6A 2XYSA 5AFMB 4ALXA 3SQ9A 3RIAA 4ILCA 3WTMA 5CO5A 2Y57A 4ILAA 5J0ZA 2XQAA 2XQ6A 4ZK1A 5L4HA 2BYNA 2YMEA 5HEHA 5TVCA 4LMKA 4UM3P 3TLSA 3EI0A 5AFMA 2Y58A 3SIOA 3U8MA 3WTLA 4ZJTA 3U8JA 2Y54A 5SYOA 5BW2A 4HFCA 4QH1A 5BRXA 4TWFA 2BYSA 3T4MA 4IL4A 4B5DA 3WTHA 4UM3S 3TLUA 4A98A 5J5GA 4IL9A 2XNTA 3U8KA 5KE4A 4HFBA 2C9TA 5KZUA 3IGQA 5AFJA 2XZ6A 5J5IA 2YN6A 3JAFA 3WTIA 3ZDHA 2X00D 4ZZCA 3WTKA 4ZJSA 5LG3A 2XNUA 4UY2A 5CFBA 5J5HA 3UU3A 3RQWA 3UU6A 1I9BA 2Y7YA 4NPPA 4TWDA 5JMEA 4AFHA 3RIFA 2BYPA 2BG9E 4AFTA 3EHZA 4Z91A 5AFHA 2XNVA 3U8NA 3GUAA 2XQ8A 2Y56A 5LXBA 2BG9C 1UW6A 4HFEA 2YMDA 3UQ7A 4WV9A 1UV6A 3EAMA 4Z90A 3UU5A 4HFIA 2BR7A 5HEJA 2WNCA 4COFA 4HQPA 4QACA 3WTOA 3C79A 4TWHA 3P4WA 3JAEA 4D01A 4NZBA 5L4EA 4FRRA 3U8LA 2ZJVA 5FJVA 2WN9A 2WNLA 4UM1A 3JADA 2BG9A 5BP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QH4 A;  2X00 A;  3RI5 A;  4F8H A;  4XK9 A;  4ZK4 A;  2YKS A;  4ILB A;  3ZKR A;  2VL0 A;  3TLW A;  4AFG A;  5HCJ A;  2ZJU A;  5IUX A;  5L47 A;  3PEO A;  4TNW A;  4DBM A;  4QAA A;  3WTN A;  2YOE A;  4LMJ A;  2BJ0 A;  5HEG A;  3LSV A;  5AIN A;  4QH5 A;  3ZDG A;  2XQ4 A;  4TNV A;  5J5F A;  1UX2 A;  4IRE A;  2BYR A;  2BG9 B;  2XQ9 A;  3SH1 A;  2XZ5 A;  3PMZ A;  2XYT A;  5HEO A;  3UQ4 A;  3RHW A;  4ZZB A;  4BFQ A;  3TLT A;  3UU8 A;  4HFH A;  2PH9 A;  5HEU A;  2XQ5 A;  4EZ1 A;  3P50 A;  2W8F A;  2PGZ A;  2UZ6 A;  3WIP A;  4PIR A;  4X5T A;  3C84 A;  4LML A;  3SQ6 A;  2XQ7 A;  2XQ3 A;  4BQT A;  3UU4 A;  2W8G A;  2BYQ A;  5HCM A;  3TLV A;  3UUB A;  2WNJ A;  5AFK A;  4XHE A;  5AFL A;  2QC1 B;  4HFD A;  2WZY A;  4ZRU A;  4UXU A;  4UM3 A;  3WTJ A;  5AFN A;  2BR8 A;  4A97 A;  3RQU A;  4QAB A;  4ZR6 A;  2XYS A;  5AFM B;  4ALX A;  3SQ9 A;  3RIA A;  4ILC A;  3WTM A;  5CO5 A;  2Y57 A;  4ILA A;  5J0Z A;  2XQA A;  2XQ6 A;  4ZK1 A;  5L4H A;  2BYN A;  2YME A;  5HEH A;  5TVC A;  4LMK A;  4UM3 P;  3TLS A;  3EI0 A;  5AFM A;  2Y58 A;  3SIO A;  3U8M A;  3WTL A;  4ZJT A;  3U8J A;  2Y54 A;  5SYO A;  5BW2 A;  4HFC A;  4QH1 A;  5BRX A;  4TWF A;  2BYS A;  3T4M A;  4IL4 A;  4B5D A;  3WTH A;  4UM3 S;  3TLU A;  4A98 A;  5J5G A;  4IL9 A;  2XNT A;  3U8K A;  5KE4 A;  4HFB A;  2C9T A;  5KZU A;  3IGQ A;  5AFJ A;  2XZ6 A;  5J5I A;  2YN6 A;  3JAF A;  3WTI A;  3ZDH A;  2X00 D;  4ZZC A;  3WTK A;  4ZJS A;  5LG3 A;  2XNU A;  4UY2 A;  5CFB A;  5J5H A;  3UU3 A;  3RQW A;  3UU6 A;  1I9B A;  2Y7Y A;  4NPP A;  4TWD A;  5JME A;  4AFH A;  3RIF A;  2BYP A;  2BG9 E;  4AFT A;  3EHZ A;  4Z91 A;  5AFH A;  2XNV A;  3U8N A;  3GUA A;  2XQ8 A;  2Y56 A;  5LXB A;  2BG9 C;  1UW6 A;  4HFE A;  2YMD A;  3UQ7 A;  4WV9 A;  1UV6 A;  3EAM A;  4Z90 A;  3UU5 A;  4HFI A;  2BR7 A;  5HEJ A;  2WNC A;  4COF A;  4HQP A;  4QAC A;  3WTO A;  3C79 A;  4TWH A;  3P4W A;  3JAE A;  4D01 A;  4NZB A;  5L4E A;  4FRR A;  3U8L A;  2ZJV A;  5FJV A;  2WN9 A;  2WNL A;  4UM1 A;  3JAD A;  2BG9 A;  5BP0 A; 
#chains in the Genus database with same CATH topology
 4QH4 A;  2X00 A;  3RI5 A;  4F8H A;  4XK9 A;  4ZK4 A;  2YKS A;  4ILB A;  3ZKR A;  2VL0 A;  3TLW A;  4AFG A;  5HCJ A;  2ZJU A;  5IUX A;  5L47 A;  3PEO A;  4TNW A;  4DBM A;  4QAA A;  3WTN A;  2YOE A;  4LMJ A;  2BJ0 A;  5HEG A;  3LSV A;  5AIN A;  4QH5 A;  3ZDG A;  2XQ4 A;  4TNV A;  5J5F A;  1UX2 A;  4IRE A;  2BYR A;  2BG9 B;  2XQ9 A;  3SH1 A;  2XZ5 A;  3PMZ A;  2XYT A;  5HEO A;  3UQ4 A;  3RHW A;  4ZZB A;  4BFQ A;  3TLT A;  3UU8 A;  4HFH A;  2PH9 A;  5HEU A;  2XQ5 A;  4EZ1 A;  3P50 A;  2W8F A;  2PGZ A;  2UZ6 A;  3WIP A;  4PIR A;  4X5T A;  3C84 A;  4LML A;  3SQ6 A;  2XQ7 A;  2XQ3 A;  4BQT A;  3UU4 A;  2W8G A;  2BYQ A;  5HCM A;  3TLV A;  3UUB A;  2WNJ A;  5AFK A;  4XHE A;  5AFL A;  2QC1 B;  4HFD A;  2WZY A;  4ZRU A;  4UXU A;  4UM3 A;  3WTJ A;  5AFN A;  2BR8 A;  4A97 A;  3RQU A;  4QAB A;  4ZR6 A;  2XYS A;  5AFM B;  4ALX A;  3SQ9 A;  3RIA A;  4ILC A;  3WTM A;  5CO5 A;  2Y57 A;  4ILA A;  5J0Z A;  2XQA A;  2XQ6 A;  4ZK1 A;  5L4H A;  2BYN A;  2YME A;  5HEH A;  5TVC A;  4LMK A;  4UM3 P;  3TLS A;  3EI0 A;  5AFM A;  2Y58 A;  3SIO A;  3U8M A;  3WTL A;  4ZJT A;  3U8J A;  2Y54 A;  5SYO A;  5BW2 A;  4HFC A;  4QH1 A;  5BRX A;  4TWF A;  2BYS A;  3T4M A;  4IL4 A;  4B5D A;  3WTH A;  4UM3 S;  3TLU A;  4A98 A;  5J5G A;  4IL9 A;  2XNT A;  3U8K A;  5KE4 A;  4HFB A;  2C9T A;  5KZU A;  3IGQ A;  5AFJ A;  2XZ6 A;  5J5I A;  2YN6 A;  3JAF A;  3WTI A;  3ZDH A;  2X00 D;  4ZZC A;  3WTK A;  4ZJS A;  5LG3 A;  2XNU A;  4UY2 A;  5CFB A;  5J5H A;  3UU3 A;  3RQW A;  3UU6 A;  1I9B A;  2Y7Y A;  4NPP A;  4TWD A;  5JME A;  4AFH A;  3RIF A;  2BYP A;  2BG9 E;  4AFT A;  3EHZ A;  4Z91 A;  5AFH A;  2XNV A;  3U8N A;  3GUA A;  2XQ8 A;  2Y56 A;  5LXB A;  2BG9 C;  1UW6 A;  4HFE A;  2YMD A;  3UQ7 A;  4WV9 A;  1UV6 A;  3EAM A;  4Z90 A;  3UU5 A;  4HFI A;  2BR7 A;  5HEJ A;  2WNC A;  4COF A;  4HQP A;  4QAC A;  3WTO A;  3C79 A;  4TWH A;  3P4W A;  3JAE A;  4D01 A;  4NZB A;  5L4E A;  4FRR A;  3U8L A;  2ZJV A;  5FJV A;  2WN9 A;  2WNL A;  4UM1 A;  3JAD A;  2BG9 A;  5BP0 A; 
#chains in the Genus database with same CATH homology
 4QH4 A;  2X00 A;  3RI5 A;  4F8H A;  4XK9 A;  4ZK4 A;  2YKS A;  4ILB A;  3ZKR A;  2VL0 A;  3TLW A;  4AFG A;  5HCJ A;  2ZJU A;  5IUX A;  5L47 A;  3PEO A;  4TNW A;  4DBM A;  4QAA A;  3WTN A;  2YOE A;  4LMJ A;  2BJ0 A;  5HEG A;  3LSV A;  5AIN A;  4QH5 A;  3ZDG A;  2XQ4 A;  4TNV A;  5J5F A;  1UX2 A;  4IRE A;  2BYR A;  2BG9 B;  2XQ9 A;  3SH1 A;  2XZ5 A;  3PMZ A;  2XYT A;  5HEO A;  3UQ4 A;  3RHW A;  4ZZB A;  4BFQ A;  3TLT A;  3UU8 A;  4HFH A;  2PH9 A;  5HEU A;  2XQ5 A;  4EZ1 A;  3P50 A;  2W8F A;  2PGZ A;  2UZ6 A;  3WIP A;  4PIR A;  4X5T A;  3C84 A;  4LML A;  3SQ6 A;  2XQ7 A;  2XQ3 A;  4BQT A;  3UU4 A;  2W8G A;  2BYQ A;  5HCM A;  3TLV A;  3UUB A;  2WNJ A;  5AFK A;  4XHE A;  5AFL A;  2QC1 B;  4HFD A;  2WZY A;  4ZRU A;  4UXU A;  4UM3 A;  3WTJ A;  5AFN A;  2BR8 A;  4A97 A;  3RQU A;  4QAB A;  4ZR6 A;  2XYS A;  5AFM B;  4ALX A;  3SQ9 A;  3RIA A;  4ILC A;  3WTM A;  5CO5 A;  2Y57 A;  4ILA A;  5J0Z A;  2XQA A;  2XQ6 A;  4ZK1 A;  5L4H A;  2BYN A;  2YME A;  5HEH A;  5TVC A;  4LMK A;  4UM3 P;  3TLS A;  3EI0 A;  5AFM A;  2Y58 A;  3SIO A;  3U8M A;  3WTL A;  4ZJT A;  3U8J A;  2Y54 A;  5SYO A;  5BW2 A;  4HFC A;  4QH1 A;  5BRX A;  4TWF A;  2BYS A;  3T4M A;  4IL4 A;  4B5D A;  3WTH A;  4UM3 S;  3TLU A;  4A98 A;  5J5G A;  4IL9 A;  2XNT A;  3U8K A;  5KE4 A;  4HFB A;  2C9T A;  5KZU A;  3IGQ A;  5AFJ A;  2XZ6 A;  5J5I A;  2YN6 A;  3JAF A;  3WTI A;  3ZDH A;  2X00 D;  4ZZC A;  3WTK A;  4ZJS A;  5LG3 A;  2XNU A;  4UY2 A;  5CFB A;  5J5H A;  3UU3 A;  3RQW A;  3UU6 A;  1I9B A;  2Y7Y A;  4NPP A;  4TWD A;  5JME A;  4AFH A;  3RIF A;  2BYP A;  2BG9 E;  4AFT A;  3EHZ A;  4Z91 A;  5AFH A;  2XNV A;  3U8N A;  3GUA A;  2XQ8 A;  2Y56 A;  5LXB A;  2BG9 C;  1UW6 A;  4HFE A;  2YMD A;  3UQ7 A;  4WV9 A;  1UV6 A;  3EAM A;  4Z90 A;  3UU5 A;  4HFI A;  2BR7 A;  5HEJ A;  2WNC A;  4COF A;  4HQP A;  4QAC A;  3WTO A;  3C79 A;  4TWH A;  3P4W A;  3JAE A;  4D01 A;  4NZB A;  5L4E A;  4FRR A;  3U8L A;  2ZJV A;  5FJV A;  2WN9 A;  2WNL A;  4UM1 A;  3JAD A;  2BG9 A;  5BP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...