4AK4A

High resolution structure of galactose binding lectin from champedak (cgb)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
GKAFDDGVFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGENHKSFITGFTPVKISLDFPSEYIMEVSGYTGKVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFSLPIENGLIVGFKGSIGYWLDYFSMYLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures and Binding Specificity of Galactose- and Mannose-Binding Lectins from Champedak: Differences from Jackfruit Lectins
pubmed doi rcsb
molecule keywords AGGLUTININ ALPHA CHAIN
molecule tags Sugar binding protein
total genus 29
structure length 133
sequence length 133
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2012-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 4ak4A00
3R52A 3LL1A 1UGYC 1TOQA 4PIUA 1UH0A 2BN0A 3MIVA 5J4XA 3VY6A 2JZ4A 4R6QA 1UGYA 1X1VA 2GUCA 4PITA 2BMZA 1XEZA 1ZGRA 1VBPA 1UGWC 3LLYA 4DDNA 4WOGA 3LKYA 1JACA 3VZFA 3WOCA 1UGWA 5J4TA 1PXDA 3MITA 1J4UA 3LLZA 4PIFA 1C3NA 1TP8A 3R50A 4MQ0A 1J4SA 2GTYA 1C3KA 2GUXA 1XXQA 1C3MA 4R6OA 2GUEA 5AV7A 3P8SA 2GUDA 3LL2A 1VBOA 5J50A 5J51A 1KUJA 3LL0A 3R51A 5EXGA 3VZEA 4AKDA 1WS4C 4AKCA 1OUWA 4AK4A 2NU5A 3WOBA 3VY7A 5BN6E 4PIKA 4R6NA 5JM1A 1WS4A 1UGXA 1UH1A 3APAA 1WS5C 4R6PA 1JOTA 3MIUA 4GX7A 4AKBA 1KU8A 1ZGSA 1M26A 1WS5A 2NUOA 2BMYA 3O44A 3VZGA 1XXRA 3LM1A 2HYRA 3AQGA 1J4TA 2HYQA 4R6RA
chains in the Genus database with same CATH superfamily
3R52A 3LL1A 1UGYC 1TOQA 4PIUA 4QX2A 1UH0A 2BN0A 4QX3A 3MIVA 5J4XA 3VY6A 2JZ4A 4ARYA 4R6QA 1UGYA 1X1VA 2GUCA 4PITA 2BMZA 1XEZA 1ZGRA 1VBPA 4W8JA 4MOAA 1UGWC 3LLYA 4DDNA 4WOGA 3LKYA 1JACA 3VZFA 3WOCA 1UGWA 5J4TA 1PXDA 3MITA 1J4UA 3LLZA 4PIFA 2C9KA 1C3NA 1TP8A 3R50A 4MQ0A 1J4SA 2GTYA 1C3KA 2GUXA 1XXQA 1C3MA 4R6OA 2GUEA 1CIYA 5AV7A 3P8SA 1VMOA 2GUDA 4ARXA 4QX1A 1DLCA 3LL2A 1VBOA 3TOWA 5J50A 1JI6A 5J51A 1KUJA 1I5PA 3LL0A 3R51A 5EXGA 3VZEA 4AKDA 4QX0A 1WS4C 4AKCA 1OUWA 2QP2A 4AK4A 2NU5A 3WOBA 3VY7A 5BN6E 4PIKA 4R6NA 5JM1A 1WS4A 1UGXA 1UH1A 3APAA 1WS5C 4D8MA 4R6PA 1W99A 1JOTA 3MIUA 4GX7A 4AKBA 1KU8A 1ZGSA 1M26A 1WS5A 2NUOA 2BMYA 3O44A 3VZGA 1XXRA 3LM1A 2HYRA 3AQGA 3EB7A 1J4TA 2HYQA 4R6RA
chains in the Genus database with same CATH topology
3R52A 3LL1A 1UGYC 1TOQA 4PIUA 1UH0A 2BN0A 3MIVA 5J4XA 3VY6A 2JZ4A 4R6QA 1UGYA 1X1VA 2GUCA 4PITA 2BMZA 1XEZA 1ZGRA 1VBPA 1UGWC 3LLYA 4DDNA 4WOGA 3LKYA 1JACA 3VZFA 3WOCA 1UGWA 5J4TA 1PXDA 3MITA 1J4UA 3LLZA 4PIFA 1C3NA 1TP8A 3R50A 4MQ0A 1J4SA 2GTYA 1C3KA 2GUXA 1XXQA 1C3MA 4R6OA 2GUEA 5AV7A 3P8SA 2GUDA 3LL2A 1VBOA 5J50A 5J51A 1KUJA 3LL0A 3R51A 5EXGA 3VZEA 4AKDA 1WS4C 4AKCA 1OUWA 4AK4A 2NU5A 3WOBA 3VY7A 5BN6E 4PIKA 4R6NA 5JM1A 1WS4A 1UGXA 1UH1A 3APAA 1WS5C 4R6PA 1JOTA 3MIUA 4GX7A 4AKBA 1KU8A 1ZGSA 1M26A 1WS5A 2NUOA 2BMYA 3O44A 3VZGA 1XXRA 3LM1A 2HYRA 3AQGA 1J4TA 2HYQA 4R6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R52 A;  3LL1 A;  1UGY C;  1TOQ A;  4PIU A;  1UH0 A;  2BN0 A;  3MIV A;  5J4X A;  3VY6 A;  2JZ4 A;  4R6Q A;  1UGY A;  1X1V A;  2GUC A;  4PIT A;  2BMZ A;  1XEZ A;  1ZGR A;  1VBP A;  1UGW C;  3LLY A;  4DDN A;  4WOG A;  3LKY A;  1JAC A;  3VZF A;  3WOC A;  1UGW A;  5J4T A;  1PXD A;  3MIT A;  1J4U A;  3LLZ A;  4PIF A;  1C3N A;  1TP8 A;  3R50 A;  4MQ0 A;  1J4S A;  2GTY A;  1C3K A;  2GUX A;  1XXQ A;  1C3M A;  4R6O A;  2GUE A;  5AV7 A;  3P8S A;  2GUD A;  3LL2 A;  1VBO A;  5J50 A;  5J51 A;  1KUJ A;  3LL0 A;  3R51 A;  5EXG A;  3VZE A;  4AKD A;  1WS4 C;  4AKC A;  1OUW A;  4AK4 A;  2NU5 A;  3WOB A;  3VY7 A;  5BN6 E;  4PIK A;  4R6N A;  5JM1 A;  1WS4 A;  1UGX A;  1UH1 A;  3APA A;  1WS5 C;  4R6P A;  1JOT A;  3MIU A;  4GX7 A;  4AKB A;  1KU8 A;  1ZGS A;  1M26 A;  1WS5 A;  2NUO A;  2BMY A;  3O44 A;  3VZG A;  1XXR A;  3LM1 A;  2HYR A;  3AQG A;  1J4T A;  2HYQ A;  4R6R A; 
#chains in the Genus database with same CATH topology
 3R52 A;  3LL1 A;  1UGY C;  1TOQ A;  4PIU A;  4QX2 A;  1UH0 A;  2BN0 A;  4QX3 A;  3MIV A;  5J4X A;  3VY6 A;  2JZ4 A;  4ARY A;  4R6Q A;  1UGY A;  1X1V A;  2GUC A;  4PIT A;  2BMZ A;  1XEZ A;  1ZGR A;  1VBP A;  4W8J A;  4MOA A;  1UGW C;  3LLY A;  4DDN A;  4WOG A;  3LKY A;  1JAC A;  3VZF A;  3WOC A;  1UGW A;  5J4T A;  1PXD A;  3MIT A;  1J4U A;  3LLZ A;  4PIF A;  2C9K A;  1C3N A;  1TP8 A;  3R50 A;  4MQ0 A;  1J4S A;  2GTY A;  1C3K A;  2GUX A;  1XXQ A;  1C3M A;  4R6O A;  2GUE A;  1CIY A;  5AV7 A;  3P8S A;  1VMO A;  2GUD A;  4ARX A;  4QX1 A;  1DLC A;  3LL2 A;  1VBO A;  3TOW A;  5J50 A;  1JI6 A;  5J51 A;  1KUJ A;  1I5P A;  3LL0 A;  3R51 A;  5EXG A;  3VZE A;  4AKD A;  4QX0 A;  1WS4 C;  4AKC A;  1OUW A;  2QP2 A;  4AK4 A;  2NU5 A;  3WOB A;  3VY7 A;  5BN6 E;  4PIK A;  4R6N A;  5JM1 A;  1WS4 A;  1UGX A;  1UH1 A;  3APA A;  1WS5 C;  4D8M A;  4R6P A;  1W99 A;  1JOT A;  3MIU A;  4GX7 A;  4AKB A;  1KU8 A;  1ZGS A;  1M26 A;  1WS5 A;  2NUO A;  2BMY A;  3O44 A;  3VZG A;  1XXR A;  3LM1 A;  2HYR A;  3AQG A;  3EB7 A;  1J4T A;  2HYQ A;  4R6R A; 
#chains in the Genus database with same CATH homology
 3R52 A;  3LL1 A;  1UGY C;  1TOQ A;  4PIU A;  1UH0 A;  2BN0 A;  3MIV A;  5J4X A;  3VY6 A;  2JZ4 A;  4R6Q A;  1UGY A;  1X1V A;  2GUC A;  4PIT A;  2BMZ A;  1XEZ A;  1ZGR A;  1VBP A;  1UGW C;  3LLY A;  4DDN A;  4WOG A;  3LKY A;  1JAC A;  3VZF A;  3WOC A;  1UGW A;  5J4T A;  1PXD A;  3MIT A;  1J4U A;  3LLZ A;  4PIF A;  1C3N A;  1TP8 A;  3R50 A;  4MQ0 A;  1J4S A;  2GTY A;  1C3K A;  2GUX A;  1XXQ A;  1C3M A;  4R6O A;  2GUE A;  5AV7 A;  3P8S A;  2GUD A;  3LL2 A;  1VBO A;  5J50 A;  5J51 A;  1KUJ A;  3LL0 A;  3R51 A;  5EXG A;  3VZE A;  4AKD A;  1WS4 C;  4AKC A;  1OUW A;  4AK4 A;  2NU5 A;  3WOB A;  3VY7 A;  5BN6 E;  4PIK A;  4R6N A;  5JM1 A;  1WS4 A;  1UGX A;  1UH1 A;  3APA A;  1WS5 C;  4R6P A;  1JOT A;  3MIU A;  4GX7 A;  4AKB A;  1KU8 A;  1ZGS A;  1M26 A;  1WS5 A;  2NUO A;  2BMY A;  3O44 A;  3VZG A;  1XXR A;  3LM1 A;  2HYR A;  3AQG A;  1J4T A;  2HYQ A;  4R6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...