4AFXA

Crystal structure of the reactive loop cleaved zpi in i2 space group
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
347
structure length
347
Chain Sequence
SEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Catalytic Activation of Protein Z-Dependent Protease Inhibitor (Zpi) by Protein Z.
pubmed doi rcsb
molecule keywords PROTEIN Z DEPENDENT PROTEASE INHIBITOR
molecule tags Hydrolase inhibitor
source organism Homo sapiens
total genus 93
structure length 347
sequence length 347
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.39.10 Mainly Beta Roll Alpha-1-antitrypsin; domain 1 Alpha-1-antitrypsin, domain 1 4afxA02
3.30.497.10 Alpha Beta 2-Layer Sandwich Antithrombin; Chain I, domain 2 Antithrombin, subunit I, domain 2 4afxA01
4RSQA 1PSIA 4PYWA 1AZXI 1MTPA 2B4XL 1ANTI 3KCGI 4EB1L 3DRMA 1OC0A 4G8RA 2HI9A 2HIJL 4AJTA 4ROBA 2WXXA 4AU3A 1B3KA 3STOA 1QMNA 2WY0C 1OPHA 2RIVA 4KDSA 1ATUA 1C8OA 4RO9A 4ZK0A 1DZHI 2ARRA 3CWMA 1NQ9I 2WXZC 2ZNHA 1LK6I 1OVAA 3PZFA 1BR8I 2CEOA 4Y40A 4DY7C 3LW2A 5INWA 2ACHA 3EVJI 1AS4A 2ZV6A 1JTIA 2OL2A 3CAAA 1HLEA 2H4RA 1DZGL 3UT3A 1WZ9A 2ANTI 2XN5A 1LJ5A 1OVAB 4IF8A 5CE0A 2XN6A 4X30A 2WXYC 1E03I 4G8OA 1XQJA 4C49A 4AFXA 3NE4A 3DLWA 4DTEA 8APIA 1JJOC 3NDDA 4AU4A 3F1SA 4IC0A 7APIA 1SEKA 1OYHI 1SR5A 2QUGA 3FGQA 1R1LI 4CAAA 1ATTA 3Q03A 4AJUA 4P0FA 2VDXA 2B5TI 1JMJA 4DY0A 4BB2A 4ROAA 9PAIA 2PEEA 2XN3A 1QLPA 2XN7A 4AQHA 1HP7A 1JRRA 1TB6I 5C98A 1T1FA 1E04I 2BEHI 3DY0A 1E05I 1IZ2A 1D5SA 2V95A 5HGCA 1DVNA 1DZHL 2WXZA 1QMBA 2H4PA 1ATHA 1XQGA 3LE2A 1C5GA 3PB1I 2B4XI 2RIWA 3ZHAA 1A7CA 3VVJA 5EI0A 1F0CA 2GD4C 1UHGA 3F5NA 2BEHL 1SNGA 3F02A 1OO8A 5BRRI 2VH4A 3NDAA 3R4LA 1DB2A 4R9IA 1LQ8A 3H5CA 4ZK3A 2ARQA 1M93B 2DUTA 1OVAC 4Y3KA 3CVMA 2VDYA 9APIA 5CDXA 3Q02A 5CDZA 3OZQA 4C41A 1K9OI 1OYHL 1JMOA 1BY7A 2D26A 1YXAA 3NDFA 3B9FI 1DZGI 4YIAA 1DVMA 1JVQI 2R9YA 2WY1A 2H4QA 4AU2A 2OAYA 4EB1I 1EZXA 2HIJI 1KCTA 2WXWA 4P0OA 1IMVA 1XU8A 3T1PA 5IO1A 4GA7A 4AU3B 3DRUA 3EOXA 3CWLA 2PEFA
chains in the Genus database with same CATH superfamily
4RSQA 1PSIA 4PYWA 1AZXI 1MTPA 2B4XL 1ANTI 3KCGI 4EB1L 3DRMA 1OC0A 4G8RA 2HI9A 2HIJL 4AJTA 4ROBA 2WXXA 4AU3A 1B3KA 3STOA 1QMNA 2WY0C 1OPHA 2RIVA 4KDSA 1ATUA 1C8OA 4RO9A 4ZK0A 1DZHI 2ARRA 3CWMA 1NQ9I 2WXZC 2ZNHA 1LK6I 1OVAA 3PZFA 1BR8I 2CEOA 4Y40A 4DY7C 3LW2A 5INWA 2ACHA 3EVJI 1AS4A 2ZV6A 1JTIA 2OL2A 3CAAA 1HLEA 2H4RA 1DZGL 3UT3A 1WZ9A 2ANTI 2XN5A 1LJ5A 1OVAB 4IF8A 5CE0A 2XN6A 4X30A 2WXYC 1E03I 4G8OA 1XQJA 4C49A 4AFXA 3NE4A 3DLWA 4DTEA 8APIA 1JJOC 3NDDA 4AU4A 3F1SA 4IC0A 7APIA 1SEKA 1OYHI 1SR5A 2QUGA 3FGQA 1R1LI 4CAAA 1ATTA 3Q03A 4AJUA 4P0FA 2VDXA 2B5TI 1JMJA 4DY0A 4BB2A 4ROAA 9PAIA 2PEEA 2XN3A 1QLPA 2XN7A 4AQHA 1HP7A 1JRRA 1TB6I 5C98A 1T1FA 1E04I 2BEHI 3DY0A 1E05I 1IZ2A 1D5SA 2V95A 5HGCA 1DVNA 1DZHL 2WXZA 1QMBA 2H4PA 1ATHA 1XQGA 3LE2A 1C5GA 3PB1I 2B4XI 2RIWA 3ZHAA 1A7CA 3VVJA 5EI0A 1F0CA 2GD4C 1UHGA 3F5NA 2BEHL 1SNGA 3F02A 1OO8A 5BRRI 2VH4A 3NDAA 3R4LA 1DB2A 4R9IA 1LQ8A 3H5CA 4ZK3A 2ARQA 1M93B 2DUTA 1OVAC 4Y3KA 3CVMA 2VDYA 9APIA 5CDXA 3Q02A 5CDZA 3OZQA 4C41A 1K9OI 1OYHL 1JMOA 1BY7A 2D26A 1YXAA 3NDFA 3B9FI 1DZGI 4YIAA 1DVMA 1JVQI 2R9YA 2WY1A 2H4QA 4AU2A 2OAYA 4EB1I 1EZXA 2HIJI 1KCTA 2WXWA 4P0OA 1IMVA 1XU8A 3T1PA 5IO1A 4GA7A 4AU3B 3DRUA 3EOXA 3CWLA 2PEFA
chains in the Genus database with same CATH topology
4RSQA 1PSIA 4PYWA 1AZXI 1MTPA 2B4XL 1ANTI 3KCGI 4EB1L 3DRMA 1OC0A 4G8RA 2HI9A 2HIJL 4AJTA 4ROBA 2WXXA 4AU3A 1B3KA 3STOA 1QMNA 2WY0C 1OPHA 2RIVA 4KDSA 1ATUA 1C8OA 4RO9A 4ZK0A 1DZHI 2ARRA 3CWMA 1NQ9I 2WXZC 2ZNHA 1LK6I 1OVAA 3PZFA 1BR8I 2CEOA 4Y40A 4DY7C 3LW2A 5INWA 2ACHA 3EVJI 1AS4A 2ZV6A 1JTIA 2OL2A 3CAAA 1HLEA 2H4RA 1DZGL 3UT3A 1WZ9A 2ANTI 2XN5A 1LJ5A 1OVAB 4IF8A 5CE0A 2XN6A 4X30A 2WXYC 1E03I 4G8OA 1XQJA 4C49A 4AFXA 3NE4A 3DLWA 4DTEA 8APIA 1JJOC 3NDDA 4AU4A 3F1SA 4IC0A 7APIA 1SEKA 1OYHI 1SR5A 2QUGA 3FGQA 1R1LI 4CAAA 1ATTA 3Q03A 4AJUA 4P0FA 2VDXA 2B5TI 1JMJA 4DY0A 4BB2A 4ROAA 9PAIA 2PEEA 2XN3A 1QLPA 2XN7A 4AQHA 1HP7A 1JRRA 1TB6I 5C98A 1T1FA 1E04I 2BEHI 3DY0A 1E05I 1IZ2A 1D5SA 2V95A 5HGCA 1DVNA 1DZHL 2WXZA 1QMBA 2H4PA 1ATHA 1XQGA 3LE2A 1C5GA 3PB1I 2B4XI 2RIWA 3ZHAA 1A7CA 3VVJA 5EI0A 1F0CA 2GD4C 1UHGA 3F5NA 2BEHL 1SNGA 3F02A 1OO8A 5BRRI 2VH4A 3NDAA 3R4LA 1DB2A 4R9IA 1LQ8A 3H5CA 4ZK3A 2ARQA 1M93B 2DUTA 1OVAC 4Y3KA 3CVMA 2VDYA 9APIA 5CDXA 3Q02A 5CDZA 3OZQA 4C41A 1K9OI 1OYHL 1JMOA 1BY7A 2D26A 1YXAA 3NDFA 3B9FI 1DZGI 4YIAA 1DVMA 1JVQI 2R9YA 2WY1A 2H4QA 4AU2A 2OAYA 4EB1I 1EZXA 2HIJI 1KCTA 2WXWA 4P0OA 1IMVA 1XU8A 3T1PA 5IO1A 4GA7A 4AU3B 3DRUA 3EOXA 3CWLA 2PEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RSQ A;  1PSI A;  4PYW A;  1AZX I;  1MTP A;  2B4X L;  1ANT I;  3KCG I;  4EB1 L;  3DRM A;  1OC0 A;  4G8R A;  2HI9 A;  2HIJ L;  4AJT A;  4ROB A;  2WXX A;  4AU3 A;  1B3K A;  3STO A;  1QMN A;  2WY0 C;  1OPH A;  2RIV A;  4KDS A;  1ATU A;  1C8O A;  4RO9 A;  4ZK0 A;  1DZH I;  2ARR A;  3CWM A;  1NQ9 I;  2WXZ C;  2ZNH A;  1LK6 I;  1OVA A;  3PZF A;  1BR8 I;  2CEO A;  4Y40 A;  4DY7 C;  3LW2 A;  5INW A;  2ACH A;  3EVJ I;  1AS4 A;  2ZV6 A;  1JTI A;  2OL2 A;  3CAA A;  1HLE A;  2H4R A;  1DZG L;  3UT3 A;  1WZ9 A;  2ANT I;  2XN5 A;  1LJ5 A;  1OVA B;  4IF8 A;  5CE0 A;  2XN6 A;  4X30 A;  2WXY C;  1E03 I;  4G8O A;  1XQJ A;  4C49 A;  4AFX A;  3NE4 A;  3DLW A;  4DTE A;  8API A;  1JJO C;  3NDD A;  4AU4 A;  3F1S A;  4IC0 A;  7API A;  1SEK A;  1OYH I;  1SR5 A;  2QUG A;  3FGQ A;  1R1L I;  4CAA A;  1ATT A;  3Q03 A;  4AJU A;  4P0F A;  2VDX A;  2B5T I;  1JMJ A;  4DY0 A;  4BB2 A;  4ROA A;  9PAI A;  2PEE A;  2XN3 A;  1QLP A;  2XN7 A;  4AQH A;  1HP7 A;  1JRR A;  1TB6 I;  5C98 A;  1T1F A;  1E04 I;  2BEH I;  3DY0 A;  1E05 I;  1IZ2 A;  1D5S A;  2V95 A;  5HGC A;  1DVN A;  1DZH L;  2WXZ A;  1QMB A;  2H4P A;  1ATH A;  1XQG A;  3LE2 A;  1C5G A;  3PB1 I;  2B4X I;  2RIW A;  3ZHA A;  1A7C A;  3VVJ A;  5EI0 A;  1F0C A;  2GD4 C;  1UHG A;  3F5N A;  2BEH L;  1SNG A;  3F02 A;  1OO8 A;  5BRR I;  2VH4 A;  3NDA A;  3R4L A;  1DB2 A;  4R9I A;  1LQ8 A;  3H5C A;  4ZK3 A;  2ARQ A;  1M93 B;  2DUT A;  1OVA C;  4Y3K A;  3CVM A;  2VDY A;  9API A;  5CDX A;  3Q02 A;  5CDZ A;  3OZQ A;  4C41 A;  1K9O I;  1OYH L;  1JMO A;  1BY7 A;  2D26 A;  1YXA A;  3NDF A;  3B9F I;  1DZG I;  4YIA A;  1DVM A;  1JVQ I;  2R9Y A;  2WY1 A;  2H4Q A;  4AU2 A;  2OAY A;  4EB1 I;  1EZX A;  2HIJ I;  1KCT A;  2WXW A;  4P0O A;  1IMV A;  1XU8 A;  3T1P A;  5IO1 A;  4GA7 A;  4AU3 B;  3DRU A;  3EOX A;  3CWL A;  2PEF A; 
#chains in the Genus database with same CATH topology
 4RSQ A;  1PSI A;  4PYW A;  1AZX I;  1MTP A;  2B4X L;  1ANT I;  3KCG I;  4EB1 L;  3DRM A;  1OC0 A;  4G8R A;  2HI9 A;  2HIJ L;  4AJT A;  4ROB A;  2WXX A;  4AU3 A;  1B3K A;  3STO A;  1QMN A;  2WY0 C;  1OPH A;  2RIV A;  4KDS A;  1ATU A;  1C8O A;  4RO9 A;  4ZK0 A;  1DZH I;  2ARR A;  3CWM A;  1NQ9 I;  2WXZ C;  2ZNH A;  1LK6 I;  1OVA A;  3PZF A;  1BR8 I;  2CEO A;  4Y40 A;  4DY7 C;  3LW2 A;  5INW A;  2ACH A;  3EVJ I;  1AS4 A;  2ZV6 A;  1JTI A;  2OL2 A;  3CAA A;  1HLE A;  2H4R A;  1DZG L;  3UT3 A;  1WZ9 A;  2ANT I;  2XN5 A;  1LJ5 A;  1OVA B;  4IF8 A;  5CE0 A;  2XN6 A;  4X30 A;  2WXY C;  1E03 I;  4G8O A;  1XQJ A;  4C49 A;  4AFX A;  3NE4 A;  3DLW A;  4DTE A;  8API A;  1JJO C;  3NDD A;  4AU4 A;  3F1S A;  4IC0 A;  7API A;  1SEK A;  1OYH I;  1SR5 A;  2QUG A;  3FGQ A;  1R1L I;  4CAA A;  1ATT A;  3Q03 A;  4AJU A;  4P0F A;  2VDX A;  2B5T I;  1JMJ A;  4DY0 A;  4BB2 A;  4ROA A;  9PAI A;  2PEE A;  2XN3 A;  1QLP A;  2XN7 A;  4AQH A;  1HP7 A;  1JRR A;  1TB6 I;  5C98 A;  1T1F A;  1E04 I;  2BEH I;  3DY0 A;  1E05 I;  1IZ2 A;  1D5S A;  2V95 A;  5HGC A;  1DVN A;  1DZH L;  2WXZ A;  1QMB A;  2H4P A;  1ATH A;  1XQG A;  3LE2 A;  1C5G A;  3PB1 I;  2B4X I;  2RIW A;  3ZHA A;  1A7C A;  3VVJ A;  5EI0 A;  1F0C A;  2GD4 C;  1UHG A;  3F5N A;  2BEH L;  1SNG A;  3F02 A;  1OO8 A;  5BRR I;  2VH4 A;  3NDA A;  3R4L A;  1DB2 A;  4R9I A;  1LQ8 A;  3H5C A;  4ZK3 A;  2ARQ A;  1M93 B;  2DUT A;  1OVA C;  4Y3K A;  3CVM A;  2VDY A;  9API A;  5CDX A;  3Q02 A;  5CDZ A;  3OZQ A;  4C41 A;  1K9O I;  1OYH L;  1JMO A;  1BY7 A;  2D26 A;  1YXA A;  3NDF A;  3B9F I;  1DZG I;  4YIA A;  1DVM A;  1JVQ I;  2R9Y A;  2WY1 A;  2H4Q A;  4AU2 A;  2OAY A;  4EB1 I;  1EZX A;  2HIJ I;  1KCT A;  2WXW A;  4P0O A;  1IMV A;  1XU8 A;  3T1P A;  5IO1 A;  4GA7 A;  4AU3 B;  3DRU A;  3EOX A;  3CWL A;  2PEF A; 
#chains in the Genus database with same CATH homology
 4RSQ A;  1PSI A;  4PYW A;  1AZX I;  1MTP A;  2B4X L;  1ANT I;  3KCG I;  4EB1 L;  3DRM A;  1OC0 A;  4G8R A;  2HI9 A;  2HIJ L;  4AJT A;  4ROB A;  2WXX A;  4AU3 A;  1B3K A;  3STO A;  1QMN A;  2WY0 C;  1OPH A;  2RIV A;  4KDS A;  1ATU A;  1C8O A;  4RO9 A;  4ZK0 A;  1DZH I;  2ARR A;  3CWM A;  1NQ9 I;  2WXZ C;  2ZNH A;  1LK6 I;  1OVA A;  3PZF A;  1BR8 I;  2CEO A;  4Y40 A;  4DY7 C;  3LW2 A;  5INW A;  2ACH A;  3EVJ I;  1AS4 A;  2ZV6 A;  1JTI A;  2OL2 A;  3CAA A;  1HLE A;  2H4R A;  1DZG L;  3UT3 A;  1WZ9 A;  2ANT I;  2XN5 A;  1LJ5 A;  1OVA B;  4IF8 A;  5CE0 A;  2XN6 A;  4X30 A;  2WXY C;  1E03 I;  4G8O A;  1XQJ A;  4C49 A;  4AFX A;  3NE4 A;  3DLW A;  4DTE A;  8API A;  1JJO C;  3NDD A;  4AU4 A;  3F1S A;  4IC0 A;  7API A;  1SEK A;  1OYH I;  1SR5 A;  2QUG A;  3FGQ A;  1R1L I;  4CAA A;  1ATT A;  3Q03 A;  4AJU A;  4P0F A;  2VDX A;  2B5T I;  1JMJ A;  4DY0 A;  4BB2 A;  4ROA A;  9PAI A;  2PEE A;  2XN3 A;  1QLP A;  2XN7 A;  4AQH A;  1HP7 A;  1JRR A;  1TB6 I;  5C98 A;  1T1F A;  1E04 I;  2BEH I;  3DY0 A;  1E05 I;  1IZ2 A;  1D5S A;  2V95 A;  5HGC A;  1DVN A;  1DZH L;  2WXZ A;  1QMB A;  2H4P A;  1ATH A;  1XQG A;  3LE2 A;  1C5G A;  3PB1 I;  2B4X I;  2RIW A;  3ZHA A;  1A7C A;  3VVJ A;  5EI0 A;  1F0C A;  2GD4 C;  1UHG A;  3F5N A;  2BEH L;  1SNG A;  3F02 A;  1OO8 A;  5BRR I;  2VH4 A;  3NDA A;  3R4L A;  1DB2 A;  4R9I A;  1LQ8 A;  3H5C A;  4ZK3 A;  2ARQ A;  1M93 B;  2DUT A;  1OVA C;  4Y3K A;  3CVM A;  2VDY A;  9API A;  5CDX A;  3Q02 A;  5CDZ A;  3OZQ A;  4C41 A;  1K9O I;  1OYH L;  1JMO A;  1BY7 A;  2D26 A;  1YXA A;  3NDF A;  3B9F I;  1DZG I;  4YIA A;  1DVM A;  1JVQ I;  2R9Y A;  2WY1 A;  2H4Q A;  4AU2 A;  2OAY A;  4EB1 I;  1EZX A;  2HIJ I;  1KCT A;  2WXW A;  4P0O A;  1IMV A;  1XU8 A;  3T1P A;  5IO1 A;  4GA7 A;  4AU3 B;  3DRU A;  3EOX A;  3CWL A;  2PEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...