4AKCA

Structure of galactose binding lectin from champedak (cgb) with gal(beta)1,3-galnac
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGENHKSFITGFTPVKISLDFPSEYIMEVSGYTGKVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFSLPIENGLIVGFKGSIGYWLDYFSMYLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures and Binding Specificity of Galactose- and Mannose-Binding Lectins from Champedak: Differences from Jackfruit Lectins
pubmed doi rcsb
molecule keywords AGGLUTININ ALPHA CHAIN
molecule tags Sugar binding protein
total genus 29
structure length 133
sequence length 133
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 4akcA00
4R6NA 1TOQA 1WS5A 3LL0A 3MIUA 1XXQA 1UGWC 4R6OA 4R6PA 1JOTA 1C3NA 4PIFA 1C3MA 1UGWA 1ZGSA 3VY6A 4AKBA 2NU5A 2GTYA 1J4UA 4GX7A 3AQGA 3LL2A 4AKCA 4PIKA 1KUJA 2NUOA 1UGXA 1KU8A 4MQ0A 4AK4A 5BN6E 1OUWA 5J4XA 3O44A 1WS4C 3APAA 3LLYA 3R52A 3VZFA 5J4TA 4WOGA 4R6RA 3R50A 1C3KA 1WS4A 3LM1A 1J4SA 3VZEA 4DDNA 3LL1A 3LLZA 5J51A 3LKYA 3P8SA 4R6QA 3MIVA 2BMZA 1TP8A 2GUXA 4PIUA 1UGYC 1J4TA 5JM1A 1UGYA 4PITA 1UH0A 5J50A 2GUDA 2JZ4A 5EXGA 2GUEA 3WOCA 3R51A 2BN0A 3VZGA 2HYRA 4AKDA 1X1VA 2HYQA 1M26A 1JACA 1UH1A 1XEZA 1VBOA 2GUCA 3VY7A 3WOBA 2BMYA 1PXDA 1VBPA 1ZGRA 3MITA 5AV7A 1WS5C 1XXRA
chains in the Genus database with same CATH superfamily
2C9KA 4R6NA 4QX0A 1TOQA 1WS5A 3LL0A 4D8MA 1VMOA 3MIUA 1XXQA 1UGWC 4R6OA 4R6PA 1W99A 4MOAA 1CIYA 1JOTA 4ARXA 1C3NA 4PIFA 1C3MA 1UGWA 1ZGSA 3VY6A 4AKBA 4QX1A 2NU5A 2GTYA 1J4UA 4GX7A 3AQGA 3LL2A 4AKCA 4PIKA 1JI6A 1KUJA 2NUOA 1UGXA 1KU8A 4MQ0A 4AK4A 5BN6E 1OUWA 5J4XA 3O44A 1WS4C 3APAA 3LLYA 3R52A 3VZFA 5J4TA 4WOGA 4R6RA 3R50A 1C3KA 1WS4A 3LM1A 1J4SA 3VZEA 4DDNA 3LL1A 3LLZA 5J51A 4QX2A 3LKYA 3P8SA 4R6QA 3MIVA 2BMZA 1TP8A 4ARYA 2GUXA 4PIUA 1UGYC 1J4TA 5JM1A 1UGYA 3TOWA 4PITA 1I5PA 1UH0A 1DLCA 5J50A 2GUDA 2JZ4A 2GUEA 5EXGA 3WOCA 3R51A 2BN0A 3EB7A 3VZGA 2HYRA 4AKDA 1X1VA 2HYQA 1M26A 1JACA 1UH1A 2QP2A 1XEZA 4QX3A 1VBOA 2GUCA 3VY7A 3WOBA 2BMYA 1PXDA 1VBPA 1ZGRA 3MITA 4W8JA 5AV7A 1WS5C 1XXRA
chains in the Genus database with same CATH topology
4R6NA 1TOQA 1WS5A 3LL0A 3MIUA 1XXQA 1UGWC 4R6OA 4R6PA 1JOTA 1C3NA 4PIFA 1C3MA 1UGWA 1ZGSA 3VY6A 4AKBA 2NU5A 2GTYA 1J4UA 4GX7A 3AQGA 3LL2A 4AKCA 4PIKA 1KUJA 2NUOA 1UGXA 1KU8A 4MQ0A 4AK4A 5BN6E 1OUWA 5J4XA 3O44A 1WS4C 3APAA 3LLYA 3R52A 3VZFA 5J4TA 4WOGA 4R6RA 3R50A 1C3KA 1WS4A 3LM1A 1J4SA 3VZEA 4DDNA 3LL1A 3LLZA 5J51A 3LKYA 3P8SA 4R6QA 3MIVA 2BMZA 1TP8A 2GUXA 4PIUA 1UGYC 1J4TA 5JM1A 1UGYA 4PITA 1UH0A 5J50A 2GUDA 2JZ4A 5EXGA 2GUEA 3WOCA 3R51A 2BN0A 3VZGA 2HYRA 4AKDA 1X1VA 2HYQA 1M26A 1JACA 1UH1A 1XEZA 1VBOA 2GUCA 3VY7A 3WOBA 2BMYA 1PXDA 1VBPA 1ZGRA 3MITA 5AV7A 1WS5C 1XXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6N A;  1TOQ A;  1WS5 A;  3LL0 A;  3MIU A;  1XXQ A;  1UGW C;  4R6O A;  4R6P A;  1JOT A;  1C3N A;  4PIF A;  1C3M A;  1UGW A;  1ZGS A;  3VY6 A;  4AKB A;  2NU5 A;  2GTY A;  1J4U A;  4GX7 A;  3AQG A;  3LL2 A;  4AKC A;  4PIK A;  1KUJ A;  2NUO A;  1UGX A;  1KU8 A;  4MQ0 A;  4AK4 A;  5BN6 E;  1OUW A;  5J4X A;  3O44 A;  1WS4 C;  3APA A;  3LLY A;  3R52 A;  3VZF A;  5J4T A;  4WOG A;  4R6R A;  3R50 A;  1C3K A;  1WS4 A;  3LM1 A;  1J4S A;  3VZE A;  4DDN A;  3LL1 A;  3LLZ A;  5J51 A;  3LKY A;  3P8S A;  4R6Q A;  3MIV A;  2BMZ A;  1TP8 A;  2GUX A;  4PIU A;  1UGY C;  1J4T A;  5JM1 A;  1UGY A;  4PIT A;  1UH0 A;  5J50 A;  2GUD A;  2JZ4 A;  5EXG A;  2GUE A;  3WOC A;  3R51 A;  2BN0 A;  3VZG A;  2HYR A;  4AKD A;  1X1V A;  2HYQ A;  1M26 A;  1JAC A;  1UH1 A;  1XEZ A;  1VBO A;  2GUC A;  3VY7 A;  3WOB A;  2BMY A;  1PXD A;  1VBP A;  1ZGR A;  3MIT A;  5AV7 A;  1WS5 C;  1XXR A; 
#chains in the Genus database with same CATH topology
 2C9K A;  4R6N A;  4QX0 A;  1TOQ A;  1WS5 A;  3LL0 A;  4D8M A;  1VMO A;  3MIU A;  1XXQ A;  1UGW C;  4R6O A;  4R6P A;  1W99 A;  4MOA A;  1CIY A;  1JOT A;  4ARX A;  1C3N A;  4PIF A;  1C3M A;  1UGW A;  1ZGS A;  3VY6 A;  4AKB A;  4QX1 A;  2NU5 A;  2GTY A;  1J4U A;  4GX7 A;  3AQG A;  3LL2 A;  4AKC A;  4PIK A;  1JI6 A;  1KUJ A;  2NUO A;  1UGX A;  1KU8 A;  4MQ0 A;  4AK4 A;  5BN6 E;  1OUW A;  5J4X A;  3O44 A;  1WS4 C;  3APA A;  3LLY A;  3R52 A;  3VZF A;  5J4T A;  4WOG A;  4R6R A;  3R50 A;  1C3K A;  1WS4 A;  3LM1 A;  1J4S A;  3VZE A;  4DDN A;  3LL1 A;  3LLZ A;  5J51 A;  4QX2 A;  3LKY A;  3P8S A;  4R6Q A;  3MIV A;  2BMZ A;  1TP8 A;  4ARY A;  2GUX A;  4PIU A;  1UGY C;  1J4T A;  5JM1 A;  1UGY A;  3TOW A;  4PIT A;  1I5P A;  1UH0 A;  1DLC A;  5J50 A;  2GUD A;  2JZ4 A;  2GUE A;  5EXG A;  3WOC A;  3R51 A;  2BN0 A;  3EB7 A;  3VZG A;  2HYR A;  4AKD A;  1X1V A;  2HYQ A;  1M26 A;  1JAC A;  1UH1 A;  2QP2 A;  1XEZ A;  4QX3 A;  1VBO A;  2GUC A;  3VY7 A;  3WOB A;  2BMY A;  1PXD A;  1VBP A;  1ZGR A;  3MIT A;  4W8J A;  5AV7 A;  1WS5 C;  1XXR A; 
#chains in the Genus database with same CATH homology
 4R6N A;  1TOQ A;  1WS5 A;  3LL0 A;  3MIU A;  1XXQ A;  1UGW C;  4R6O A;  4R6P A;  1JOT A;  1C3N A;  4PIF A;  1C3M A;  1UGW A;  1ZGS A;  3VY6 A;  4AKB A;  2NU5 A;  2GTY A;  1J4U A;  4GX7 A;  3AQG A;  3LL2 A;  4AKC A;  4PIK A;  1KUJ A;  2NUO A;  1UGX A;  1KU8 A;  4MQ0 A;  4AK4 A;  5BN6 E;  1OUW A;  5J4X A;  3O44 A;  1WS4 C;  3APA A;  3LLY A;  3R52 A;  3VZF A;  5J4T A;  4WOG A;  4R6R A;  3R50 A;  1C3K A;  1WS4 A;  3LM1 A;  1J4S A;  3VZE A;  4DDN A;  3LL1 A;  3LLZ A;  5J51 A;  3LKY A;  3P8S A;  4R6Q A;  3MIV A;  2BMZ A;  1TP8 A;  2GUX A;  4PIU A;  1UGY C;  1J4T A;  5JM1 A;  1UGY A;  4PIT A;  1UH0 A;  5J50 A;  2GUD A;  2JZ4 A;  5EXG A;  2GUE A;  3WOC A;  3R51 A;  2BN0 A;  3VZG A;  2HYR A;  4AKD A;  1X1V A;  2HYQ A;  1M26 A;  1JAC A;  1UH1 A;  1XEZ A;  1VBO A;  2GUC A;  3VY7 A;  3WOB A;  2BMY A;  1PXD A;  1VBP A;  1ZGR A;  3MIT A;  5AV7 A;  1WS5 C;  1XXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...