4AKVA

Crystal structure of human sorting nexin 33 (snx33)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
363
structure length
345
Chain Sequence
MYSIEMGPRGPQWKANPHPFACSVEDPISYKLTPTHAASPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQEDFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLLTFQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSTVASELVRKHVGGFRKEFQKLGSAFQAISHSFQMDPPFCSEALNSAISHTGRTYEAIGEMFAEQPKNDLFQMLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRVGQQLEKTLRMYDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human Sorting Nexin 33
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords SORTING NEXIN-33
total genus 140
structure length 345
sequence length 363
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4akvA02
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 4akvA01
1I49A 2V6VA 3CAZA 2WWEA 4FZSA 1OCSA 2L73A 1X04A 1O7KA 2RAKA 1URUA 4IKBA 1WDZA 4H8SA 3QNIA 3QWEA 3HAHA 3ABHA 1Y2OA 2Z0VA 2ETTA 2AR5A 1KMDA 4HASA 3IQ2A 4ATMA 3DYTA 3M3WA 4P2IA 2V14A 4OXWA 3HPCX 2D4CA 2FICA 3FOGA 4PZGA 1I4TA 3HPBA 2Z0NA 4NQIA 1I4DA 2CSKA 1X03A 2C08A 2ELBA 4WPCA 3LUIA 2X3XA 2YKTA 3LLLA 4P2JA 3P0CA 4IKBB 2EFLA 5C5BB 2X3WA 1XTEA 5C5BA 2RAIA 3Q0KA 4BNEA 3PLTA 3Q84A 1OCUA 1I4LA 4BGJA 2D1LA 4ON3A 2Q13A 3OK8A 4PQOA 4WPEA 2REAA 4IKDA 2Z0OA 3SOGA 2X3VA 1GD5A 4NSWA 2EFKA 4AZ9A 2REDA 2RAJA 4DCNC 4PQPA 2DYBA 4DYLA 2Q12A 2I4KA 3ACOA 4AKVA 2CZOA 4AVMA 1ZWWA 1H6HA 3I2WA 1KQ6A 3HAJA 3QE6A 3SYVA 2YPSA 2V0OA 4I1QA 1XTNA 3HAIA 3G9GA 2IWLX
chains in the Genus database with same CATH superfamily
2YIAA 4AZ5A 2L73A 3CZNA 4HR1A 3BUIA 4IW0A 4AZ7A 1WDZA 2WYHA 3ABHA 4FM3A 4KIKA 2Z0VA 4JLCA 1E1DA 4EZQA 2ND1A 1HWWA 3IQ2A 4G6QA 2FYVA 3M3WA 4P2IA 2D4CA 2YL5A 2FICA 3B52X 3HPBA 4R5GA 2OBLA 2CSKA 4AZGA 4EZNA 4M0MA 4HR1B 2Z8YA 2NCZA 3ER8C 5C5BA 4UDXX 1TQUA 1R33A 4EZZA 3Q84A 2YLAA 4BGJA 2EX3B 4ON3A 2Q13A 3OHXM 4PQOA 4H6IA 3A98A 4WPEA 2N3KA 2Z0OA 4F01A 1TQWA 1PS3A 4PQPA 1HXKA 2YI9A 4EZXA 2OZNB 3T49A 3RPMA 4R5IA 3BLBA 3O3OB 2YPSA 2V0OA 3DDGA 2GA9D 5FLEX 3D50A 3CVRA 1XTNA 1GNTA 1DKZA 2QFFA 3QA8A 3DPOA 3EJSA 2LXYA 2RAKA 4IKBA 3I01A 3L3PA 4H8SA 3CZSA 4AZCB 3D52A 3HAHA 4EZRA 3BVWA 4FZPA 1Y2OA 1TQSA 2ALWA 3KDRA 2AR5A 4R5JA 4HASA 2PMRA 3BUDA 3DX0A 3VKHA 4OXWA 3RV1A 2F7RA 2ND0A 2F1AA 4EZSA 3FOGA 2YIBA 3QNJA 3T4AG 1I4DA 4JNFA 1U00A 1X03A 4JWIA 4H6HA 3LUIA 3BUPA 3LLLA 4P2JA 2GAFD 4IKBB 4D8JA 3FD9A 3CKDA 2RAIA 3BVXA 4EZWA 4HY9A 1O7DB 4JNEA 1OCUA 3VEAA 2D1LA 1DKYA 3DX3A 1YWMA 2REAA 4IKDA 3D2EA 2YL9A 4NSWA 4AZ9A 3KAVA 2REDA 2DYBA 4EZOA 4JWCA 3T47A 4DYLA 3D51A 2RT6A 1SU6A 1ZWWA 2ZXQA 1LQ7A 3DX2A 3HAJA 3SYVA 4PO2A 2OO2A 4JN4A 4I1QA 4AZIA 4EZYA 2YLLA 2V6VA 4JWEA 2WWEA 3CV5A 4FZSA 1OCSA 1X04A 1SU8A 3VEBA 3QNIA 3QWEA 3EJUA 3D4YA 3D4ZA 4EZVA 1TQTA 4KIKB 3DPPA 4AZCA 5E84A 4ATMA 3ERCC 3HPCX 4AZHA 4NQIA 3T48A 1R34A 1OA0A 2PY6A 2C08A 1OAOA 1JQKA 3ER9B 2X3XA 3DDFA 3F7WA 2EFLA 5C5BB 1ZYLA 2X3WA 1XTEA 4JL9A 3Q0KA 3I39X 4BNEA 4F00A 3PLTA 1I4LA 2QKWA 3L3OM 1QX1A 3DX1A 4R5KA 2EWFA 2MI7A 2YL8A 2X3VA 1GD5A 2GF4A 2EFKA 2WINM 4IWPA 3B53X 2O0I1 2RAJA 3LMFA 3OWGA 2Q12A 2JNSA 3ACOA 4AKVA 4AVMA 1H6HA 3I2WA 3GI7A 3DPQA 1MJGA 3BVUA 1SU7A 3HAIA 3G9GA 1R5EA 1I49A 3CAZA 1W9MA 1E9VA 5TKYA 3EJTA 1O7KA 1URUA 2KHOA 3I04A 1DKXA 4NPHA 3DX4A 3EJQA 2ETTA 2YL6A 2QXLA 3RV0A 2X5CA 3BVTA 1KMDA 2F7QA 2JNKA 2YI8A 4JWDA 3DYTA 2V14A 4EZUA 1SUFA 1HTYA 4B9QA 4PZGA 1I4TA 1O7DC 4IM0A 1GNLA 4E3CA 2Z0NA 3BUBA 3C7NA 3LVTA 2ELBA 3BVVA 3O3MB 4WPCA 3T46A 2YKTA 3P0CA 3D2FA 4HYBA 2OW7A 3ZEDA 3KAWA 4IM3A 2WYIA 4IM2A 1TQVA 1QWNA 3OK8A 4EZTA 2YIVX 4AZBA 3EJPA 4UDYX 4EZPA 1UPXA 2F18A 1OA1A 3O3NB 3SOGA 2OBMA 2F7PA 4IWOA 1GN9A 4DCNC 4R5LA 5KBPA 4AZ6A 4IWQA 3EJRA 2I4KA 3BUQA 2LM0A 2CZOA 1KQ6A 1QWUA 1E2UA 3QE6A 2OW6A 4FZOA 4E81A 2F7OA 5FIGA 3B51X 3UITA 2F1BA 2IWLX
chains in the Genus database with same CATH topology
1I49A 2V6VA 3CAZA 2WWEA 4FZSA 1OCSA 2L73A 1X04A 1O7KA 2RAKA 1URUA 4IKBA 1WDZA 4H8SA 3QNIA 3QWEA 3HAHA 3ABHA 1Y2OA 2Z0VA 2ETTA 2AR5A 1KMDA 4HASA 3IQ2A 4ATMA 3DYTA 3M3WA 4P2IA 2V14A 4OXWA 3HPCX 2D4CA 2FICA 3FOGA 4PZGA 1I4TA 3HPBA 2Z0NA 4NQIA 1I4DA 2CSKA 1X03A 2C08A 2ELBA 4WPCA 3LUIA 2X3XA 2YKTA 3LLLA 4P2JA 3P0CA 4IKBB 2EFLA 5C5BB 2X3WA 1XTEA 5C5BA 2RAIA 3Q0KA 4BNEA 3PLTA 3Q84A 1OCUA 1I4LA 4BGJA 2D1LA 4ON3A 2Q13A 3OK8A 4PQOA 4WPEA 2REAA 4IKDA 2Z0OA 3SOGA 2X3VA 1GD5A 4NSWA 2EFKA 4AZ9A 2REDA 2RAJA 4DCNC 4PQPA 2DYBA 4DYLA 2Q12A 2I4KA 3ACOA 4AKVA 2CZOA 4AVMA 1ZWWA 1H6HA 3I2WA 1KQ6A 3HAJA 3QE6A 3SYVA 2YPSA 2V0OA 4I1QA 1XTNA 3HAIA 3G9GA 2IWLX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I49 A;  2V6V A;  3CAZ A;  2WWE A;  4FZS A;  1OCS A;  2L73 A;  1X04 A;  1O7K A;  2RAK A;  1URU A;  4IKB A;  1WDZ A;  4H8S A;  3QNI A;  3QWE A;  3HAH A;  3ABH A;  1Y2O A;  2Z0V A;  2ETT A;  2AR5 A;  1KMD A;  4HAS A;  3IQ2 A;  4ATM A;  3DYT A;  3M3W A;  4P2I A;  2V14 A;  4OXW A;  3HPC X;  2D4C A;  2FIC A;  3FOG A;  4PZG A;  1I4T A;  3HPB A;  2Z0N A;  4NQI A;  1I4D A;  2CSK A;  1X03 A;  2C08 A;  2ELB A;  4WPC A;  3LUI A;  2X3X A;  2YKT A;  3LLL A;  4P2J A;  3P0C A;  4IKB B;  2EFL A;  5C5B B;  2X3W A;  1XTE A;  5C5B A;  2RAI A;  3Q0K A;  4BNE A;  3PLT A;  3Q84 A;  1OCU A;  1I4L A;  4BGJ A;  2D1L A;  4ON3 A;  2Q13 A;  3OK8 A;  4PQO A;  4WPE A;  2REA A;  4IKD A;  2Z0O A;  3SOG A;  2X3V A;  1GD5 A;  4NSW A;  2EFK A;  4AZ9 A;  2RED A;  2RAJ A;  4DCN C;  4PQP A;  2DYB A;  4DYL A;  2Q12 A;  2I4K A;  3ACO A;  4AKV A;  2CZO A;  4AVM A;  1ZWW A;  1H6H A;  3I2W A;  1KQ6 A;  3HAJ A;  3QE6 A;  3SYV A;  2YPS A;  2V0O A;  4I1Q A;  1XTN A;  3HAI A;  3G9G A;  2IWL X; 
#chains in the Genus database with same CATH topology
 2YIA A;  4AZ5 A;  2L73 A;  3CZN A;  4HR1 A;  3BUI A;  4IW0 A;  4AZ7 A;  1WDZ A;  2WYH A;  3ABH A;  4FM3 A;  4KIK A;  2Z0V A;  4JLC A;  1E1D A;  4EZQ A;  2ND1 A;  1HWW A;  3IQ2 A;  4G6Q A;  2FYV A;  3M3W A;  4P2I A;  2D4C A;  2YL5 A;  2FIC A;  3B52 X;  3HPB A;  4R5G A;  2OBL A;  2CSK A;  4AZG A;  4EZN A;  4M0M A;  4HR1 B;  2Z8Y A;  2NCZ A;  3ER8 C;  5C5B A;  4UDX X;  1TQU A;  1R33 A;  4EZZ A;  3Q84 A;  2YLA A;  4BGJ A;  2EX3 B;  4ON3 A;  2Q13 A;  3OHX M;  4PQO A;  4H6I A;  3A98 A;  4WPE A;  2N3K A;  2Z0O A;  4F01 A;  1TQW A;  1PS3 A;  4PQP A;  1HXK A;  2YI9 A;  4EZX A;  2OZN B;  3T49 A;  3RPM A;  4R5I A;  3BLB A;  3O3O B;  2YPS A;  2V0O A;  3DDG A;  2GA9 D;  5FLE X;  3D50 A;  3CVR A;  1XTN A;  1GNT A;  1DKZ A;  2QFF A;  3QA8 A;  3DPO A;  3EJS A;  2LXY A;  2RAK A;  4IKB A;  3I01 A;  3L3P A;  4H8S A;  3CZS A;  4AZC B;  3D52 A;  3HAH A;  4EZR A;  3BVW A;  4FZP A;  1Y2O A;  1TQS A;  2ALW A;  3KDR A;  2AR5 A;  4R5J A;  4HAS A;  2PMR A;  3BUD A;  3DX0 A;  3VKH A;  4OXW A;  3RV1 A;  2F7R A;  2ND0 A;  2F1A A;  4EZS A;  3FOG A;  2YIB A;  3QNJ A;  3T4A G;  1I4D A;  4JNF A;  1U00 A;  1X03 A;  4JWI A;  4H6H A;  3LUI A;  3BUP A;  3LLL A;  4P2J A;  2GAF D;  4IKB B;  4D8J A;  3FD9 A;  3CKD A;  2RAI A;  3BVX A;  4EZW A;  4HY9 A;  1O7D B;  4JNE A;  1OCU A;  3VEA A;  2D1L A;  1DKY A;  3DX3 A;  1YWM A;  2REA A;  4IKD A;  3D2E A;  2YL9 A;  4NSW A;  4AZ9 A;  3KAV A;  2RED A;  2DYB A;  4EZO A;  4JWC A;  3T47 A;  4DYL A;  3D51 A;  2RT6 A;  1SU6 A;  1ZWW A;  2ZXQ A;  1LQ7 A;  3DX2 A;  3HAJ A;  3SYV A;  4PO2 A;  2OO2 A;  4JN4 A;  4I1Q A;  4AZI A;  4EZY A;  2YLL A;  2V6V A;  4JWE A;  2WWE A;  3CV5 A;  4FZS A;  1OCS A;  1X04 A;  1SU8 A;  3VEB A;  3QNI A;  3QWE A;  3EJU A;  3D4Y A;  3D4Z A;  4EZV A;  1TQT A;  4KIK B;  3DPP A;  4AZC A;  5E84 A;  4ATM A;  3ERC C;  3HPC X;  4AZH A;  4NQI A;  3T48 A;  1R34 A;  1OA0 A;  2PY6 A;  2C08 A;  1OAO A;  1JQK A;  3ER9 B;  2X3X A;  3DDF A;  3F7W A;  2EFL A;  5C5B B;  1ZYL A;  2X3W A;  1XTE A;  4JL9 A;  3Q0K A;  3I39 X;  4BNE A;  4F00 A;  3PLT A;  1I4L A;  2QKW A;  3L3O M;  1QX1 A;  3DX1 A;  4R5K A;  2EWF A;  2MI7 A;  2YL8 A;  2X3V A;  1GD5 A;  2GF4 A;  2EFK A;  2WIN M;  4IWP A;  3B53 X;  2O0I 1;  2RAJ A;  3LMF A;  3OWG A;  2Q12 A;  2JNS A;  3ACO A;  4AKV A;  4AVM A;  1H6H A;  3I2W A;  3GI7 A;  3DPQ A;  1MJG A;  3BVU A;  1SU7 A;  3HAI A;  3G9G A;  1R5E A;  1I49 A;  3CAZ A;  1W9M A;  1E9V A;  5TKY A;  3EJT A;  1O7K A;  1URU A;  2KHO A;  3I04 A;  1DKX A;  4NPH A;  3DX4 A;  3EJQ A;  2ETT A;  2YL6 A;  2QXL A;  3RV0 A;  2X5C A;  3BVT A;  1KMD A;  2F7Q A;  2JNK A;  2YI8 A;  4JWD A;  3DYT A;  2V14 A;  4EZU A;  1SUF A;  1HTY A;  4B9Q A;  4PZG A;  1I4T A;  1O7D C;  4IM0 A;  1GNL A;  4E3C A;  2Z0N A;  3BUB A;  3C7N A;  3LVT A;  2ELB A;  3BVV A;  3O3M B;  4WPC A;  3T46 A;  2YKT A;  3P0C A;  3D2F A;  4HYB A;  2OW7 A;  3ZED A;  3KAW A;  4IM3 A;  2WYI A;  4IM2 A;  1TQV A;  1QWN A;  3OK8 A;  4EZT A;  2YIV X;  4AZB A;  3EJP A;  4UDY X;  4EZP A;  1UPX A;  2F18 A;  1OA1 A;  3O3N B;  3SOG A;  2OBM A;  2F7P A;  4IWO A;  1GN9 A;  4DCN C;  4R5L A;  5KBP A;  4AZ6 A;  4IWQ A;  3EJR A;  2I4K A;  3BUQ A;  2LM0 A;  2CZO A;  1KQ6 A;  1QWU A;  1E2U A;  3QE6 A;  2OW6 A;  4FZO A;  4E81 A;  2F7O A;  5FIG A;  3B51 X;  3UIT A;  2F1B A;  2IWL X; 
#chains in the Genus database with same CATH homology
 1I49 A;  2V6V A;  3CAZ A;  2WWE A;  4FZS A;  1OCS A;  2L73 A;  1X04 A;  1O7K A;  2RAK A;  1URU A;  4IKB A;  1WDZ A;  4H8S A;  3QNI A;  3QWE A;  3HAH A;  3ABH A;  1Y2O A;  2Z0V A;  2ETT A;  2AR5 A;  1KMD A;  4HAS A;  3IQ2 A;  4ATM A;  3DYT A;  3M3W A;  4P2I A;  2V14 A;  4OXW A;  3HPC X;  2D4C A;  2FIC A;  3FOG A;  4PZG A;  1I4T A;  3HPB A;  2Z0N A;  4NQI A;  1I4D A;  2CSK A;  1X03 A;  2C08 A;  2ELB A;  4WPC A;  3LUI A;  2X3X A;  2YKT A;  3LLL A;  4P2J A;  3P0C A;  4IKB B;  2EFL A;  5C5B B;  2X3W A;  1XTE A;  5C5B A;  2RAI A;  3Q0K A;  4BNE A;  3PLT A;  3Q84 A;  1OCU A;  1I4L A;  4BGJ A;  2D1L A;  4ON3 A;  2Q13 A;  3OK8 A;  4PQO A;  4WPE A;  2REA A;  4IKD A;  2Z0O A;  3SOG A;  2X3V A;  1GD5 A;  4NSW A;  2EFK A;  4AZ9 A;  2RED A;  2RAJ A;  4DCN C;  4PQP A;  2DYB A;  4DYL A;  2Q12 A;  2I4K A;  3ACO A;  4AKV A;  2CZO A;  4AVM A;  1ZWW A;  1H6H A;  3I2W A;  1KQ6 A;  3HAJ A;  3QE6 A;  3SYV A;  2YPS A;  2V0O A;  4I1Q A;  1XTN A;  3HAI A;  3G9G A;  2IWL X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...