4AKDA

High resolution structure of mannose binding lectin from champedak (cmb)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
150
Chain Sequence
MASQTITVGPWGGSGGNGWDDGSYTGIRQIELSYKEAIGSFCVIYDLNGESFPGPKHTSKLPYKNVKIELQFPEEFLVSVSGYTGPFSALATPTPVVRSLTFKTNKGRTFGPYGDEEGTYFNLPIENGLIVGFKGRTGDLLDAIGVHMAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures and Binding Specificity of Galactose- and Mannose-Binding Lectins from Champedak: Differences from Jackfruit Lectins
pubmed doi rcsb
molecule keywords MANNOSE-SPECIFIC LECTIN KM+
molecule tags Sugar binding protein
total genus 30
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 4akdA00
1TP8A 1C3NA 3VY6A 1M26A 2NUOA 1WS4C 3LLYA 2GUXA 2BMYA 1X1VA 3AQGA 4DDNA 3LLZA 4AK4A 1KU8A 5J4TA 3WOCA 3R52A 2GUCA 3VY7A 1VBPA 3VZEA 1UH1A 1UGWA 3LM1A 4R6PA 3LL1A 4PITA 1XEZA 1KUJA 3WOBA 2HYQA 1ZGSA 4PIUA 1XXRA 3R50A 2HYRA 5J51A 1ZGRA 2GTYA 2JZ4A 4AKBA 3MIVA 1J4UA 3MIUA 5J50A 1UGWC 3LKYA 3LL2A 5JM1A 1UH0A 4R6NA 4WOGA 2BMZA 1JACA 1C3MA 3O44A 5EXGA 5J4XA 2BN0A 1UGYA 1JOTA 3R51A 4MQ0A 1XXQA 1TOQA 1OUWA 1VBOA 4PIKA 2GUEA 4AKCA 1WS5A 3VZFA 2GUDA 1WS4A 4GX7A 3APAA 1UGXA 3P8SA 1UGYC 5AV7A 1PXDA 1J4SA 4R6QA 4PIFA 4AKDA 5BN6E 1C3KA 3VZGA 3MITA 3LL0A 4R6OA 2NU5A 1WS5C 4R6RA 1J4TA
chains in the Genus database with same CATH superfamily
1TP8A 1C3NA 3VY6A 4ARYA 1M26A 2NUOA 1WS4C 3LLYA 2GUXA 2BMYA 1X1VA 3AQGA 4DDNA 3LLZA 4AK4A 1KU8A 5J4TA 3WOCA 1DLCA 2C9KA 3R52A 2GUCA 3VY7A 1VBPA 3VZEA 1UH1A 1UGWA 3LM1A 4R6PA 3LL1A 4PITA 1I5PA 1XEZA 1W99A 1KUJA 3EB7A 3WOBA 2HYQA 1ZGSA 4PIUA 1XXRA 4R6RA 3R50A 2HYRA 5J51A 1ZGRA 2GTYA 2JZ4A 4AKBA 3MIVA 1J4UA 3MIUA 5J50A 1UGWC 3TOWA 3LKYA 3LL2A 5JM1A 1UH0A 1CIYA 4R6NA 4WOGA 2BMZA 1JACA 1JI6A 1C3MA 2QP2A 3O44A 5EXGA 5J4XA 2BN0A 1UGYA 1JOTA 3R51A 4MQ0A 1XXQA 1TOQA 1OUWA 1VBOA 4PIKA 4QX2A 4QX0A 4W8JA 2GUEA 4AKCA 1WS5A 1VMOA 4QX3A 3VZFA 2GUDA 1WS4A 4GX7A 3APAA 4QX1A 1UGXA 3P8SA 1UGYC 5AV7A 1PXDA 1J4SA 4R6QA 4D8MA 4PIFA 4MOAA 4AKDA 5BN6E 1C3KA 3VZGA 4ARXA 3MITA 3LL0A 4R6OA 2NU5A 1WS5C 1J4TA
chains in the Genus database with same CATH topology
1TP8A 1C3NA 3VY6A 1M26A 2NUOA 1WS4C 3LLYA 2GUXA 2BMYA 1X1VA 3AQGA 4DDNA 3LLZA 4AK4A 1KU8A 5J4TA 3WOCA 3R52A 2GUCA 3VY7A 1VBPA 3VZEA 1UH1A 1UGWA 3LM1A 4R6PA 3LL1A 4PITA 1XEZA 1KUJA 3WOBA 2HYQA 1ZGSA 4PIUA 1XXRA 3R50A 2HYRA 5J51A 1ZGRA 2GTYA 2JZ4A 4AKBA 3MIVA 1J4UA 3MIUA 5J50A 1UGWC 3LKYA 3LL2A 5JM1A 1UH0A 4R6NA 4WOGA 2BMZA 1JACA 1C3MA 3O44A 5EXGA 5J4XA 2BN0A 1UGYA 1JOTA 3R51A 4MQ0A 1XXQA 1TOQA 1OUWA 1VBOA 4PIKA 2GUEA 4AKCA 1WS5A 3VZFA 2GUDA 1WS4A 4GX7A 3APAA 1UGXA 3P8SA 1UGYC 5AV7A 1PXDA 1J4SA 4R6QA 4PIFA 4AKDA 5BN6E 1C3KA 3VZGA 3MITA 3LL0A 4R6OA 2NU5A 1WS5C 4R6RA 1J4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TP8 A;  1C3N A;  3VY6 A;  1M26 A;  2NUO A;  1WS4 C;  3LLY A;  2GUX A;  2BMY A;  1X1V A;  3AQG A;  4DDN A;  3LLZ A;  4AK4 A;  1KU8 A;  5J4T A;  3WOC A;  3R52 A;  2GUC A;  3VY7 A;  1VBP A;  3VZE A;  1UH1 A;  1UGW A;  3LM1 A;  4R6P A;  3LL1 A;  4PIT A;  1XEZ A;  1KUJ A;  3WOB A;  2HYQ A;  1ZGS A;  4PIU A;  1XXR A;  3R50 A;  2HYR A;  5J51 A;  1ZGR A;  2GTY A;  2JZ4 A;  4AKB A;  3MIV A;  1J4U A;  3MIU A;  5J50 A;  1UGW C;  3LKY A;  3LL2 A;  5JM1 A;  1UH0 A;  4R6N A;  4WOG A;  2BMZ A;  1JAC A;  1C3M A;  3O44 A;  5EXG A;  5J4X A;  2BN0 A;  1UGY A;  1JOT A;  3R51 A;  4MQ0 A;  1XXQ A;  1TOQ A;  1OUW A;  1VBO A;  4PIK A;  2GUE A;  4AKC A;  1WS5 A;  3VZF A;  2GUD A;  1WS4 A;  4GX7 A;  3APA A;  1UGX A;  3P8S A;  1UGY C;  5AV7 A;  1PXD A;  1J4S A;  4R6Q A;  4PIF A;  4AKD A;  5BN6 E;  1C3K A;  3VZG A;  3MIT A;  3LL0 A;  4R6O A;  2NU5 A;  1WS5 C;  4R6R A;  1J4T A; 
#chains in the Genus database with same CATH topology
 1TP8 A;  1C3N A;  3VY6 A;  4ARY A;  1M26 A;  2NUO A;  1WS4 C;  3LLY A;  2GUX A;  2BMY A;  1X1V A;  3AQG A;  4DDN A;  3LLZ A;  4AK4 A;  1KU8 A;  5J4T A;  3WOC A;  1DLC A;  2C9K A;  3R52 A;  2GUC A;  3VY7 A;  1VBP A;  3VZE A;  1UH1 A;  1UGW A;  3LM1 A;  4R6P A;  3LL1 A;  4PIT A;  1I5P A;  1XEZ A;  1W99 A;  1KUJ A;  3EB7 A;  3WOB A;  2HYQ A;  1ZGS A;  4PIU A;  1XXR A;  4R6R A;  3R50 A;  2HYR A;  5J51 A;  1ZGR A;  2GTY A;  2JZ4 A;  4AKB A;  3MIV A;  1J4U A;  3MIU A;  5J50 A;  1UGW C;  3TOW A;  3LKY A;  3LL2 A;  5JM1 A;  1UH0 A;  1CIY A;  4R6N A;  4WOG A;  2BMZ A;  1JAC A;  1JI6 A;  1C3M A;  2QP2 A;  3O44 A;  5EXG A;  5J4X A;  2BN0 A;  1UGY A;  1JOT A;  3R51 A;  4MQ0 A;  1XXQ A;  1TOQ A;  1OUW A;  1VBO A;  4PIK A;  4QX2 A;  4QX0 A;  4W8J A;  2GUE A;  4AKC A;  1WS5 A;  1VMO A;  4QX3 A;  3VZF A;  2GUD A;  1WS4 A;  4GX7 A;  3APA A;  4QX1 A;  1UGX A;  3P8S A;  1UGY C;  5AV7 A;  1PXD A;  1J4S A;  4R6Q A;  4D8M A;  4PIF A;  4MOA A;  4AKD A;  5BN6 E;  1C3K A;  3VZG A;  4ARX A;  3MIT A;  3LL0 A;  4R6O A;  2NU5 A;  1WS5 C;  1J4T A; 
#chains in the Genus database with same CATH homology
 1TP8 A;  1C3N A;  3VY6 A;  1M26 A;  2NUO A;  1WS4 C;  3LLY A;  2GUX A;  2BMY A;  1X1V A;  3AQG A;  4DDN A;  3LLZ A;  4AK4 A;  1KU8 A;  5J4T A;  3WOC A;  3R52 A;  2GUC A;  3VY7 A;  1VBP A;  3VZE A;  1UH1 A;  1UGW A;  3LM1 A;  4R6P A;  3LL1 A;  4PIT A;  1XEZ A;  1KUJ A;  3WOB A;  2HYQ A;  1ZGS A;  4PIU A;  1XXR A;  3R50 A;  2HYR A;  5J51 A;  1ZGR A;  2GTY A;  2JZ4 A;  4AKB A;  3MIV A;  1J4U A;  3MIU A;  5J50 A;  1UGW C;  3LKY A;  3LL2 A;  5JM1 A;  1UH0 A;  4R6N A;  4WOG A;  2BMZ A;  1JAC A;  1C3M A;  3O44 A;  5EXG A;  5J4X A;  2BN0 A;  1UGY A;  1JOT A;  3R51 A;  4MQ0 A;  1XXQ A;  1TOQ A;  1OUW A;  1VBO A;  4PIK A;  2GUE A;  4AKC A;  1WS5 A;  3VZF A;  2GUD A;  1WS4 A;  4GX7 A;  3APA A;  1UGX A;  3P8S A;  1UGY C;  5AV7 A;  1PXD A;  1J4S A;  4R6Q A;  4PIF A;  4AKD A;  5BN6 E;  1C3K A;  3VZG A;  3MIT A;  3LL0 A;  4R6O A;  2NU5 A;  1WS5 C;  4R6R A;  1J4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...