4AIVA

Crystal structure of putative nadh-dependent nitrite reductase small subunit from mycobacterium tuberculosis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
DIQVWTTACAYDHLIPGRGVGVLLDDGSQVALFRLDDGSVHAVGNVDPFSGAAVMSRGIVGDRGGRAMVQSPILKQAFALDDGSCLDDPRVSVPVYPARVTPEGRIQVARVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Nird, the Small Subunit of the Nitrite Reductase Nirbd from Mycobacterium Tuberculosis, at 2.0 Angstrom Resolution
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords PROBABLE NITRITE REDUCTASE [NAD(P)H] SMALL SUBUNIT NIRD
total genus 21
structure length 113
sequence length 113
ec nomenclature ec 1.6.6.4: Transferred entry: 1.7.1.4.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13806 Rieske_2 Rieske-like [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4aivA00
3EQQA 1FQTA 2HMOA 3VCPA 2HMKA 1VCKA 1SQVE 2QJPC 5HL4A 1WQLA 1NTKE 2BCCE 4H13D 4NBCD 4H44D 1EZVE 2DE6D 4QDDA 1BE3E 3GB4A 1VF5D 3H1JE 4HM0A 4QUPA 1P84E 3GL2A 4PV1D 3GTEA 1L0LE 1RIEA 2JZAA 3GZXA 4HM3A 1SQBE 2DE7D 2E75D 2B24A 2FYNC 4HM1A 2XSHA 4HKVA 5KLIC 1O7MA 2YIUC 2YFLA 2BMQA 4QUQA 3L74E 2BMOA 2ZYLA 3CX5E 2QJKC 3BCCE 4P1CH 4AIVA 2NVEA 3N0QA 4U3FE 1PPJE 2A06E 3C0DA 4HM8A 3CXHE 2Q3WA 5CXMA 2QPZA 3AZCA 1ZRTE 1RFSA 1SJGA 2YVJB 1NDOA 1O7NA 2HMMA 2E4PA 4NBED 5AEWA 3H1KE 3GCEA 4HM5A 2YFIA 3H1IE 1EG9A 1SQQE 2FYUE 2I7FA 4H0LD 5KLVE 2B1XA 2DE5D 4NBFD 1Q90C 2GBWA 2NUMA 3L75E 3GKEA 4P1BH 2XSOA 2NUKA 2D2CD 1VM9A 3GTSA 3VMID 2E74D 3FOUA 4QDFA 2XR8A 1O7GA 4NBDD 1UUWA 3DQYA 4QCKA 2ZT9D 3D89A 3L73E 2HMLA 4QDCA 1NTZE 2E76D 1G8KB 1KB9E 5KKZC 4OGQD 2CKFA 4HM2A 2IBZE 3GL0A 3GZYA 4NB8D 1UUVA 4PD4E 2JO6A 3CWBE 3GOBA 4AAYB 3H1LE 2GBXA 4NBHD 4HM7A 3L71E 1SQPE 1ULJA 2YFJA 2NVGA 2NVFA 2BMRA 3L70E 1ULIA 2NWFA 4NBGD 4QDFB 2QJYC 4QURA 5AEUA 1G8JB 2HMNA 4NB9D 1PP9E 1O7PA 1O7WA 3VMGD 4NBBD 3H1HE 1NU1E 1BCCE 3VCAA 4HJLA 2HMJA 4HM4A 2XRXA 1NYKA 1SQXE 3VMHD 1O7HA 2E4QA 4EMJB 3L72E 1L0NE 4HM6A 1JM1A 1NTME 4NBAD 5BOKA 3EN1A 3TGUE 1KYOE
chains in the Genus database with same CATH superfamily
3EQQA 1FQTA 2HMOA 3VCPA 2HMKA 1VCKA 1SQVE 2QJPC 5HL4A 1WQLA 1NTKE 2BCCE 4H13D 4NBCD 4H44D 1EZVE 2DE6D 4QDDA 1BE3E 3GB4A 1VF5D 3H1JE 4HM0A 4QUPA 1P84E 3GL2A 4PV1D 3GTEA 1L0LE 1RIEA 2JZAA 3GZXA 4HM3A 1SQBE 2DE7D 2E75D 2B24A 2FYNC 4HM1A 2XSHA 4HKVA 5KLIC 1O7MA 2YIUC 2YFLA 2BMQA 4QUQA 3L74E 2BMOA 2ZYLA 3CX5E 2QJKC 3BCCE 4P1CH 4AIVA 2NVEA 3N0QA 4U3FE 1PPJE 2A06E 3C0DA 4HM8A 3CXHE 2Q3WA 5CXMA 2QPZA 3AZCA 1ZRTE 1RFSA 1SJGA 2YVJB 1NDOA 1O7NA 2HMMA 2E4PA 4NBED 5AEWA 3H1KE 3GCEA 4HM5A 2YFIA 3H1IE 1EG9A 1SQQE 2FYUE 2I7FA 4H0LD 5KLVE 2B1XA 2DE5D 4NBFD 1Q90C 2GBWA 2NUMA 3L75E 3GKEA 4P1BH 2XSOA 2NUKA 2D2CD 1VM9A 3GTSA 3VMID 2E74D 3FOUA 4QDFA 2XR8A 1O7GA 4NBDD 1UUWA 3DQYA 4QCKA 2ZT9D 3D89A 3L73E 2HMLA 4QDCA 1NTZE 2E76D 1G8KB 1KB9E 5KKZC 4OGQD 2CKFA 4HM2A 2IBZE 3GL0A 3GZYA 4NB8D 1UUVA 4PD4E 2JO6A 3CWBE 3GOBA 4AAYB 3H1LE 2GBXA 4NBHD 4HM7A 3L71E 1SQPE 1ULJA 2YFJA 2NVGA 2NVFA 2BMRA 3L70E 1ULIA 2NWFA 4NBGD 4QDFB 2QJYC 4QURA 5AEUA 1G8JB 2HMNA 4NB9D 1PP9E 1O7PA 1O7WA 3VMGD 4NBBD 3H1HE 1NU1E 1BCCE 3VCAA 4HJLA 2HMJA 4HM4A 2XRXA 1NYKA 1SQXE 3VMHD 1O7HA 2E4QA 4EMJB 3L72E 1L0NE 4HM6A 1JM1A 1NTME 4NBAD 5BOKA 3EN1A 3TGUE 1KYOE
chains in the Genus database with same CATH topology
3EQQA 1FQTA 2HMOA 3VCPA 2HMKA 1VCKA 1SQVE 2QJPC 5HL4A 1WQLA 1NTKE 2BCCE 4H13D 4NBCD 4H44D 1EZVE 2DE6D 4QDDA 1BE3E 3GB4A 1VF5D 3H1JE 4HM0A 4QUPA 1P84E 3GL2A 4PV1D 3GTEA 1L0LE 1RIEA 2JZAA 3GZXA 4HM3A 1SQBE 2DE7D 2E75D 2B24A 2FYNC 4HM1A 2XSHA 4HKVA 5KLIC 1O7MA 2YIUC 2YFLA 2BMQA 4QUQA 3L74E 2BMOA 2ZYLA 3CX5E 2QJKC 3BCCE 4P1CH 4AIVA 2NVEA 3N0QA 4U3FE 1PPJE 2A06E 3C0DA 4HM8A 3CXHE 2Q3WA 5CXMA 2QPZA 3AZCA 1ZRTE 1RFSA 1SJGA 2YVJB 1NDOA 1O7NA 2HMMA 2E4PA 4NBED 5AEWA 3H1KE 3GCEA 4HM5A 2YFIA 3H1IE 1EG9A 1SQQE 2FYUE 2I7FA 4H0LD 5KLVE 2B1XA 2DE5D 4NBFD 1Q90C 2GBWA 2NUMA 3L75E 3GKEA 4P1BH 2XSOA 2NUKA 2D2CD 1VM9A 3GTSA 3VMID 2E74D 3FOUA 4QDFA 2XR8A 1O7GA 4NBDD 1UUWA 3DQYA 4QCKA 2ZT9D 3D89A 3L73E 2HMLA 4QDCA 1NTZE 2E76D 1G8KB 1KB9E 5KKZC 4OGQD 2CKFA 4HM2A 2IBZE 3GL0A 3GZYA 4NB8D 1UUVA 4PD4E 2JO6A 3CWBE 3GOBA 4AAYB 3H1LE 2GBXA 4NBHD 4HM7A 3L71E 1SQPE 1ULJA 2YFJA 2NVGA 2NVFA 2BMRA 3L70E 1ULIA 2NWFA 4NBGD 4QDFB 2QJYC 4QURA 5AEUA 1G8JB 2HMNA 4NB9D 1PP9E 1O7PA 1O7WA 3VMGD 4NBBD 3H1HE 1NU1E 1BCCE 3VCAA 4HJLA 2HMJA 4HM4A 2XRXA 1NYKA 1SQXE 3VMHD 1O7HA 2E4QA 4EMJB 3L72E 1L0NE 4HM6A 1JM1A 1NTME 4NBAD 5BOKA 3EN1A 3TGUE 1KYOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQQ A;  1FQT A;  2HMO A;  3VCP A;  2HMK A;  1VCK A;  1SQV E;  2QJP C;  5HL4 A;  1WQL A;  1NTK E;  2BCC E;  4H13 D;  4NBC D;  4H44 D;  1EZV E;  2DE6 D;  4QDD A;  1BE3 E;  3GB4 A;  1VF5 D;  3H1J E;  4HM0 A;  4QUP A;  1P84 E;  3GL2 A;  4PV1 D;  3GTE A;  1L0L E;  1RIE A;  2JZA A;  3GZX A;  4HM3 A;  1SQB E;  2DE7 D;  2E75 D;  2B24 A;  2FYN C;  4HM1 A;  2XSH A;  4HKV A;  5KLI C;  1O7M A;  2YIU C;  2YFL A;  2BMQ A;  4QUQ A;  3L74 E;  2BMO A;  2ZYL A;  3CX5 E;  2QJK C;  3BCC E;  4P1C H;  4AIV A;  2NVE A;  3N0Q A;  4U3F E;  1PPJ E;  2A06 E;  3C0D A;  4HM8 A;  3CXH E;  2Q3W A;  5CXM A;  2QPZ A;  3AZC A;  1ZRT E;  1RFS A;  1SJG A;  2YVJ B;  1NDO A;  1O7N A;  2HMM A;  2E4P A;  4NBE D;  5AEW A;  3H1K E;  3GCE A;  4HM5 A;  2YFI A;  3H1I E;  1EG9 A;  1SQQ E;  2FYU E;  2I7F A;  4H0L D;  5KLV E;  2B1X A;  2DE5 D;  4NBF D;  1Q90 C;  2GBW A;  2NUM A;  3L75 E;  3GKE A;  4P1B H;  2XSO A;  2NUK A;  2D2C D;  1VM9 A;  3GTS A;  3VMI D;  2E74 D;  3FOU A;  4QDF A;  2XR8 A;  1O7G A;  4NBD D;  1UUW A;  3DQY A;  4QCK A;  2ZT9 D;  3D89 A;  3L73 E;  2HML A;  4QDC A;  1NTZ E;  2E76 D;  1G8K B;  1KB9 E;  5KKZ C;  4OGQ D;  2CKF A;  4HM2 A;  2IBZ E;  3GL0 A;  3GZY A;  4NB8 D;  1UUV A;  4PD4 E;  2JO6 A;  3CWB E;  3GOB A;  4AAY B;  3H1L E;  2GBX A;  4NBH D;  4HM7 A;  3L71 E;  1SQP E;  1ULJ A;  2YFJ A;  2NVG A;  2NVF A;  2BMR A;  3L70 E;  1ULI A;  2NWF A;  4NBG D;  4QDF B;  2QJY C;  4QUR A;  5AEU A;  1G8J B;  2HMN A;  4NB9 D;  1PP9 E;  1O7P A;  1O7W A;  3VMG D;  4NBB D;  3H1H E;  1NU1 E;  1BCC E;  3VCA A;  4HJL A;  2HMJ A;  4HM4 A;  2XRX A;  1NYK A;  1SQX E;  3VMH D;  1O7H A;  2E4Q A;  4EMJ B;  3L72 E;  1L0N E;  4HM6 A;  1JM1 A;  1NTM E;  4NBA D;  5BOK A;  3EN1 A;  3TGU E;  1KYO E; 
#chains in the Genus database with same CATH topology
 3EQQ A;  1FQT A;  2HMO A;  3VCP A;  2HMK A;  1VCK A;  1SQV E;  2QJP C;  5HL4 A;  1WQL A;  1NTK E;  2BCC E;  4H13 D;  4NBC D;  4H44 D;  1EZV E;  2DE6 D;  4QDD A;  1BE3 E;  3GB4 A;  1VF5 D;  3H1J E;  4HM0 A;  4QUP A;  1P84 E;  3GL2 A;  4PV1 D;  3GTE A;  1L0L E;  1RIE A;  2JZA A;  3GZX A;  4HM3 A;  1SQB E;  2DE7 D;  2E75 D;  2B24 A;  2FYN C;  4HM1 A;  2XSH A;  4HKV A;  5KLI C;  1O7M A;  2YIU C;  2YFL A;  2BMQ A;  4QUQ A;  3L74 E;  2BMO A;  2ZYL A;  3CX5 E;  2QJK C;  3BCC E;  4P1C H;  4AIV A;  2NVE A;  3N0Q A;  4U3F E;  1PPJ E;  2A06 E;  3C0D A;  4HM8 A;  3CXH E;  2Q3W A;  5CXM A;  2QPZ A;  3AZC A;  1ZRT E;  1RFS A;  1SJG A;  2YVJ B;  1NDO A;  1O7N A;  2HMM A;  2E4P A;  4NBE D;  5AEW A;  3H1K E;  3GCE A;  4HM5 A;  2YFI A;  3H1I E;  1EG9 A;  1SQQ E;  2FYU E;  2I7F A;  4H0L D;  5KLV E;  2B1X A;  2DE5 D;  4NBF D;  1Q90 C;  2GBW A;  2NUM A;  3L75 E;  3GKE A;  4P1B H;  2XSO A;  2NUK A;  2D2C D;  1VM9 A;  3GTS A;  3VMI D;  2E74 D;  3FOU A;  4QDF A;  2XR8 A;  1O7G A;  4NBD D;  1UUW A;  3DQY A;  4QCK A;  2ZT9 D;  3D89 A;  3L73 E;  2HML A;  4QDC A;  1NTZ E;  2E76 D;  1G8K B;  1KB9 E;  5KKZ C;  4OGQ D;  2CKF A;  4HM2 A;  2IBZ E;  3GL0 A;  3GZY A;  4NB8 D;  1UUV A;  4PD4 E;  2JO6 A;  3CWB E;  3GOB A;  4AAY B;  3H1L E;  2GBX A;  4NBH D;  4HM7 A;  3L71 E;  1SQP E;  1ULJ A;  2YFJ A;  2NVG A;  2NVF A;  2BMR A;  3L70 E;  1ULI A;  2NWF A;  4NBG D;  4QDF B;  2QJY C;  4QUR A;  5AEU A;  1G8J B;  2HMN A;  4NB9 D;  1PP9 E;  1O7P A;  1O7W A;  3VMG D;  4NBB D;  3H1H E;  1NU1 E;  1BCC E;  3VCA A;  4HJL A;  2HMJ A;  4HM4 A;  2XRX A;  1NYK A;  1SQX E;  3VMH D;  1O7H A;  2E4Q A;  4EMJ B;  3L72 E;  1L0N E;  4HM6 A;  1JM1 A;  1NTM E;  4NBA D;  5BOK A;  3EN1 A;  3TGU E;  1KYO E; 
#chains in the Genus database with same CATH homology
 3EQQ A;  1FQT A;  2HMO A;  3VCP A;  2HMK A;  1VCK A;  1SQV E;  2QJP C;  5HL4 A;  1WQL A;  1NTK E;  2BCC E;  4H13 D;  4NBC D;  4H44 D;  1EZV E;  2DE6 D;  4QDD A;  1BE3 E;  3GB4 A;  1VF5 D;  3H1J E;  4HM0 A;  4QUP A;  1P84 E;  3GL2 A;  4PV1 D;  3GTE A;  1L0L E;  1RIE A;  2JZA A;  3GZX A;  4HM3 A;  1SQB E;  2DE7 D;  2E75 D;  2B24 A;  2FYN C;  4HM1 A;  2XSH A;  4HKV A;  5KLI C;  1O7M A;  2YIU C;  2YFL A;  2BMQ A;  4QUQ A;  3L74 E;  2BMO A;  2ZYL A;  3CX5 E;  2QJK C;  3BCC E;  4P1C H;  4AIV A;  2NVE A;  3N0Q A;  4U3F E;  1PPJ E;  2A06 E;  3C0D A;  4HM8 A;  3CXH E;  2Q3W A;  5CXM A;  2QPZ A;  3AZC A;  1ZRT E;  1RFS A;  1SJG A;  2YVJ B;  1NDO A;  1O7N A;  2HMM A;  2E4P A;  4NBE D;  5AEW A;  3H1K E;  3GCE A;  4HM5 A;  2YFI A;  3H1I E;  1EG9 A;  1SQQ E;  2FYU E;  2I7F A;  4H0L D;  5KLV E;  2B1X A;  2DE5 D;  4NBF D;  1Q90 C;  2GBW A;  2NUM A;  3L75 E;  3GKE A;  4P1B H;  2XSO A;  2NUK A;  2D2C D;  1VM9 A;  3GTS A;  3VMI D;  2E74 D;  3FOU A;  4QDF A;  2XR8 A;  1O7G A;  4NBD D;  1UUW A;  3DQY A;  4QCK A;  2ZT9 D;  3D89 A;  3L73 E;  2HML A;  4QDC A;  1NTZ E;  2E76 D;  1G8K B;  1KB9 E;  5KKZ C;  4OGQ D;  2CKF A;  4HM2 A;  2IBZ E;  3GL0 A;  3GZY A;  4NB8 D;  1UUV A;  4PD4 E;  2JO6 A;  3CWB E;  3GOB A;  4AAY B;  3H1L E;  2GBX A;  4NBH D;  4HM7 A;  3L71 E;  1SQP E;  1ULJ A;  2YFJ A;  2NVG A;  2NVF A;  2BMR A;  3L70 E;  1ULI A;  2NWF A;  4NBG D;  4QDF B;  2QJY C;  4QUR A;  5AEU A;  1G8J B;  2HMN A;  4NB9 D;  1PP9 E;  1O7P A;  1O7W A;  3VMG D;  4NBB D;  3H1H E;  1NU1 E;  1BCC E;  3VCA A;  4HJL A;  2HMJ A;  4HM4 A;  2XRX A;  1NYK A;  1SQX E;  3VMH D;  1O7H A;  2E4Q A;  4EMJ B;  3L72 E;  1L0N E;  4HM6 A;  1JM1 A;  1NTM E;  4NBA D;  5BOK A;  3EN1 A;  3TGU E;  1KYO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...