4AN7B

Kunitz type trypsin inhibitor complex with porcine trypsin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
174
structure length
156
Chain Sequence
b'YTVHDTDGKPVLNNAGQYYILPAKGGGLGLSNDDDGNCPLTVSQTPIDIPIGLPVRFSSRARISHITTALSLNIEFTIAPACAPKPARWRIYTPVKISDDFSSAAPFQIKKFEEDYKLVYCSRKCVDLGIKIDNEKNRRLVLKEGDPFKVKFKKVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structural Basis for Dual Inhibitory Role of Tamarind Kunitz Inhibitor (Tki) Against Factor Xa and Trypsin.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 31
structure length 156
sequence length 174
ec nomenclature
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4an7B00
1V6WA 2DRZA 4I7IA 4AN7B 1HWMB 5BQUC 4CJMA 1W3FA 1MC9A 4HA2A 3AJ6A 3F1RA 3N0KA 2RSTA 1FGAA 2ZQOA 3BAQA 5D61A 1G9CA 4IQPA 1IRAX 4OWKA 4I0YA 3PG0A 3A23A 1Q03A 1Q1UA 1AVXB 3UDAA 3BTAA 4KEJA 6I1BA 1EVTA 2NM1A 3O4AA 2DS0A 3BAVA 2D23A 2KKIA 3N7MA 2P39A 2KH2A 3ZC8A 3VWCA 2X2TA 2AXMA 1I1BA 4QKSA 4LO2C 4LO3C 5JLVA 1HCEA 3BA7A 3CA1A 1JLXA 3BRFA 1HWOB 2D7IA 3IM6A 4AN6A 1DQOA 3NBNA 3WO4A 1TOOA 1JY0A 3OJVA 4P0KA 5JMCA 5EG6C 1BFBA 2QN4A 2RG9B 1Z2VA 1HCDA 4LO7C 1D0HA 2IHOA 3H6SE 1BLAA 3RTIB 4X3AA 3P6JA 4GOVA 2NVHA 4IZXA 3VEQA 1R8NA 2ZQNA 3NBEA 4ZOTA 1VCLA 4ZFYB 2XOAA 4GOYA 3HMYA 4I3NA 4YOLA 5BP5A 2K8RA 3AJ5A 3CRIA 3AKGA 4IONA 5D62A 1NZKA 4X39A 2K4AB 3NBCA 3MPPG 2VSAA 4ISRA 3AKHA 3BADA 1Z0HA 3QYDA 1EV2A 1II4A 2ESUA 1FV3A 1QQLA 4JPZA 4ZKTB 1WD4A 5E24E 3AH2A 1ISVA 4XKIA 1HIBA 3WO3A 2YUGA 3O3QA 1WBCA 1GGPB 4Q9PA 2D22A 4EB2B 1XYFA 3N7KA 2HW9A 1S0GA 1DQGA 4I4XA 3WMUA 3WINA 3O4CA 4EEEB 2BFHA 1PWAA 1ILR1 3OGGA 3S8JA 5DVHA 2MIBA 1IJTA 3VSFA 1HKNA 2X2SA 1G9BA 3K1XA 3AKFA 3JUTA 3V0BB 3FUOA 3FGMA 4I6IA 1W3AA 2E4MC 2KLLA 1IHKA 2D44A 4OUJA 1TP0A 4TLPA 1RG8A 4Z8SB 3VT2A 4G6JA 1IILA 3P53A 4J23B 4J2XA 3O5WB 3HALA 3ZXGA 3V79C 3OBRA 2L5XA 4G9MA 4QO3A 2FO1A 1BFGA 1MD6A 4ZFWB 3R4UA 3AZWA 3FJKA 3V0BA 4LO7B 4D0TA 3I2AA 3NBDA 1M16A 3Q7XA 1FQ9A 3Q7YA 2KI4A 3IIRA 2ZR1B 5I1BA 4IZEA 1AVUA 1BA7A 4XFUA 4USPA 5F8WA 4QBVA 3VSZA 3IM5A 3O4OA 4Z9WB 3T8SA 1AVWB 2NP0A 2FFUA 3UD9A 1K5UA 1WBAA 2BEBA 1G9DA 1R8OA 1ISYA 3W9TA 3BA4A 4OEFA 1IRPA 4GAIA 4OEGA 3BA5A 5F8SA 3ILAA 4J2KA 4JKXB 1L2HA 4I4RA 2MLLB 3RMXA 1RMLA 1S0LA 4G9NA 3HSMA 1J0SA 1P63A 3UD7A 2RQ9A 3H6RB 3PUBA 4DCKC 2VUAA 4QC4A 4ZFUB 3FJDA 3JRRA 3POKA 1A8DA 1YBIA 2GZBA 4ZBVB 4A7ZA 2Y9XE 4XFSA 3ZC9A 1K5VA 1W3GA 1E0OA 1M2TB 4P6AA 1SR4A 3FJHA 3BB2A 2VXTI 3D7WB 3RTJB 3MALA 3SNVA 1PZZA 1ISXA 2NZ9A 4X38A 3AH1A 4EKXB 4D8HA 3S8KA 3UJ0A 4ISQA 3RMYA 4PC4A 31BIA 2Q3NB 3LTQA 1XG6A 1T4QA 3FJIA 4I96A 4HJJA 2ERMA 3H6RA 1DFCA 2D24A 2QYIB 1S0BA 2KI6B 3O4BA 2D43A 1YTOA 4LO0A 5D63A 1HWNB 4HR6C 1Z4SA 1YYNA 2LIQA 4J2YA 1V6XA 2Y9WC 3RSJA 4IY9A 2FFVA 4FGFA 2D1ZA 1YXWA 4LO1C 4L4HA 1BFCA 1EPWA 4JP0A 5BVPI 3FUQA 2I1BA 1CE7B 2DRYA 1I1EA 2WBCA 4FVVA 1PC8B 3OBTA 3BAUA 4JKQA 1V6UA 2F2FC 5HPZA 3BRGC 3CAHA 5BXRA 3FJJA 3HOMA 3BAOA 1AXMA 1ABRB 3N7JA 1HWPB 3UJ4A 3P6IA 1ISZA 1IOBA 3CRHA 4KEIA 2P23A 3CA6A 4OWLA 5BQUA 1EYLA 4ZA3B 3CU1B 3A21A 3AH4A 2IWTB 4QALA 5BP5C 1JLYA 3ZXDA 3KMVA 4XFTA 1KNMA 1F31A 5FNXA 1JQZA 1FN0A 4Q9GA 1YF8B 4ENDA 4P0JA 5BXPA 5EC5A 4I4SA 3E8LC 1S0DA 4DENA 4LO8B 4USOA 4A7YA 2D20A 3BX1C 1ONKB 4I4PA 3A07A 3R4SA 3FJ9A 3HBWA 4D0ZA 2NTDA 3CA3A 2D7RA 5BXTA 1ISWA 4ZLBB 1TWMA 4LO2A 2AQZA 41BIA 4LO3A 3WINC 1BLDA 1ITBA 1JT7A 2Z48A 3AZVA 1IT0A 3FJAA 4QD2C 4JAWA 2J3PA 1N4KA 4EFQA 1TTUA 4KC3A 3UD8A 4EFPA 4I37A 5FZZA 1QQKA 3Q7WA 2FDBM 4JQ0A 3O4DA 1OQLB 5BXSA 3IAGC 1FMZA 1SZ6B 4I8MA 1DFQA 1JT3A 5DUYA 3I29B 21BIA 4IY8A 4I1BA 3I2XA 3BAHA 1NUNA 2AAIB 4R6UB 4GP0A 1TIEA 1UPSA 2WRYA 3VUOA 1QXMA 2ET2A 2VLCA 1RY7A 4I4QA 8I1BA 1DJSB 1JT5A 1XHBA 2K43A 2M49A 3FJEA 3IM7A 5FZYA 4LO1A 5DZUA 4OWJA 2Q9XA 3OJMA 4ZGRB 3OJ2A 3ZX7A 5FZUA 4F34A 1JT4A 2R9KB 4GP3A 4I4YA 1G82A 2F2FA 4H04A 4QBCA 4G6MA 2VXRA 2FGFA 2HZ9A 1S0CA 2HWAA 1Q04A 2F8XC 3FJ8A 4I4UA 1FV2A 4F83A 7I1BA 4A7KA 4IYBA 2E4MA 3FFZA 1BFFA 3HN1A 3BRDA 1BASA 1DZCA 2UUSA 3FJCA 3B9UA 5DSSB 5G00A 5BOWA 1TFMB 3CA4A 1BARA 1FWVA 5EHAA 1SR4C 1FWUA 4QD2B 2HWMA 3H6QA 1AVAC 2VSEA 3O44A 5F8YA 3WA1A 4QKRA 1PUUB 4DEPA 3A22A 3TC2A 3FJBA 3V0AB 2LIEA 3QR5A 4I2SA 3LLPA 3PHZA 4I4OA 1G9AA 1AFCA 1WD3A 1JTCA 1DIWA 1FMMS 3C9ZA 1RZOB 4EFRA 1T9FA 1S0EA 5B2HA 4LO0C 2GO2A 2MC2A 4G1RA 3CRGA 2DREA 4OW4A 1AF9A 9ILBA 4II0A 4J2SA 1DZDA 4Q91A 4IHZA 4KBBA 2BEAA 3WO2A 4H9WA 1PUMB 5FNWA 3F62B 4WBCA 3WMVA 3V0AA 3FJFA 2Y9FA 2NYYA 4OEEA 1DLLA 3OGFA 3VT1A 1S0FA 1CVSA 2Z49A 4L4IA 4KEKA 1V6VA 4GAFA 3O49A 2VU9A 3CA5A 4JRAA 3AKIA 3CQAA 1TWEA 3NJ5A 4I4VA 1XZZA 3N7LA 3EF2A 3VT0A 2Y9GA 3BAGA 3PMEA 4I1EA 5GAQA 5F90A 4P0LA 2AFGA 4X37A 3CA0A
chains in the Genus database with same CATH superfamily
1V6WA 2DRZA 4I7IA 4AN7B 1HWMB 5BQUC 4CJMA 1W3FA 1MC9A 4HA2A 3AJ6A 3F1RA 3N0KA 2RSTA 1FGAA 2ZQOA 3BAQA 5D61A 1G9CA 4IQPA 1IRAX 4OWKA 4I0YA 3PG0A 3A23A 1Q03A 1Q1UA 1AVXB 3UDAA 3BTAA 4KEJA 6I1BA 1EVTA 2NM1A 3O4AA 2DS0A 3BAVA 2D23A 2KKIA 3N7MA 2P39A 2KH2A 3ZC8A 3VWCA 2X2TA 2AXMA 1I1BA 4QKSA 4LO2C 4LO3C 5JLVA 1HCEA 3BA7A 3CA1A 1JLXA 3BRFA 1HWOB 2D7IA 3IM6A 4AN6A 1DQOA 3NBNA 3WO4A 1TOOA 1JY0A 3OJVA 4P0KA 5JMCA 5EG6C 1BFBA 2QN4A 2RG9B 1Z2VA 1HCDA 4LO7C 2NS2A 1D0HA 2IHOA 3H6SE 1BLAA 3RTIB 4X3AA 3P6JA 4GOVA 2NVHA 4IZXA 3VEQA 1R8NA 2ZQNA 3NBEA 4ZOTA 1VCLA 4ZFYB 2XOAA 4GOYA 3HMYA 4I3NA 4YOLA 5BP5A 2K8RA 3AJ5A 3CRIA 3AKGA 4IONA 5D62A 1NZKA 4X39A 2K4AB 3NBCA 3MPPG 2VSAA 4ISRA 3AKHA 3BADA 1Z0HA 3QYDA 4MZHA 1EV2A 1II4A 2ESUA 1FV3A 1QQLA 4JPZA 4ZKTB 1WD4A 5E24E 3AH2A 1ISVA 4XKIA 1HIBA 3WO3A 2YUGA 3O3QA 1WBCA 1GGPB 4Q9PA 2D22A 4EB2B 1XYFA 3N7KA 2HW9A 1S0GA 1DQGA 4I4XA 3WMUA 3WINA 3O4CA 4EEEB 2BFHA 1PWAA 1ILR1 3OGGA 3S8JA 5DVHA 2MIBA 1IJTA 3VSFA 1HKNA 2X2SA 1G9BA 3K1XA 3AKFA 3JUTA 3V0BB 3FUOA 3FGMA 4I6IA 1W3AA 2E4MC 2KLLA 1IHKA 2D44A 4OUJA 1TP0A 4TLPA 1RG8A 4Z8SB 3VT2A 4G6JA 1IILA 3P53A 4J23B 4J2XA 3O5WB 3HALA 3ZXGA 3V79C 3OBRA 2L5XA 4G9MA 4QO3A 2FO1A 1BFGA 1MD6A 4ZFWB 3R4UA 3AZWA 3FJKA 3V0BA 4LO7B 4D0TA 3I2AA 3NBDA 1M16A 3Q7XA 1FQ9A 3Q7YA 2KI4A 3IIRA 2ZR1B 5I1BA 4IZEA 1AVUA 1BA7A 4XFUA 4USPA 5F8WA 4QBVA 3VSZA 3IM5A 3O4OA 4Z9WB 3T8SA 1AVWB 2NP0A 2FFUA 3UD9A 1K5UA 1WBAA 2BEBA 1G9DA 1R8OA 1ISYA 3W9TA 3BA4A 4OEFA 1IRPA 4GAIA 4OEGA 3BA5A 5F8SA 3ILAA 4J2KA 4JKXB 1L2HA 4I4RA 2MLLB 3RMXA 1RMLA 1S0LA 4G9NA 3HSMA 1J0SA 1P63A 3UD7A 2RQ9A 3H6RB 3PUBA 4DCKC 4MZFB 2VUAA 4QC4A 4ZFUB 3FJDA 3JRRA 3POKA 1A8DA 1YBIA 2GZBA 4ZBVB 4A7ZA 2Y9XE 4XFSA 3ZC9A 1K5VA 1W3GA 1E0OA 1M2TB 4P6AA 1SR4A 3FJHA 3BB2A 2VXTI 3D7WB 3RTJB 3MALA 3SNVA 1PZZA 1ISXA 2NZ9A 4X38A 3AH1A 4EKXB 4D8HA 3S8KA 3UJ0A 4ISQA 3RMYA 4PC4A 31BIA 2Q3NB 3LTQA 1XG6A 1T4QA 3FJIA 4I96A 4HJJA 2ERMA 3H6RA 1DFCA 2D24A 2QYIB 1S0BA 2KI6B 3O4BA 2D43A 1YTOA 4LO0A 5D63A 1HWNB 4HR6C 1Z4SA 1YYNA 2LIQA 4UY4A 4J2YA 1V6XA 2Y9WC 3RSJA 4IY9A 2FFVA 4FGFA 2D1ZA 1YXWA 4LO1C 4L4HA 1BFCA 1EPWA 4JP0A 5BVPI 3FUQA 2I1BA 1CE7B 2DRYA 1I1EA 2WBCA 4FVVA 1PC8B 3OBTA 3BAUA 4JKQA 1V6UA 2F2FC 5HPZA 3BRGC 3CAHA 5BXRA 3FJJA 3HOMA 3BAOA 1AXMA 1ABRB 3N7JA 1HWPB 3UJ4A 3P6IA 1ISZA 1IOBA 3CRHA 4KEIA 2P23A 3CA6A 4OWLA 5BQUA 1EYLA 4ZA3B 3CU1B 3A21A 3AH4A 2IWTB 4QALA 5BP5C 1JLYA 3ZXDA 3KMVA 4XFTA 1KNMA 1F31A 5FNXA 1JQZA 1FN0A 4Q9GA 1YF8B 4ENDA 4P0JA 5BXPA 5EC5A 4I4SA 3E8LC 1S0DA 4DENA 4LO8B 4USOA 4A7YA 4MZGB 2D20A 3BX1C 1ONKB 4I4PA 3A07A 3R4SA 3FJ9A 3HBWA 4D0ZA 2NTDA 3CA3A 2D7RA 5BXTA 1ISWA 4ZLBB 1TWMA 4LO2A 2AQZA 41BIA 4LO3A 3WINC 1BLDA 1ITBA 1JT7A 2Z48A 3AZVA 1IT0A 3FJAA 4QD2C 4JAWA 2J3PA 1N4KA 4EFQA 1TTUA 4KC3A 3UD8A 4EFPA 4I37A 5FZZA 1QQKA 3Q7WA 2FDBM 4JQ0A 3O4DA 1OQLB 5BXSA 3IAGC 1FMZA 1SZ6B 4I8MA 1DFQA 1JT3A 5DUYA 3I29B 21BIA 4IY8A 4I1BA 3I2XA 3BAHA 1NUNA 2AAIB 4R6UB 4GP0A 1TIEA 1UPSA 2WRYA 3VUOA 1QXMA 2ET2A 2VLCA 1RY7A 4I4QA 8I1BA 1DJSB 1JT5A 1XHBA 2K43A 2M49A 3FJEA 3IM7A 5FZYA 4LO1A 5DZUA 4OWJA 2Q9XA 3OJMA 4ZGRB 3OJ2A 3ZX7A 5FZUA 4F34A 1JT4A 2R9KB 4GP3A 4I4YA 1G82A 2F2FA 4H04A 4QBCA 4G6MA 2VXRA 2FGFA 2HZ9A 1S0CA 2HWAA 1Q04A 2F8XC 3FJ8A 4I4UA 1FV2A 4F83A 7I1BA 4A7KA 4IYBA 2E4MA 3FFZA 1BFFA 3HN1A 3BRDA 1BASA 1DZCA 2UUSA 3FJCA 3B9UA 5DSSB 5G00A 5BOWA 1TFMB 3CA4A 1BARA 4H75A 1FWVA 5EHAA 1SR4C 1FWUA 4QD2B 2HWMA 3H6QA 1AVAC 2VSEA 3O44A 5F8YA 3WA1A 4QKRA 1PUUB 4DEPA 3A22A 3TC2A 3FJBA 3V0AB 2LIEA 3QR5A 4I2SA 3LLPA 3PHZA 4I4OA 1G9AA 1AFCA 1WD3A 1JTCA 1DIWA 1FMMS 3C9ZA 1RZOB 4EFRA 1T9FA 1S0EA 5B2HA 4LO0C 2GO2A 2MC2A 4G1RA 3CRGA 2DREA 4OW4A 1AF9A 9ILBA 4II0A 4J2SA 1DZDA 4Q91A 4IHZA 4KBBA 2BEAA 3WO2A 4H9WA 1PUMB 5FNWA 3F62B 4WBCA 3WMVA 3V0AA 3FJFA 2Y9FA 2NYYA 4OEEA 1DLLA 3OGFA 3VT1A 1S0FA 1CVSA 2Z49A 4L4IA 4KEKA 1V6VA 4GAFA 3O49A 2VU9A 3CA5A 4JRAA 3AKIA 3CQAA 1TWEA 3NJ5A 4I4VA 1XZZA 3N7LA 3EF2A 3VT0A 2Y9GA 3BAGA 3PMEA 4I1EA 5GAQA 5F90A 4P0LA 2AFGA 4X37A 3CA0A
chains in the Genus database with same CATH topology
1V6WA 2DRZA 4I7IA 4AN7B 1HWMB 5BQUC 4CJMA 1W3FA 1MC9A 4HA2A 3AJ6A 3F1RA 3N0KA 2RSTA 1FGAA 2ZQOA 3BAQA 5D61A 1G9CA 4IQPA 1IRAX 4OWKA 4I0YA 3PG0A 3A23A 1Q03A 1Q1UA 1AVXB 3UDAA 3BTAA 4KEJA 6I1BA 1EVTA 2NM1A 3O4AA 2DS0A 3BAVA 2D23A 2KKIA 3N7MA 2P39A 2KH2A 3ZC8A 3VWCA 2X2TA 2AXMA 1I1BA 4QKSA 4LO2C 4LO3C 5JLVA 1HCEA 3BA7A 3CA1A 1JLXA 3BRFA 1HWOB 2D7IA 3IM6A 4AN6A 1DQOA 3NBNA 3WO4A 1TOOA 1JY0A 3OJVA 4P0KA 5JMCA 5EG6C 1BFBA 2QN4A 2RG9B 1Z2VA 1HCDA 4LO7C 2NS2A 1D0HA 2IHOA 3H6SE 1BLAA 3RTIB 4X3AA 3P6JA 4GOVA 2NVHA 4IZXA 3VEQA 1R8NA 2ZQNA 3NBEA 4ZOTA 1VCLA 4ZFYB 2XOAA 4GOYA 3HMYA 4I3NA 4YOLA 5BP5A 2K8RA 3AJ5A 3CRIA 3AKGA 4IONA 5D62A 1NZKA 4X39A 2K4AB 3NBCA 3MPPG 2VSAA 4ISRA 3AKHA 3BADA 1Z0HA 3QYDA 4MZHA 1EV2A 1II4A 2ESUA 1FV3A 1QQLA 4JPZA 4ZKTB 1WD4A 5E24E 3AH2A 1ISVA 4XKIA 1HIBA 3WO3A 2YUGA 3O3QA 1WBCA 1GGPB 4Q9PA 2D22A 4EB2B 1XYFA 3N7KA 2HW9A 1S0GA 1DQGA 4I4XA 3WMUA 3WINA 3O4CA 4EEEB 2BFHA 1PWAA 1ILR1 3OGGA 3S8JA 5DVHA 2MIBA 1IJTA 3VSFA 1HKNA 2X2SA 1G9BA 3K1XA 3AKFA 3JUTA 3V0BB 3FUOA 3FGMA 4I6IA 1W3AA 2E4MC 2KLLA 1IHKA 2D44A 4OUJA 1TP0A 4TLPA 1RG8A 4Z8SB 3VT2A 4G6JA 1IILA 3P53A 4J23B 4J2XA 3O5WB 3HALA 3ZXGA 3V79C 3OBRA 2L5XA 4G9MA 4QO3A 2FO1A 1BFGA 1MD6A 4ZFWB 3R4UA 3AZWA 3FJKA 3V0BA 4LO7B 4D0TA 3I2AA 3NBDA 1M16A 3Q7XA 1FQ9A 3Q7YA 2KI4A 3IIRA 2ZR1B 5I1BA 4IZEA 1AVUA 1BA7A 4XFUA 4USPA 5F8WA 4QBVA 3VSZA 3IM5A 3O4OA 4Z9WB 3T8SA 1AVWB 2NP0A 2FFUA 3UD9A 1K5UA 1WBAA 2BEBA 1G9DA 1R8OA 1ISYA 3W9TA 3BA4A 4OEFA 1IRPA 4GAIA 4OEGA 3BA5A 5F8SA 3ILAA 4J2KA 4JKXB 1L2HA 4I4RA 2MLLB 3RMXA 1RMLA 1S0LA 4G9NA 3HSMA 1J0SA 1P63A 3UD7A 2RQ9A 3H6RB 3PUBA 4DCKC 4MZFB 2VUAA 4QC4A 4ZFUB 3FJDA 3JRRA 3POKA 1A8DA 1YBIA 2GZBA 4ZBVB 4A7ZA 2Y9XE 4XFSA 3ZC9A 1K5VA 1W3GA 1E0OA 1M2TB 4P6AA 1SR4A 3FJHA 3BB2A 2VXTI 3D7WB 3RTJB 3MALA 3SNVA 1PZZA 1ISXA 2NZ9A 4X38A 3AH1A 4EKXB 4D8HA 3S8KA 3UJ0A 4ISQA 3RMYA 4PC4A 31BIA 2Q3NB 3LTQA 1XG6A 1T4QA 3FJIA 4I96A 4HJJA 2ERMA 3H6RA 1DFCA 2D24A 2QYIB 1S0BA 2KI6B 3O4BA 2D43A 1YTOA 4LO0A 5D63A 1HWNB 4HR6C 1Z4SA 1YYNA 2LIQA 4UY4A 4J2YA 1V6XA 2Y9WC 3RSJA 4IY9A 2FFVA 4FGFA 2D1ZA 1YXWA 4LO1C 4L4HA 1BFCA 1EPWA 4JP0A 5BVPI 3FUQA 2I1BA 1CE7B 2DRYA 1I1EA 2WBCA 4FVVA 1PC8B 3OBTA 3BAUA 4JKQA 1V6UA 2F2FC 5HPZA 3BRGC 3CAHA 5BXRA 3FJJA 3HOMA 3BAOA 1AXMA 1ABRB 3N7JA 1HWPB 3UJ4A 3P6IA 1ISZA 1IOBA 3CRHA 4KEIA 2P23A 3CA6A 4OWLA 5BQUA 1EYLA 4ZA3B 3CU1B 3A21A 3AH4A 2IWTB 4QALA 5BP5C 1JLYA 3ZXDA 3KMVA 4XFTA 1KNMA 1F31A 5FNXA 1JQZA 1FN0A 4Q9GA 1YF8B 4ENDA 4P0JA 5BXPA 5EC5A 4I4SA 3E8LC 1S0DA 4DENA 4LO8B 4USOA 4A7YA 4MZGB 2D20A 3BX1C 1ONKB 4I4PA 3A07A 3R4SA 3FJ9A 3HBWA 4D0ZA 2NTDA 3CA3A 2D7RA 5BXTA 1ISWA 4ZLBB 1TWMA 4LO2A 2AQZA 41BIA 4LO3A 3WINC 1BLDA 1ITBA 1JT7A 2Z48A 3AZVA 1IT0A 3FJAA 4QD2C 4JAWA 2J3PA 1N4KA 4EFQA 1TTUA 4KC3A 3UD8A 4EFPA 4I37A 5FZZA 1QQKA 3Q7WA 2FDBM 4JQ0A 3O4DA 1OQLB 5BXSA 3IAGC 1FMZA 1SZ6B 4I8MA 1DFQA 1JT3A 5DUYA 3I29B 21BIA 4IY8A 4I1BA 3I2XA 3BAHA 1NUNA 2AAIB 4R6UB 4GP0A 1TIEA 1UPSA 2WRYA 3VUOA 1QXMA 2ET2A 2VLCA 1RY7A 4I4QA 8I1BA 1DJSB 1JT5A 1XHBA 2K43A 2M49A 3FJEA 3IM7A 5FZYA 4LO1A 5DZUA 4OWJA 2Q9XA 3OJMA 4ZGRB 3OJ2A 3ZX7A 5FZUA 4F34A 1JT4A 2R9KB 4GP3A 4I4YA 1G82A 2F2FA 4H04A 4QBCA 4G6MA 2VXRA 2FGFA 2HZ9A 1S0CA 2HWAA 1Q04A 2F8XC 3FJ8A 4I4UA 1FV2A 4F83A 7I1BA 4A7KA 4IYBA 2E4MA 3FFZA 1BFFA 3HN1A 3BRDA 1BASA 1DZCA 2UUSA 3FJCA 3B9UA 5DSSB 5G00A 5BOWA 1TFMB 3CA4A 1BARA 4H75A 1FWVA 5EHAA 1SR4C 1FWUA 4QD2B 2HWMA 3H6QA 1AVAC 2VSEA 3O44A 5F8YA 3WA1A 4QKRA 1PUUB 4DEPA 3A22A 3TC2A 3FJBA 3V0AB 2LIEA 3QR5A 4I2SA 3LLPA 3PHZA 4I4OA 1G9AA 1AFCA 1WD3A 1JTCA 1DIWA 1FMMS 3C9ZA 1RZOB 4EFRA 1T9FA 1S0EA 5B2HA 4LO0C 2GO2A 2MC2A 4G1RA 3CRGA 2DREA 4OW4A 1AF9A 9ILBA 4II0A 4J2SA 1DZDA 4Q91A 4IHZA 4KBBA 2BEAA 3WO2A 4H9WA 1PUMB 5FNWA 3F62B 4WBCA 3WMVA 3V0AA 3FJFA 2Y9FA 2NYYA 4OEEA 1DLLA 3OGFA 3VT1A 1S0FA 1CVSA 2Z49A 4L4IA 4KEKA 1V6VA 4GAFA 3O49A 2VU9A 3CA5A 4JRAA 3AKIA 3CQAA 1TWEA 3NJ5A 4I4VA 1XZZA 3N7LA 3EF2A 3VT0A 2Y9GA 3BAGA 3PMEA 4I1EA 5GAQA 5F90A 4P0LA 2AFGA 4X37A 3CA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V6W A;  2DRZ A;  4I7I A;  4AN7 B;  1HWM B;  5BQU C;  4CJM A;  1W3F A;  1MC9 A;  4HA2 A;  3AJ6 A;  3F1R A;  3N0K A;  2RST A;  1FGA A;  2ZQO A;  3BAQ A;  5D61 A;  1G9C A;  4IQP A;  1IRA X;  4OWK A;  4I0Y A;  3PG0 A;  3A23 A;  1Q03 A;  1Q1U A;  1AVX B;  3UDA A;  3BTA A;  4KEJ A;  6I1B A;  1EVT A;  2NM1 A;  3O4A A;  2DS0 A;  3BAV A;  2D23 A;  2KKI A;  3N7M A;  2P39 A;  2KH2 A;  3ZC8 A;  3VWC A;  2X2T A;  2AXM A;  1I1B A;  4QKS A;  4LO2 C;  4LO3 C;  5JLV A;  1HCE A;  3BA7 A;  3CA1 A;  1JLX A;  3BRF A;  1HWO B;  2D7I A;  3IM6 A;  4AN6 A;  1DQO A;  3NBN A;  3WO4 A;  1TOO A;  1JY0 A;  3OJV A;  4P0K A;  5JMC A;  5EG6 C;  1BFB A;  2QN4 A;  2RG9 B;  1Z2V A;  1HCD A;  4LO7 C;  1D0H A;  2IHO A;  3H6S E;  1BLA A;  3RTI B;  4X3A A;  3P6J A;  4GOV A;  2NVH A;  4IZX A;  3VEQ A;  1R8N A;  2ZQN A;  3NBE A;  4ZOT A;  1VCL A;  4ZFY B;  2XOA A;  4GOY A;  3HMY A;  4I3N A;  4YOL A;  5BP5 A;  2K8R A;  3AJ5 A;  3CRI A;  3AKG A;  4ION A;  5D62 A;  1NZK A;  4X39 A;  2K4A B;  3NBC A;  3MPP G;  2VSA A;  4ISR A;  3AKH A;  3BAD A;  1Z0H A;  3QYD A;  1EV2 A;  1II4 A;  2ESU A;  1FV3 A;  1QQL A;  4JPZ A;  4ZKT B;  1WD4 A;  5E24 E;  3AH2 A;  1ISV A;  4XKI A;  1HIB A;  3WO3 A;  2YUG A;  3O3Q A;  1WBC A;  1GGP B;  4Q9P A;  2D22 A;  4EB2 B;  1XYF A;  3N7K A;  2HW9 A;  1S0G A;  1DQG A;  4I4X A;  3WMU A;  3WIN A;  3O4C A;  4EEE B;  2BFH A;  1PWA A;  1ILR 1;  3OGG A;  3S8J A;  5DVH A;  2MIB A;  1IJT A;  3VSF A;  1HKN A;  2X2S A;  1G9B A;  3K1X A;  3AKF A;  3JUT A;  3V0B B;  3FUO A;  3FGM A;  4I6I A;  1W3A A;  2E4M C;  2KLL A;  1IHK A;  2D44 A;  4OUJ A;  1TP0 A;  4TLP A;  1RG8 A;  4Z8S B;  3VT2 A;  4G6J A;  1IIL A;  3P53 A;  4J23 B;  4J2X A;  3O5W B;  3HAL A;  3ZXG A;  3V79 C;  3OBR A;  2L5X A;  4G9M A;  4QO3 A;  2FO1 A;  1BFG A;  1MD6 A;  4ZFW B;  3R4U A;  3AZW A;  3FJK A;  3V0B A;  4LO7 B;  4D0T A;  3I2A A;  3NBD A;  1M16 A;  3Q7X A;  1FQ9 A;  3Q7Y A;  2KI4 A;  3IIR A;  2ZR1 B;  5I1B A;  4IZE A;  1AVU A;  1BA7 A;  4XFU A;  4USP A;  5F8W A;  4QBV A;  3VSZ A;  3IM5 A;  3O4O A;  4Z9W B;  3T8S A;  1AVW B;  2NP0 A;  2FFU A;  3UD9 A;  1K5U A;  1WBA A;  2BEB A;  1G9D A;  1R8O A;  1ISY A;  3W9T A;  3BA4 A;  4OEF A;  1IRP A;  4GAI A;  4OEG A;  3BA5 A;  5F8S A;  3ILA A;  4J2K A;  4JKX B;  1L2H A;  4I4R A;  2MLL B;  3RMX A;  1RML A;  1S0L A;  4G9N A;  3HSM A;  1J0S A;  1P63 A;  3UD7 A;  2RQ9 A;  3H6R B;  3PUB A;  4DCK C;  2VUA A;  4QC4 A;  4ZFU B;  3FJD A;  3JRR A;  3POK A;  1A8D A;  1YBI A;  2GZB A;  4ZBV B;  4A7Z A;  2Y9X E;  4XFS A;  3ZC9 A;  1K5V A;  1W3G A;  1E0O A;  1M2T B;  4P6A A;  1SR4 A;  3FJH A;  3BB2 A;  2VXT I;  3D7W B;  3RTJ B;  3MAL A;  3SNV A;  1PZZ A;  1ISX A;  2NZ9 A;  4X38 A;  3AH1 A;  4EKX B;  4D8H A;  3S8K A;  3UJ0 A;  4ISQ A;  3RMY A;  4PC4 A;  31BI A;  2Q3N B;  3LTQ A;  1XG6 A;  1T4Q A;  3FJI A;  4I96 A;  4HJJ A;  2ERM A;  3H6R A;  1DFC A;  2D24 A;  2QYI B;  1S0B A;  2KI6 B;  3O4B A;  2D43 A;  1YTO A;  4LO0 A;  5D63 A;  1HWN B;  4HR6 C;  1Z4S A;  1YYN A;  2LIQ A;  4J2Y A;  1V6X A;  2Y9W C;  3RSJ A;  4IY9 A;  2FFV A;  4FGF A;  2D1Z A;  1YXW A;  4LO1 C;  4L4H A;  1BFC A;  1EPW A;  4JP0 A;  5BVP I;  3FUQ A;  2I1B A;  1CE7 B;  2DRY A;  1I1E A;  2WBC A;  4FVV A;  1PC8 B;  3OBT A;  3BAU A;  4JKQ A;  1V6U A;  2F2F C;  5HPZ A;  3BRG C;  3CAH A;  5BXR A;  3FJJ A;  3HOM A;  3BAO A;  1AXM A;  1ABR B;  3N7J A;  1HWP B;  3UJ4 A;  3P6I A;  1ISZ A;  1IOB A;  3CRH A;  4KEI A;  2P23 A;  3CA6 A;  4OWL A;  5BQU A;  1EYL A;  4ZA3 B;  3CU1 B;  3A21 A;  3AH4 A;  2IWT B;  4QAL A;  5BP5 C;  1JLY A;  3ZXD A;  3KMV A;  4XFT A;  1KNM A;  1F31 A;  5FNX A;  1JQZ A;  1FN0 A;  4Q9G A;  1YF8 B;  4END A;  4P0J A;  5BXP A;  5EC5 A;  4I4S A;  3E8L C;  1S0D A;  4DEN A;  4LO8 B;  4USO A;  4A7Y A;  2D20 A;  3BX1 C;  1ONK B;  4I4P A;  3A07 A;  3R4S A;  3FJ9 A;  3HBW A;  4D0Z A;  2NTD A;  3CA3 A;  2D7R A;  5BXT A;  1ISW A;  4ZLB B;  1TWM A;  4LO2 A;  2AQZ A;  41BI A;  4LO3 A;  3WIN C;  1BLD A;  1ITB A;  1JT7 A;  2Z48 A;  3AZV A;  1IT0 A;  3FJA A;  4QD2 C;  4JAW A;  2J3P A;  1N4K A;  4EFQ A;  1TTU A;  4KC3 A;  3UD8 A;  4EFP A;  4I37 A;  5FZZ A;  1QQK A;  3Q7W A;  2FDB M;  4JQ0 A;  3O4D A;  1OQL B;  5BXS A;  3IAG C;  1FMZ A;  1SZ6 B;  4I8M A;  1DFQ A;  1JT3 A;  5DUY A;  3I29 B;  21BI A;  4IY8 A;  4I1B A;  3I2X A;  3BAH A;  1NUN A;  2AAI B;  4R6U B;  4GP0 A;  1TIE A;  1UPS A;  2WRY A;  3VUO A;  1QXM A;  2ET2 A;  2VLC A;  1RY7 A;  4I4Q A;  8I1B A;  1DJS B;  1JT5 A;  1XHB A;  2K43 A;  2M49 A;  3FJE A;  3IM7 A;  5FZY A;  4LO1 A;  5DZU A;  4OWJ A;  2Q9X A;  3OJM A;  4ZGR B;  3OJ2 A;  3ZX7 A;  5FZU A;  4F34 A;  1JT4 A;  2R9K B;  4GP3 A;  4I4Y A;  1G82 A;  2F2F A;  4H04 A;  4QBC A;  4G6M A;  2VXR A;  2FGF A;  2HZ9 A;  1S0C A;  2HWA A;  1Q04 A;  2F8X C;  3FJ8 A;  4I4U A;  1FV2 A;  4F83 A;  7I1B A;  4A7K A;  4IYB A;  2E4M A;  3FFZ A;  1BFF A;  3HN1 A;  3BRD A;  1BAS A;  1DZC A;  2UUS A;  3FJC A;  3B9U A;  5DSS B;  5G00 A;  5BOW A;  1TFM B;  3CA4 A;  1BAR A;  1FWV A;  5EHA A;  1SR4 C;  1FWU A;  4QD2 B;  2HWM A;  3H6Q A;  1AVA C;  2VSE A;  3O44 A;  5F8Y A;  3WA1 A;  4QKR A;  1PUU B;  4DEP A;  3A22 A;  3TC2 A;  3FJB A;  3V0A B;  2LIE A;  3QR5 A;  4I2S A;  3LLP A;  3PHZ A;  4I4O A;  1G9A A;  1AFC A;  1WD3 A;  1JTC A;  1DIW A;  1FMM S;  3C9Z A;  1RZO B;  4EFR A;  1T9F A;  1S0E A;  5B2H A;  4LO0 C;  2GO2 A;  2MC2 A;  4G1R A;  3CRG A;  2DRE A;  4OW4 A;  1AF9 A;  9ILB A;  4II0 A;  4J2S A;  1DZD A;  4Q91 A;  4IHZ A;  4KBB A;  2BEA A;  3WO2 A;  4H9W A;  1PUM B;  5FNW A;  3F62 B;  4WBC A;  3WMV A;  3V0A A;  3FJF A;  2Y9F A;  2NYY A;  4OEE A;  1DLL A;  3OGF A;  3VT1 A;  1S0F A;  1CVS A;  2Z49 A;  4L4I A;  4KEK A;  1V6V A;  4GAF A;  3O49 A;  2VU9 A;  3CA5 A;  4JRA A;  3AKI A;  3CQA A;  1TWE A;  3NJ5 A;  4I4V A;  1XZZ A;  3N7L A;  3EF2 A;  3VT0 A;  2Y9G A;  3BAG A;  3PME A;  4I1E A;  5GAQ A;  5F90 A;  4P0L A;  2AFG A;  4X37 A;  3CA0 A; 
#chains in the Genus database with same CATH topology
 1V6W A;  2DRZ A;  4I7I A;  4AN7 B;  1HWM B;  5BQU C;  4CJM A;  1W3F A;  1MC9 A;  4HA2 A;  3AJ6 A;  3F1R A;  3N0K A;  2RST A;  1FGA A;  2ZQO A;  3BAQ A;  5D61 A;  1G9C A;  4IQP A;  1IRA X;  4OWK A;  4I0Y A;  3PG0 A;  3A23 A;  1Q03 A;  1Q1U A;  1AVX B;  3UDA A;  3BTA A;  4KEJ A;  6I1B A;  1EVT A;  2NM1 A;  3O4A A;  2DS0 A;  3BAV A;  2D23 A;  2KKI A;  3N7M A;  2P39 A;  2KH2 A;  3ZC8 A;  3VWC A;  2X2T A;  2AXM A;  1I1B A;  4QKS A;  4LO2 C;  4LO3 C;  5JLV A;  1HCE A;  3BA7 A;  3CA1 A;  1JLX A;  3BRF A;  1HWO B;  2D7I A;  3IM6 A;  4AN6 A;  1DQO A;  3NBN A;  3WO4 A;  1TOO A;  1JY0 A;  3OJV A;  4P0K A;  5JMC A;  5EG6 C;  1BFB A;  2QN4 A;  2RG9 B;  1Z2V A;  1HCD A;  4LO7 C;  2NS2 A;  1D0H A;  2IHO A;  3H6S E;  1BLA A;  3RTI B;  4X3A A;  3P6J A;  4GOV A;  2NVH A;  4IZX A;  3VEQ A;  1R8N A;  2ZQN A;  3NBE A;  4ZOT A;  1VCL A;  4ZFY B;  2XOA A;  4GOY A;  3HMY A;  4I3N A;  4YOL A;  5BP5 A;  2K8R A;  3AJ5 A;  3CRI A;  3AKG A;  4ION A;  5D62 A;  1NZK A;  4X39 A;  2K4A B;  3NBC A;  3MPP G;  2VSA A;  4ISR A;  3AKH A;  3BAD A;  1Z0H A;  3QYD A;  4MZH A;  1EV2 A;  1II4 A;  2ESU A;  1FV3 A;  1QQL A;  4JPZ A;  4ZKT B;  1WD4 A;  5E24 E;  3AH2 A;  1ISV A;  4XKI A;  1HIB A;  3WO3 A;  2YUG A;  3O3Q A;  1WBC A;  1GGP B;  4Q9P A;  2D22 A;  4EB2 B;  1XYF A;  3N7K A;  2HW9 A;  1S0G A;  1DQG A;  4I4X A;  3WMU A;  3WIN A;  3O4C A;  4EEE B;  2BFH A;  1PWA A;  1ILR 1;  3OGG A;  3S8J A;  5DVH A;  2MIB A;  1IJT A;  3VSF A;  1HKN A;  2X2S A;  1G9B A;  3K1X A;  3AKF A;  3JUT A;  3V0B B;  3FUO A;  3FGM A;  4I6I A;  1W3A A;  2E4M C;  2KLL A;  1IHK A;  2D44 A;  4OUJ A;  1TP0 A;  4TLP A;  1RG8 A;  4Z8S B;  3VT2 A;  4G6J A;  1IIL A;  3P53 A;  4J23 B;  4J2X A;  3O5W B;  3HAL A;  3ZXG A;  3V79 C;  3OBR A;  2L5X A;  4G9M A;  4QO3 A;  2FO1 A;  1BFG A;  1MD6 A;  4ZFW B;  3R4U A;  3AZW A;  3FJK A;  3V0B A;  4LO7 B;  4D0T A;  3I2A A;  3NBD A;  1M16 A;  3Q7X A;  1FQ9 A;  3Q7Y A;  2KI4 A;  3IIR A;  2ZR1 B;  5I1B A;  4IZE A;  1AVU A;  1BA7 A;  4XFU A;  4USP A;  5F8W A;  4QBV A;  3VSZ A;  3IM5 A;  3O4O A;  4Z9W B;  3T8S A;  1AVW B;  2NP0 A;  2FFU A;  3UD9 A;  1K5U A;  1WBA A;  2BEB A;  1G9D A;  1R8O A;  1ISY A;  3W9T A;  3BA4 A;  4OEF A;  1IRP A;  4GAI A;  4OEG A;  3BA5 A;  5F8S A;  3ILA A;  4J2K A;  4JKX B;  1L2H A;  4I4R A;  2MLL B;  3RMX A;  1RML A;  1S0L A;  4G9N A;  3HSM A;  1J0S A;  1P63 A;  3UD7 A;  2RQ9 A;  3H6R B;  3PUB A;  4DCK C;  4MZF B;  2VUA A;  4QC4 A;  4ZFU B;  3FJD A;  3JRR A;  3POK A;  1A8D A;  1YBI A;  2GZB A;  4ZBV B;  4A7Z A;  2Y9X E;  4XFS A;  3ZC9 A;  1K5V A;  1W3G A;  1E0O A;  1M2T B;  4P6A A;  1SR4 A;  3FJH A;  3BB2 A;  2VXT I;  3D7W B;  3RTJ B;  3MAL A;  3SNV A;  1PZZ A;  1ISX A;  2NZ9 A;  4X38 A;  3AH1 A;  4EKX B;  4D8H A;  3S8K A;  3UJ0 A;  4ISQ A;  3RMY A;  4PC4 A;  31BI A;  2Q3N B;  3LTQ A;  1XG6 A;  1T4Q A;  3FJI A;  4I96 A;  4HJJ A;  2ERM A;  3H6R A;  1DFC A;  2D24 A;  2QYI B;  1S0B A;  2KI6 B;  3O4B A;  2D43 A;  1YTO A;  4LO0 A;  5D63 A;  1HWN B;  4HR6 C;  1Z4S A;  1YYN A;  2LIQ A;  4UY4 A;  4J2Y A;  1V6X A;  2Y9W C;  3RSJ A;  4IY9 A;  2FFV A;  4FGF A;  2D1Z A;  1YXW A;  4LO1 C;  4L4H A;  1BFC A;  1EPW A;  4JP0 A;  5BVP I;  3FUQ A;  2I1B A;  1CE7 B;  2DRY A;  1I1E A;  2WBC A;  4FVV A;  1PC8 B;  3OBT A;  3BAU A;  4JKQ A;  1V6U A;  2F2F C;  5HPZ A;  3BRG C;  3CAH A;  5BXR A;  3FJJ A;  3HOM A;  3BAO A;  1AXM A;  1ABR B;  3N7J A;  1HWP B;  3UJ4 A;  3P6I A;  1ISZ A;  1IOB A;  3CRH A;  4KEI A;  2P23 A;  3CA6 A;  4OWL A;  5BQU A;  1EYL A;  4ZA3 B;  3CU1 B;  3A21 A;  3AH4 A;  2IWT B;  4QAL A;  5BP5 C;  1JLY A;  3ZXD A;  3KMV A;  4XFT A;  1KNM A;  1F31 A;  5FNX A;  1JQZ A;  1FN0 A;  4Q9G A;  1YF8 B;  4END A;  4P0J A;  5BXP A;  5EC5 A;  4I4S A;  3E8L C;  1S0D A;  4DEN A;  4LO8 B;  4USO A;  4A7Y A;  4MZG B;  2D20 A;  3BX1 C;  1ONK B;  4I4P A;  3A07 A;  3R4S A;  3FJ9 A;  3HBW A;  4D0Z A;  2NTD A;  3CA3 A;  2D7R A;  5BXT A;  1ISW A;  4ZLB B;  1TWM A;  4LO2 A;  2AQZ A;  41BI A;  4LO3 A;  3WIN C;  1BLD A;  1ITB A;  1JT7 A;  2Z48 A;  3AZV A;  1IT0 A;  3FJA A;  4QD2 C;  4JAW A;  2J3P A;  1N4K A;  4EFQ A;  1TTU A;  4KC3 A;  3UD8 A;  4EFP A;  4I37 A;  5FZZ A;  1QQK A;  3Q7W A;  2FDB M;  4JQ0 A;  3O4D A;  1OQL B;  5BXS A;  3IAG C;  1FMZ A;  1SZ6 B;  4I8M A;  1DFQ A;  1JT3 A;  5DUY A;  3I29 B;  21BI A;  4IY8 A;  4I1B A;  3I2X A;  3BAH A;  1NUN A;  2AAI B;  4R6U B;  4GP0 A;  1TIE A;  1UPS A;  2WRY A;  3VUO A;  1QXM A;  2ET2 A;  2VLC A;  1RY7 A;  4I4Q A;  8I1B A;  1DJS B;  1JT5 A;  1XHB A;  2K43 A;  2M49 A;  3FJE A;  3IM7 A;  5FZY A;  4LO1 A;  5DZU A;  4OWJ A;  2Q9X A;  3OJM A;  4ZGR B;  3OJ2 A;  3ZX7 A;  5FZU A;  4F34 A;  1JT4 A;  2R9K B;  4GP3 A;  4I4Y A;  1G82 A;  2F2F A;  4H04 A;  4QBC A;  4G6M A;  2VXR A;  2FGF A;  2HZ9 A;  1S0C A;  2HWA A;  1Q04 A;  2F8X C;  3FJ8 A;  4I4U A;  1FV2 A;  4F83 A;  7I1B A;  4A7K A;  4IYB A;  2E4M A;  3FFZ A;  1BFF A;  3HN1 A;  3BRD A;  1BAS A;  1DZC A;  2UUS A;  3FJC A;  3B9U A;  5DSS B;  5G00 A;  5BOW A;  1TFM B;  3CA4 A;  1BAR A;  4H75 A;  1FWV A;  5EHA A;  1SR4 C;  1FWU A;  4QD2 B;  2HWM A;  3H6Q A;  1AVA C;  2VSE A;  3O44 A;  5F8Y A;  3WA1 A;  4QKR A;  1PUU B;  4DEP A;  3A22 A;  3TC2 A;  3FJB A;  3V0A B;  2LIE A;  3QR5 A;  4I2S A;  3LLP A;  3PHZ A;  4I4O A;  1G9A A;  1AFC A;  1WD3 A;  1JTC A;  1DIW A;  1FMM S;  3C9Z A;  1RZO B;  4EFR A;  1T9F A;  1S0E A;  5B2H A;  4LO0 C;  2GO2 A;  2MC2 A;  4G1R A;  3CRG A;  2DRE A;  4OW4 A;  1AF9 A;  9ILB A;  4II0 A;  4J2S A;  1DZD A;  4Q91 A;  4IHZ A;  4KBB A;  2BEA A;  3WO2 A;  4H9W A;  1PUM B;  5FNW A;  3F62 B;  4WBC A;  3WMV A;  3V0A A;  3FJF A;  2Y9F A;  2NYY A;  4OEE A;  1DLL A;  3OGF A;  3VT1 A;  1S0F A;  1CVS A;  2Z49 A;  4L4I A;  4KEK A;  1V6V A;  4GAF A;  3O49 A;  2VU9 A;  3CA5 A;  4JRA A;  3AKI A;  3CQA A;  1TWE A;  3NJ5 A;  4I4V A;  1XZZ A;  3N7L A;  3EF2 A;  3VT0 A;  2Y9G A;  3BAG A;  3PME A;  4I1E A;  5GAQ A;  5F90 A;  4P0L A;  2AFG A;  4X37 A;  3CA0 A; 
#chains in the Genus database with same CATH homology
 1V6W A;  2DRZ A;  4I7I A;  4AN7 B;  1HWM B;  5BQU C;  4CJM A;  1W3F A;  1MC9 A;  4HA2 A;  3AJ6 A;  3F1R A;  3N0K A;  2RST A;  1FGA A;  2ZQO A;  3BAQ A;  5D61 A;  1G9C A;  4IQP A;  1IRA X;  4OWK A;  4I0Y A;  3PG0 A;  3A23 A;  1Q03 A;  1Q1U A;  1AVX B;  3UDA A;  3BTA A;  4KEJ A;  6I1B A;  1EVT A;  2NM1 A;  3O4A A;  2DS0 A;  3BAV A;  2D23 A;  2KKI A;  3N7M A;  2P39 A;  2KH2 A;  3ZC8 A;  3VWC A;  2X2T A;  2AXM A;  1I1B A;  4QKS A;  4LO2 C;  4LO3 C;  5JLV A;  1HCE A;  3BA7 A;  3CA1 A;  1JLX A;  3BRF A;  1HWO B;  2D7I A;  3IM6 A;  4AN6 A;  1DQO A;  3NBN A;  3WO4 A;  1TOO A;  1JY0 A;  3OJV A;  4P0K A;  5JMC A;  5EG6 C;  1BFB A;  2QN4 A;  2RG9 B;  1Z2V A;  1HCD A;  4LO7 C;  2NS2 A;  1D0H A;  2IHO A;  3H6S E;  1BLA A;  3RTI B;  4X3A A;  3P6J A;  4GOV A;  2NVH A;  4IZX A;  3VEQ A;  1R8N A;  2ZQN A;  3NBE A;  4ZOT A;  1VCL A;  4ZFY B;  2XOA A;  4GOY A;  3HMY A;  4I3N A;  4YOL A;  5BP5 A;  2K8R A;  3AJ5 A;  3CRI A;  3AKG A;  4ION A;  5D62 A;  1NZK A;  4X39 A;  2K4A B;  3NBC A;  3MPP G;  2VSA A;  4ISR A;  3AKH A;  3BAD A;  1Z0H A;  3QYD A;  4MZH A;  1EV2 A;  1II4 A;  2ESU A;  1FV3 A;  1QQL A;  4JPZ A;  4ZKT B;  1WD4 A;  5E24 E;  3AH2 A;  1ISV A;  4XKI A;  1HIB A;  3WO3 A;  2YUG A;  3O3Q A;  1WBC A;  1GGP B;  4Q9P A;  2D22 A;  4EB2 B;  1XYF A;  3N7K A;  2HW9 A;  1S0G A;  1DQG A;  4I4X A;  3WMU A;  3WIN A;  3O4C A;  4EEE B;  2BFH A;  1PWA A;  1ILR 1;  3OGG A;  3S8J A;  5DVH A;  2MIB A;  1IJT A;  3VSF A;  1HKN A;  2X2S A;  1G9B A;  3K1X A;  3AKF A;  3JUT A;  3V0B B;  3FUO A;  3FGM A;  4I6I A;  1W3A A;  2E4M C;  2KLL A;  1IHK A;  2D44 A;  4OUJ A;  1TP0 A;  4TLP A;  1RG8 A;  4Z8S B;  3VT2 A;  4G6J A;  1IIL A;  3P53 A;  4J23 B;  4J2X A;  3O5W B;  3HAL A;  3ZXG A;  3V79 C;  3OBR A;  2L5X A;  4G9M A;  4QO3 A;  2FO1 A;  1BFG A;  1MD6 A;  4ZFW B;  3R4U A;  3AZW A;  3FJK A;  3V0B A;  4LO7 B;  4D0T A;  3I2A A;  3NBD A;  1M16 A;  3Q7X A;  1FQ9 A;  3Q7Y A;  2KI4 A;  3IIR A;  2ZR1 B;  5I1B A;  4IZE A;  1AVU A;  1BA7 A;  4XFU A;  4USP A;  5F8W A;  4QBV A;  3VSZ A;  3IM5 A;  3O4O A;  4Z9W B;  3T8S A;  1AVW B;  2NP0 A;  2FFU A;  3UD9 A;  1K5U A;  1WBA A;  2BEB A;  1G9D A;  1R8O A;  1ISY A;  3W9T A;  3BA4 A;  4OEF A;  1IRP A;  4GAI A;  4OEG A;  3BA5 A;  5F8S A;  3ILA A;  4J2K A;  4JKX B;  1L2H A;  4I4R A;  2MLL B;  3RMX A;  1RML A;  1S0L A;  4G9N A;  3HSM A;  1J0S A;  1P63 A;  3UD7 A;  2RQ9 A;  3H6R B;  3PUB A;  4DCK C;  4MZF B;  2VUA A;  4QC4 A;  4ZFU B;  3FJD A;  3JRR A;  3POK A;  1A8D A;  1YBI A;  2GZB A;  4ZBV B;  4A7Z A;  2Y9X E;  4XFS A;  3ZC9 A;  1K5V A;  1W3G A;  1E0O A;  1M2T B;  4P6A A;  1SR4 A;  3FJH A;  3BB2 A;  2VXT I;  3D7W B;  3RTJ B;  3MAL A;  3SNV A;  1PZZ A;  1ISX A;  2NZ9 A;  4X38 A;  3AH1 A;  4EKX B;  4D8H A;  3S8K A;  3UJ0 A;  4ISQ A;  3RMY A;  4PC4 A;  31BI A;  2Q3N B;  3LTQ A;  1XG6 A;  1T4Q A;  3FJI A;  4I96 A;  4HJJ A;  2ERM A;  3H6R A;  1DFC A;  2D24 A;  2QYI B;  1S0B A;  2KI6 B;  3O4B A;  2D43 A;  1YTO A;  4LO0 A;  5D63 A;  1HWN B;  4HR6 C;  1Z4S A;  1YYN A;  2LIQ A;  4UY4 A;  4J2Y A;  1V6X A;  2Y9W C;  3RSJ A;  4IY9 A;  2FFV A;  4FGF A;  2D1Z A;  1YXW A;  4LO1 C;  4L4H A;  1BFC A;  1EPW A;  4JP0 A;  5BVP I;  3FUQ A;  2I1B A;  1CE7 B;  2DRY A;  1I1E A;  2WBC A;  4FVV A;  1PC8 B;  3OBT A;  3BAU A;  4JKQ A;  1V6U A;  2F2F C;  5HPZ A;  3BRG C;  3CAH A;  5BXR A;  3FJJ A;  3HOM A;  3BAO A;  1AXM A;  1ABR B;  3N7J A;  1HWP B;  3UJ4 A;  3P6I A;  1ISZ A;  1IOB A;  3CRH A;  4KEI A;  2P23 A;  3CA6 A;  4OWL A;  5BQU A;  1EYL A;  4ZA3 B;  3CU1 B;  3A21 A;  3AH4 A;  2IWT B;  4QAL A;  5BP5 C;  1JLY A;  3ZXD A;  3KMV A;  4XFT A;  1KNM A;  1F31 A;  5FNX A;  1JQZ A;  1FN0 A;  4Q9G A;  1YF8 B;  4END A;  4P0J A;  5BXP A;  5EC5 A;  4I4S A;  3E8L C;  1S0D A;  4DEN A;  4LO8 B;  4USO A;  4A7Y A;  4MZG B;  2D20 A;  3BX1 C;  1ONK B;  4I4P A;  3A07 A;  3R4S A;  3FJ9 A;  3HBW A;  4D0Z A;  2NTD A;  3CA3 A;  2D7R A;  5BXT A;  1ISW A;  4ZLB B;  1TWM A;  4LO2 A;  2AQZ A;  41BI A;  4LO3 A;  3WIN C;  1BLD A;  1ITB A;  1JT7 A;  2Z48 A;  3AZV A;  1IT0 A;  3FJA A;  4QD2 C;  4JAW A;  2J3P A;  1N4K A;  4EFQ A;  1TTU A;  4KC3 A;  3UD8 A;  4EFP A;  4I37 A;  5FZZ A;  1QQK A;  3Q7W A;  2FDB M;  4JQ0 A;  3O4D A;  1OQL B;  5BXS A;  3IAG C;  1FMZ A;  1SZ6 B;  4I8M A;  1DFQ A;  1JT3 A;  5DUY A;  3I29 B;  21BI A;  4IY8 A;  4I1B A;  3I2X A;  3BAH A;  1NUN A;  2AAI B;  4R6U B;  4GP0 A;  1TIE A;  1UPS A;  2WRY A;  3VUO A;  1QXM A;  2ET2 A;  2VLC A;  1RY7 A;  4I4Q A;  8I1B A;  1DJS B;  1JT5 A;  1XHB A;  2K43 A;  2M49 A;  3FJE A;  3IM7 A;  5FZY A;  4LO1 A;  5DZU A;  4OWJ A;  2Q9X A;  3OJM A;  4ZGR B;  3OJ2 A;  3ZX7 A;  5FZU A;  4F34 A;  1JT4 A;  2R9K B;  4GP3 A;  4I4Y A;  1G82 A;  2F2F A;  4H04 A;  4QBC A;  4G6M A;  2VXR A;  2FGF A;  2HZ9 A;  1S0C A;  2HWA A;  1Q04 A;  2F8X C;  3FJ8 A;  4I4U A;  1FV2 A;  4F83 A;  7I1B A;  4A7K A;  4IYB A;  2E4M A;  3FFZ A;  1BFF A;  3HN1 A;  3BRD A;  1BAS A;  1DZC A;  2UUS A;  3FJC A;  3B9U A;  5DSS B;  5G00 A;  5BOW A;  1TFM B;  3CA4 A;  1BAR A;  4H75 A;  1FWV A;  5EHA A;  1SR4 C;  1FWU A;  4QD2 B;  2HWM A;  3H6Q A;  1AVA C;  2VSE A;  3O44 A;  5F8Y A;  3WA1 A;  4QKR A;  1PUU B;  4DEP A;  3A22 A;  3TC2 A;  3FJB A;  3V0A B;  2LIE A;  3QR5 A;  4I2S A;  3LLP A;  3PHZ A;  4I4O A;  1G9A A;  1AFC A;  1WD3 A;  1JTC A;  1DIW A;  1FMM S;  3C9Z A;  1RZO B;  4EFR A;  1T9F A;  1S0E A;  5B2H A;  4LO0 C;  2GO2 A;  2MC2 A;  4G1R A;  3CRG A;  2DRE A;  4OW4 A;  1AF9 A;  9ILB A;  4II0 A;  4J2S A;  1DZD A;  4Q91 A;  4IHZ A;  4KBB A;  2BEA A;  3WO2 A;  4H9W A;  1PUM B;  5FNW A;  3F62 B;  4WBC A;  3WMV A;  3V0A A;  3FJF A;  2Y9F A;  2NYY A;  4OEE A;  1DLL A;  3OGF A;  3VT1 A;  1S0F A;  1CVS A;  2Z49 A;  4L4I A;  4KEK A;  1V6V A;  4GAF A;  3O49 A;  2VU9 A;  3CA5 A;  4JRA A;  3AKI A;  3CQA A;  1TWE A;  3NJ5 A;  4I4V A;  1XZZ A;  3N7L A;  3EF2 A;  3VT0 A;  2Y9G A;  3BAG A;  3PME A;  4I1E A;  5GAQ A;  5F90 A;  4P0L A;  2AFG A;  4X37 A;  3CA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...