4AOWA

Crystal structure of the human rack1 protein at a resolution of 2.45 angstrom
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
312
structure length
305
Chain Sequence
EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human Rack1 Protein at a Resolution of 2.45 A.
pubmed doi rcsb
molecule keywords GUANINE NUCLEOTIDE-BINDING PROTEIN SUBUNIT BETA-2-LIKE 1
molecule tags Receptor
source organism Homo sapiens
total genus 76
structure length 305
sequence length 312
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4aowA01
4OWRA 3L4OD 4ZOXA 3ULEC 5EM2A 3EI3B 2H3XA 2P9SC 4JT5C 3C75H 2Z2NA 2AH1A 3JZNA 5EALA 3UVOA 3JZGA 4ZOVA 2PM7B 3N0EA 2HESX 4BL0A 3UVMA 1ERJA 3DWLC 1A0RB 4QRJA 4Y5RD 2IAAA 3EG6A 3VH0A 2G99A 4TZ4A 4U1EI 5TF2A 3SXTD 2XU7A 5H14A 5FKRA 4JT6C 2HKMA 1MG2A 4FB1D 4UI9R 2AGLA 1PGUA 2CO0C 2H47A 3PXSD 3MZLA 3AH8B 4ES0A 4JSVC 5CXBA 1SHYB 2I0RA 3RFGA 1MDAH 4JSPC 4JSXC 3SBPA 3F3PA 5FLXg 3DM0A 2AGWA 3UKRC 3AL9A 3EI1A 3N0DA 3KRXB 4J86A 2PM9B 5IT9g 2H68A 4J87A 3C99A 2HXCA 1PBYB 4XYIA 4CI1A 4PBZA 3EI2A 3CFVA 5C9ZB 2G9AA 2H9PA 4XEIC 5H17A 3EI4A 5CXCB 1JJUB 3JRPA 4QL1A 3SLED 4FA4D 2B4EA 4Z8LA 3UVLA 5GSAA 1XIPA 2P9IC 4CY1A 2IURA 2YNOA 3J81g 4ERYA 1FWXA 2XL3A 2CE9A 2H9NA 3HFQA 2I0SA 4PSXB 1RI6A 4HDJA 3NVXA 3JROA 1SQJA 3PSCB 3V7DB 2GC7A 4IMMA 5K19A 2J57G 4NSXA 3VGZA 3MKSB 2IWKA 3SFZA 3PXTD 4YVDA 2EBSA 4A7JA 2OVRB 1VYHC 3VA6A 1NEXB 2HJBA 2AGYA 4E5ZB 4E54A 4A08B 4EWRA 3OL2B 1Q47A 3AL8B 5HYNB 5K1CC 2CNXA 5A2Qg 3UR4A 5I5MA 4H5IA 3IKOA 2H14A 4X3EA 5EMJB 3SMRA 4A0BB 4GQBB 4PBYA 1QNIA 3C9CA 2HJ4A 5CYKA 2XYIA 5TEEA 5I5IA 5EARA 2B5LA 3SVWD 3MMYA 4FA9D 4J77A 4GGCA 4J81A 3MZKA 4CZXA 4FWWA 4J8GA 2CE8A 3UKUC 4CI2A 3L4MD 1JOFA 4J8BA 3IJ1A 3EI3A 2P9LC 4I79A 4K3ID 4FHLA 2XL2A 4GM3A 3J80g 4GMBA 3W15A 3I8EA 2CO0A 3SBRA 2I3TA 3JB9L 3FGBA 4CI8A 2W18A 4JXMA 3BG0A 3GREA 4JSNC 4O9DA 5AFU3 2YB8B 1K8KC 1N6DA 2I0TA 2OVPB 3MXXA 1GP2B 3SWSD 1B9XA 2TRCB 4X63B 5GXHA 4D0KA 4PXWA 4X60B 3JPXA 3AFCA 3I7LA 3F3FA 4GQ1A 5IJ7E 4GZ8A 5HE2B 3DSMA 4MK0B 2Z2OA 2GNQA 5KDOB 2I3SA 4ZOZA 2UZYB 4U7AA 3EMHA 4AOWA 2YMUA 2OIZA 4L3HD 4CY2A 2H13A 3F3GA 5FXYA 4A0AB 3PVWB 3ZWLB 3KRWB 2BCJB 1OLZA 5FKQA 2PM9A 1L0QA 4CZVA 4GQ2P 5IJ8E 4Y7RA 4ZN4A 4LG9A 4PNKB 2PBIB 2Q7QA 2OK6A 2HKRA 5IC7A 3EU7A 5CXCA 5GMKn 4ZOYA 2B5NA 1PI6A 5FKTA 5IGOA 4A09B 3IIWA 2YNNA 1XKSA 3UVKA 3K27A 1P22A 4OZUA 4PSWB 3BWSA 4ERZA 4A11B 3E0CA 2IUQA 5FA5B 2H9MA 1JMXB 3PSLA 3IJCA 3NVQA 3OKWA 4FAVD 5TDHB 3UVNA 4K3JB 3OKYB 4PC0A 1TYQC 4J82A 3I7KA 1TBGA 4O1QD 5EM2B 2MTAH 4GM9A 3RMZD 4O45A 3I7OA 3I89A 5SXMA 4E5ZA 2J56H 4A08A 4H5JA 2J55H 1JMZB 2OK4A 3B7FA 3I2NA 3OL2A 3A0FA 3AL8A 4GGAA 5THAA 5HE1B 5EMLB 4X61B 4D6VA 1OMWB 5GXIA 4FA5D 3JZHA 2Z2PA 4CY3A 3RFHA 4A0BA 3RN0D 4FAND 5AMSA 1GXRA 5IGQA 5EMMB 4FA1D 2HYEA 3DXMC 4J79A 3I7PA 2H6QA 4J84A 2H6KA 2QXVA 4O3UB 1N6EA 4CI3A 5CXBB 3MKQA 3I8CA 5TEFA 3C5MA 1N6FA 3JAMg 2PM6B 2P9KC 3RSEC 3SCYA 5C2WB 3EI1B 3V9FA 4CC9A 3OTTA 3FRXA 3RN1D 4GGDA 2H9LA 5EAPA 5FQDA 5EAMA 3V5WB 4JD2C 4L3GD 2H6NA 5H1MA 3DXKC 4L9OA 3RLMD 2YNPA 1PEVA 3EI2B 3EI4B 2AGZA 2P9UC 3SBQA 3CFSB 3SN6B 4QT8A 2UZXB 1GOTB 5I5JA 2OVQB 4QQEA 2AGXA 3K26A 1K32A 1YFQA 4AEZA 5HQGA 3SJLD 2BBKH 4BH6A 4XYHA 3GFCA 3RRMC 3ODTA 4J0XA 3I7HA 3ORVD 5AJAA 4O3TB 4J73A 1NR0A 2B5MA 4LG8A 5HE3B 3PXWD 4J78A 3IJ0A 4L1QD 1R5MA 2IUPA 2QC5A 4A0AA 2IUVA 4CY5A 1B9YA 4J0WA 1S4UX 3EWEA 4A2MA 2O9KA 3OKTA 4LGNA 4IA9A 4E54B 3BG1A 5EMKB 3U4YA 4G56B 4N14A 4ESGA 4KFMB 4A2LA 1U4CA 3FM0A 2CN2A 2P9NC 2P9PC 2CN3A 1SQ9A 4A09A 2AQ5A 4ERQA 3IIYA 3OW8A 2GC4A 4R7AB 1GG2B 5B4WA 5FKSA 5CYKB 1XHMA 5C2VB 5JWZA 3PE7A 1MG3A 4A11A 4CZYA 3NVNA 4BUJC 3PVUB 4GM8A 1U2VC 3SHFA 2AH0A 2YBAA 2IWFA 3CIKB 3P4FA 3I7NA 2OJYA 5HE0B 3OKYA
chains in the Genus database with same CATH superfamily
2HU8A 4OWRA 3L4OD 4ZOXA 3ULEC 5EM2A 3EI3B 2H3XA 4WK2A 2P9SC 4JT5C 2EIEA 3C75H 1UOOA 2Z2NA 2XDWA 2AH1A 1VE7A 3JZNA 5EALA 3UVOA 3JZGA 4ZOVA 3T3MA 2PM7B 3N0EA 2HESX 1O6GA 3UVMA 4BL0A 4MMXA 1ERJA 3DWLC 1A0RB 4QRJA 3QI0A 4Y5RD 2IAAA 3FCUA 3EG6A 3VH0A 2G99A 4JHPC 4TZ4A 4U1EI 5TF2A 4WK4A 3SXTD 2XU7A 3DDUA 5H14A 5FKRA 4JT6C 2HKMA 1MG2A 3IUJA 4FB1D 2EIDA 4UI9R 2AGLA 4UM8A 4RE5A 1PGUA 2CO0C 2H47A 3PXSD 1BPOA 3O4HA 3MZLA 3AH8B 1QFMA 4AMYA 4ES0A 4JSVC 5CXBA 5HDBA 3GD1I 1SHYB 2I0RA 3RFGA 1MDAH 4JSPC 4JSXC 3SBPA 3MUOA 3F3PA 5FLXg 3DM0A 4Z7QA 2AGWA 3UKRC 3AL9A 3EI1A 3N0DA 1H2WA 3KRXB 4J86A 2PM9B 5IT9g 2H68A 4J87A 3C99A 1E5TA 1PBYB 2HXCA 4XYIA 4CI1A 4PBZA 3NIDA 4D9SA 3EI2A 4G1MA 3CFVA 5C9ZB 1UOPA 2G9AA 2H9PA 3MVDK 4XEIC 4NAAA 4O2WA 5H17A 3EI4A 5CXCB 1JJUB 3JRPA 4QL1A 3SLED 4FA4D 2B4EA 4Z8LA 3UVLA 5GSAA 1XIPA 2P9IC 4CY1A 2IURA 4BCCA 3IUNA 3O4IA 2YNOA 4AMZA 3J81g 4ERYA 4BP9A 1VZ2A 1FWXA 2XL3A 2CE9A 2H9NA 3HFQA 2I0SA 4PSXB 1RI6A 4HDJA 4Z7OA 3JROA 3NVXA 3EQ7A 1SQJA 3PSCB 3V7DB 2GC7A 4IMMA 5K19A 2J57G 4NSXA 4AN1A 1U8CA 3VGZA 5M5SA 2VDPA 3MKSB 1A12A 2IWKA 3SFZA 3PXTD 4YVDA 2EBSA 4A7JA 2OVRB 1VYHC 3VA6A 1NEXB 2HJBA 2AGYA 4E5ZB 4E54A 2HU5A 4A08B 4EWRA 3OL2B 1Q47A 3IULA 5FFGA 3AL8B 5HYNB 5K1CC 2CNXA 5A2Qg 3UR4A 5I5MA 1H2XA 4H5IA 3IKOA 2H14A 4X3EA 5EMJB 3SMRA 4A0BB 3K72A 4GQBB 4L1MA 1C9LA 4PBYA 1QNIA 4JHNA 3C9CA 4MMYA 2HJ4A 5CYKA 2XYIA 5TEEA 5I5IA 5EARA 1O6FA 2B5LA 3IUMA 3SVWD 5C92A 3MMYA 4WK0A 4FA9D 5M5UA 4J77A 4WJKA 4GGCA 4J81A 4O02A 3MZKA 4CZXA 4FWWA 4J8GA 2CE8A 3UKUC 3ZE0A 3IJEA 4CI2A 3L4MD 1JOFA 4J8BA 3GC3B 3IJ1A 4QAMA 3EI3A 2P9LC 4I79A 4K3ID 4FHLA 2XL2A 4GM3A 3J80g 4GMBA 3W15A 3O4JA 3I8EA 3K6SA 2CO0A 3SBRA 2I3TA 3JB9L 3ZE1A 2VZ3A 3FGBA 4CI8A 4MMZA 3T3PA 2W18A 4JXMA 3BG0A 1I2MB 3GREA 4JSNC 4O9DA 1VE6A 5AFU3 5M5TA 2BKLA 2YB8B 1K8KC 1N6DA 2I0TA 2WQ8A 4NBMA 2OVPB 3MXXA 1GP2B 3SWSD 2VDQA 1B9XA 2TRCB 4X63B 5GXHA 4D0KA 4G55A 4PXWA 4X60B 3JPXA 3AFCA 3I7LA 3F3FA 4GQ1A 5IJ7E 4GZ8A 5HE2B 3EQ9A 3DSMA 4MK0B 2Z2OA 2GNQA 5KDOB 2I3SA 4ZOZA 2UZYB 4U7AA 3EMHA 4AOWA 4BCDA 2YMUA 2OIZA 4L3HD 4CY2A 2H13A 3F3GA 2QR5A 5FXYA 5E6RA 4A0AB 3PVWB 3ZWLB 3KRWB 2BCJB 1OLZA 5FKQA 2PM9A 1L0QA 4CZVA 4GQ2P 5IJ8E 4Y7RA 4ZN4A 3KCIA 1TYEA 4LG9A 4PNKB 3NIFA 2PBIB 2Q7QA 2OK6A 2HKRA 5IC7A 3EU7A 4Z7NA 5CXCA 5GMKn 4ZOYA 1PI6A 2B5NA 5FKTA 5IGOA 4A09B 3IIWA 2VDMA 2YNNA 1XKSA 3UVKA 3IUQA 3K27A 1P22A 4OZUA 2XE4A 5C86A 3QHYB 4PSWB 3BWSA 4ERZA 4A11B 3E0CA 2IUQA 5FA5B 2H9MA 2VDOA 1JMXB 3PSLA 3IJCA 3NVQA 3OKWA 1L5GA 5E6UA 4FAVD 5TDHB 3UVNA 4K3JB 3FCSA 3OKYB 4PC0A 1TYQC 1UTCA 4J82A 1M1XA 3I7KA 1TBGA 4O1QD 5EM2B 2MTAH 4GM9A 3O4GA 3RMZD 4O45A 3I7OA 3OF7A 1UOQA 3I89A 1C9IA 5SXMA 4E5ZA 3K71A 2J56H 4A08A 4H5JA 2J55H 1JMZB 2OK4A 3B7FA 1H2YA 3EQ8A 3I2NA 3OL2A 3A0FA 3NIGA 3AL8A 4GGAA 5THAA 5HE1B 5EMLB 4X61B 4D6VA 3MUNA 1OMWB 5GXIA 4FA5D 3JZHA 2Z2PA 4CY3A 3RFHA 4A0BA 3RN0D 4FAND 3V4VA 1E8NA 5AMSA 1GXRA 5IGQA 1T2XA 5EMMB 4FA1D 2EIBA 3DXMC 2HYEA 4J79A 3I7PA 2H6QA 4J84A 2H6KA 2QXVA 4O3UB 1N6EA 4CI3A 2VZ1A 5CXBB 3MKQA 3I8CA 4RE6A 5TEFA 3ZE2A 3C5MA 1N6FA 3JAMg 2PM6B 2P9KC 3RSEC 1K3IA 3SCYA 5C2WB 3EI1B 3V9FA 2JKXA 4CC9A 4DNWA 3OTTA 3FRXA 3RN1D 4GGDA 2H9LA 5EAPA 5FQDA 5EAMA 3V5WB 4JD2C 4L3GD 4DNUA 2H6NA 5H1MA 3DXKC 4L9OA 2VDKA 3RLMD 3ZDXA 2YNPA 1PEVA 3EI2B 3EI4B 2AGZA 2P9UC 4NC4A 3CFSB 3SBQA 4QT8A 2UZXB 5M61A 3SN6B 1GOTB 5I5JA 2OVQB 4QQEA 2AGXA 3VI4A 3K26A 1K32A 1YFQA 4AEZA 5HQGA 3SJLD 2BBKH 1E8MA 4IRZA 4BH6A 4XYHA 3GFCA 3RRMC 3ODTA 4J0XA 3I7HA 3ORVD 5AJAA 1QFSA 4O3TB 4J73A 1NR0A 4DNVA 2B5MA 4LG8A 3IURA 5HE3B 3PXWD 2VDLA 2VDRA 2VDNA 4J78A 3IJ0A 4L1QD 4AX4A 5FFOA 1R5MA 2IUPA 2QC5A 4A0AA 2IUVA 1JTDB 4CY5A 1B9YA 1GOHA 4J0WA 5E6SA 1S4UX 3EWEA 4A2MA 4UM9A 3IVMA 2HU7A 2O9KA 3OKTA 4LGNA 4G1EA 4IA9A 4E54B 2XZGA 3BG1A 5EMKB 3U4YA 4G56B 4N14A 4ESGA 2EICA 4NENA 4KFMB 4A2LA 1YR2A 1U4CA 3FM0A 5M5RA 2CN2A 2P9NC 2P9PC 3ZDZA 2CN3A 1SQ9A 2QZPA 2AQ5A 4A09A 1GOFA 3IIYA 3V4PA 3ZDYA 4ERQA 3OW8A 2GC4A 4R7AB 1GG2B 1VZ3A 4BP8A 5B4WA 5FKSA 4BCBA 5CYKB 1XHMA 1JV2A 5C2VB 5JWZA 3PE7A 1GOGA 1MG3A 4A11A 2VC2A 4CZYA 3NVNA 4BUJC 5M5VA 3PVUB 4GM8A 3VI3A 1U2VC 3SHFA 2AH0A 1H2ZA 2YBAA 2IWFA 3CIKB 3P4FA 3I7NA 2OJYA 5HE0B 4AN0A 3OKYA
chains in the Genus database with same CATH topology
4OWRA 3L4OD 4ZOXA 3ULEC 5EM2A 3EI3B 2H3XA 2P9SC 4JT5C 3C75H 2Z2NA 2AH1A 3JZNA 5EALA 3UVOA 3JZGA 4ZOVA 2PM7B 3N0EA 2HESX 4BL0A 3UVMA 1ERJA 3DWLC 1A0RB 4QRJA 4Y5RD 2IAAA 3EG6A 3VH0A 2G99A 4TZ4A 4U1EI 5TF2A 3SXTD 2XU7A 5H14A 5FKRA 4JT6C 2HKMA 1MG2A 4FB1D 4UI9R 2AGLA 1PGUA 2CO0C 2H47A 3PXSD 3MZLA 3AH8B 4ES0A 4JSVC 5CXBA 1SHYB 2I0RA 3RFGA 1MDAH 4JSPC 4JSXC 3SBPA 3F3PA 5FLXg 3DM0A 2AGWA 3UKRC 3AL9A 3EI1A 3N0DA 3KRXB 4J86A 2PM9B 5IT9g 2H68A 4J87A 3C99A 2HXCA 1PBYB 4XYIA 4CI1A 4PBZA 3EI2A 3CFVA 5C9ZB 2G9AA 2H9PA 4XEIC 5H17A 3EI4A 5CXCB 1JJUB 3JRPA 4QL1A 3SLED 4FA4D 2B4EA 4Z8LA 3UVLA 5GSAA 1XIPA 2P9IC 4CY1A 2IURA 2YNOA 3J81g 4ERYA 1FWXA 2XL3A 2CE9A 2H9NA 3HFQA 2I0SA 4PSXB 1RI6A 4HDJA 3NVXA 3JROA 1SQJA 3PSCB 3V7DB 2GC7A 4IMMA 5K19A 2J57G 4NSXA 3VGZA 3MKSB 2IWKA 3SFZA 3PXTD 4YVDA 2EBSA 4A7JA 2OVRB 1VYHC 3VA6A 1NEXB 2HJBA 2AGYA 4E5ZB 4E54A 4A08B 4EWRA 3OL2B 1Q47A 3AL8B 5HYNB 5K1CC 2CNXA 5A2Qg 3UR4A 5I5MA 4H5IA 3IKOA 2H14A 4X3EA 5EMJB 3SMRA 4A0BB 4GQBB 4PBYA 1QNIA 3C9CA 2HJ4A 5CYKA 2XYIA 5TEEA 5I5IA 5EARA 2B5LA 3SVWD 3MMYA 4FA9D 4J77A 4GGCA 4J81A 3MZKA 4CZXA 4FWWA 4J8GA 2CE8A 3UKUC 4CI2A 3L4MD 1JOFA 4J8BA 3IJ1A 3EI3A 2P9LC 4I79A 4K3ID 4FHLA 2XL2A 4GM3A 3J80g 4GMBA 3W15A 3I8EA 2CO0A 3SBRA 2I3TA 3JB9L 3FGBA 4CI8A 2W18A 4JXMA 3BG0A 3GREA 4JSNC 4O9DA 5AFU3 2YB8B 1K8KC 1N6DA 2I0TA 2OVPB 3MXXA 1GP2B 3SWSD 1B9XA 2TRCB 4X63B 5GXHA 4D0KA 4PXWA 4X60B 3JPXA 3AFCA 3I7LA 3F3FA 4GQ1A 5IJ7E 4GZ8A 5HE2B 3DSMA 4MK0B 2Z2OA 2GNQA 5KDOB 2I3SA 4ZOZA 2UZYB 4U7AA 3EMHA 4AOWA 2YMUA 2OIZA 4L3HD 4CY2A 2H13A 3F3GA 5FXYA 4A0AB 3PVWB 3ZWLB 3KRWB 2BCJB 1OLZA 5FKQA 2PM9A 1L0QA 4CZVA 4GQ2P 5IJ8E 4Y7RA 4ZN4A 4LG9A 4PNKB 2PBIB 2Q7QA 2OK6A 2HKRA 5IC7A 3EU7A 5CXCA 5GMKn 4ZOYA 2B5NA 1PI6A 5FKTA 5IGOA 4A09B 3IIWA 2YNNA 1XKSA 3UVKA 3K27A 1P22A 4OZUA 4PSWB 3BWSA 4ERZA 4A11B 3E0CA 2IUQA 5FA5B 2H9MA 1JMXB 3PSLA 3IJCA 3NVQA 3OKWA 4FAVD 5TDHB 3UVNA 4K3JB 3OKYB 4PC0A 1TYQC 4J82A 3I7KA 1TBGA 4O1QD 5EM2B 2MTAH 4GM9A 3RMZD 4O45A 3I7OA 3I89A 5SXMA 4E5ZA 2J56H 4A08A 4H5JA 2J55H 1JMZB 2OK4A 3B7FA 3I2NA 3OL2A 3A0FA 3AL8A 4GGAA 5THAA 5HE1B 5EMLB 4X61B 4D6VA 1OMWB 5GXIA 4FA5D 3JZHA 2Z2PA 4CY3A 3RFHA 4A0BA 3RN0D 4FAND 5AMSA 1GXRA 5IGQA 5EMMB 4FA1D 2HYEA 3DXMC 4J79A 3I7PA 2H6QA 4J84A 2H6KA 2QXVA 4O3UB 1N6EA 4CI3A 5CXBB 3MKQA 3I8CA 5TEFA 3C5MA 1N6FA 3JAMg 2PM6B 2P9KC 3RSEC 3SCYA 5C2WB 3EI1B 3V9FA 4CC9A 3OTTA 3FRXA 3RN1D 4GGDA 2H9LA 5EAPA 5FQDA 5EAMA 3V5WB 4JD2C 4L3GD 2H6NA 5H1MA 3DXKC 4L9OA 3RLMD 2YNPA 1PEVA 3EI2B 3EI4B 2AGZA 2P9UC 3SBQA 3CFSB 3SN6B 4QT8A 2UZXB 1GOTB 5I5JA 2OVQB 4QQEA 2AGXA 3K26A 1K32A 1YFQA 4AEZA 5HQGA 3SJLD 2BBKH 4BH6A 4XYHA 3GFCA 3RRMC 3ODTA 4J0XA 3I7HA 3ORVD 5AJAA 4O3TB 4J73A 1NR0A 2B5MA 4LG8A 5HE3B 3PXWD 4J78A 3IJ0A 4L1QD 1R5MA 2IUPA 2QC5A 4A0AA 2IUVA 4CY5A 1B9YA 4J0WA 1S4UX 3EWEA 4A2MA 2O9KA 3OKTA 4LGNA 4IA9A 4E54B 3BG1A 5EMKB 3U4YA 4G56B 4N14A 4ESGA 4KFMB 4A2LA 1U4CA 3FM0A 2CN2A 2P9NC 2P9PC 2CN3A 1SQ9A 4A09A 2AQ5A 4ERQA 3IIYA 3OW8A 2GC4A 4R7AB 1GG2B 5B4WA 5FKSA 5CYKB 1XHMA 5C2VB 5JWZA 3PE7A 1MG3A 4A11A 4CZYA 3NVNA 4BUJC 3PVUB 4GM8A 1U2VC 3SHFA 2AH0A 2YBAA 2IWFA 3CIKB 3P4FA 3I7NA 2OJYA 5HE0B 3OKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OWR A;  3L4O D;  4ZOX A;  3ULE C;  5EM2 A;  3EI3 B;  2H3X A;  2P9S C;  4JT5 C;  3C75 H;  2Z2N A;  2AH1 A;  3JZN A;  5EAL A;  3UVO A;  3JZG A;  4ZOV A;  2PM7 B;  3N0E A;  2HES X;  4BL0 A;  3UVM A;  1ERJ A;  3DWL C;  1A0R B;  4QRJ A;  4Y5R D;  2IAA A;  3EG6 A;  3VH0 A;  2G99 A;  4TZ4 A;  4U1E I;  5TF2 A;  3SXT D;  2XU7 A;  5H14 A;  5FKR A;  4JT6 C;  2HKM A;  1MG2 A;  4FB1 D;  4UI9 R;  2AGL A;  1PGU A;  2CO0 C;  2H47 A;  3PXS D;  3MZL A;  3AH8 B;  4ES0 A;  4JSV C;  5CXB A;  1SHY B;  2I0R A;  3RFG A;  1MDA H;  4JSP C;  4JSX C;  3SBP A;  3F3P A;  5FLX g;  3DM0 A;  2AGW A;  3UKR C;  3AL9 A;  3EI1 A;  3N0D A;  3KRX B;  4J86 A;  2PM9 B;  5IT9 g;  2H68 A;  4J87 A;  3C99 A;  2HXC A;  1PBY B;  4XYI A;  4CI1 A;  4PBZ A;  3EI2 A;  3CFV A;  5C9Z B;  2G9A A;  2H9P A;  4XEI C;  5H17 A;  3EI4 A;  5CXC B;  1JJU B;  3JRP A;  4QL1 A;  3SLE D;  4FA4 D;  2B4E A;  4Z8L A;  3UVL A;  5GSA A;  1XIP A;  2P9I C;  4CY1 A;  2IUR A;  2YNO A;  3J81 g;  4ERY A;  1FWX A;  2XL3 A;  2CE9 A;  2H9N A;  3HFQ A;  2I0S A;  4PSX B;  1RI6 A;  4HDJ A;  3NVX A;  3JRO A;  1SQJ A;  3PSC B;  3V7D B;  2GC7 A;  4IMM A;  5K19 A;  2J57 G;  4NSX A;  3VGZ A;  3MKS B;  2IWK A;  3SFZ A;  3PXT D;  4YVD A;  2EBS A;  4A7J A;  2OVR B;  1VYH C;  3VA6 A;  1NEX B;  2HJB A;  2AGY A;  4E5Z B;  4E54 A;  4A08 B;  4EWR A;  3OL2 B;  1Q47 A;  3AL8 B;  5HYN B;  5K1C C;  2CNX A;  5A2Q g;  3UR4 A;  5I5M A;  4H5I A;  3IKO A;  2H14 A;  4X3E A;  5EMJ B;  3SMR A;  4A0B B;  4GQB B;  4PBY A;  1QNI A;  3C9C A;  2HJ4 A;  5CYK A;  2XYI A;  5TEE A;  5I5I A;  5EAR A;  2B5L A;  3SVW D;  3MMY A;  4FA9 D;  4J77 A;  4GGC A;  4J81 A;  3MZK A;  4CZX A;  4FWW A;  4J8G A;  2CE8 A;  3UKU C;  4CI2 A;  3L4M D;  1JOF A;  4J8B A;  3IJ1 A;  3EI3 A;  2P9L C;  4I79 A;  4K3I D;  4FHL A;  2XL2 A;  4GM3 A;  3J80 g;  4GMB A;  3W15 A;  3I8E A;  2CO0 A;  3SBR A;  2I3T A;  3JB9 L;  3FGB A;  4CI8 A;  2W18 A;  4JXM A;  3BG0 A;  3GRE A;  4JSN C;  4O9D A;  5AFU 3;  2YB8 B;  1K8K C;  1N6D A;  2I0T A;  2OVP B;  3MXX A;  1GP2 B;  3SWS D;  1B9X A;  2TRC B;  4X63 B;  5GXH A;  4D0K A;  4PXW A;  4X60 B;  3JPX A;  3AFC A;  3I7L A;  3F3F A;  4GQ1 A;  5IJ7 E;  4GZ8 A;  5HE2 B;  3DSM A;  4MK0 B;  2Z2O A;  2GNQ A;  5KDO B;  2I3S A;  4ZOZ A;  2UZY B;  4U7A A;  3EMH A;  4AOW A;  2YMU A;  2OIZ A;  4L3H D;  4CY2 A;  2H13 A;  3F3G A;  5FXY A;  4A0A B;  3PVW B;  3ZWL B;  3KRW B;  2BCJ B;  1OLZ A;  5FKQ A;  2PM9 A;  1L0Q A;  4CZV A;  4GQ2 P;  5IJ8 E;  4Y7R A;  4ZN4 A;  4LG9 A;  4PNK B;  2PBI B;  2Q7Q A;  2OK6 A;  2HKR A;  5IC7 A;  3EU7 A;  5CXC A;  5GMK n;  4ZOY A;  2B5N A;  1PI6 A;  5FKT A;  5IGO A;  4A09 B;  3IIW A;  2YNN A;  1XKS A;  3UVK A;  3K27 A;  1P22 A;  4OZU A;  4PSW B;  3BWS A;  4ERZ A;  4A11 B;  3E0C A;  2IUQ A;  5FA5 B;  2H9M A;  1JMX B;  3PSL A;  3IJC A;  3NVQ A;  3OKW A;  4FAV D;  5TDH B;  3UVN A;  4K3J B;  3OKY B;  4PC0 A;  1TYQ C;  4J82 A;  3I7K A;  1TBG A;  4O1Q D;  5EM2 B;  2MTA H;  4GM9 A;  3RMZ D;  4O45 A;  3I7O A;  3I89 A;  5SXM A;  4E5Z A;  2J56 H;  4A08 A;  4H5J A;  2J55 H;  1JMZ B;  2OK4 A;  3B7F A;  3I2N A;  3OL2 A;  3A0F A;  3AL8 A;  4GGA A;  5THA A;  5HE1 B;  5EML B;  4X61 B;  4D6V A;  1OMW B;  5GXI A;  4FA5 D;  3JZH A;  2Z2P A;  4CY3 A;  3RFH A;  4A0B A;  3RN0 D;  4FAN D;  5AMS A;  1GXR A;  5IGQ A;  5EMM B;  4FA1 D;  2HYE A;  3DXM C;  4J79 A;  3I7P A;  2H6Q A;  4J84 A;  2H6K A;  2QXV A;  4O3U B;  1N6E A;  4CI3 A;  5CXB B;  3MKQ A;  3I8C A;  5TEF A;  3C5M A;  1N6F A;  3JAM g;  2PM6 B;  2P9K C;  3RSE C;  3SCY A;  5C2W B;  3EI1 B;  3V9F A;  4CC9 A;  3OTT A;  3FRX A;  3RN1 D;  4GGD A;  2H9L A;  5EAP A;  5FQD A;  5EAM A;  3V5W B;  4JD2 C;  4L3G D;  2H6N A;  5H1M A;  3DXK C;  4L9O A;  3RLM D;  2YNP A;  1PEV A;  3EI2 B;  3EI4 B;  2AGZ A;  2P9U C;  3SBQ A;  3CFS B;  3SN6 B;  4QT8 A;  2UZX B;  1GOT B;  5I5J A;  2OVQ B;  4QQE A;  2AGX A;  3K26 A;  1K32 A;  1YFQ A;  4AEZ A;  5HQG A;  3SJL D;  2BBK H;  4BH6 A;  4XYH A;  3GFC A;  3RRM C;  3ODT A;  4J0X A;  3I7H A;  3ORV D;  5AJA A;  4O3T B;  4J73 A;  1NR0 A;  2B5M A;  4LG8 A;  5HE3 B;  3PXW D;  4J78 A;  3IJ0 A;  4L1Q D;  1R5M A;  2IUP A;  2QC5 A;  4A0A A;  2IUV A;  4CY5 A;  1B9Y A;  4J0W A;  1S4U X;  3EWE A;  4A2M A;  2O9K A;  3OKT A;  4LGN A;  4IA9 A;  4E54 B;  3BG1 A;  5EMK B;  3U4Y A;  4G56 B;  4N14 A;  4ESG A;  4KFM B;  4A2L A;  1U4C A;  3FM0 A;  2CN2 A;  2P9N C;  2P9P C;  2CN3 A;  1SQ9 A;  4A09 A;  2AQ5 A;  4ERQ A;  3IIY A;  3OW8 A;  2GC4 A;  4R7A B;  1GG2 B;  5B4W A;  5FKS A;  5CYK B;  1XHM A;  5C2V B;  5JWZ A;  3PE7 A;  1MG3 A;  4A11 A;  4CZY A;  3NVN A;  4BUJ C;  3PVU B;  4GM8 A;  1U2V C;  3SHF A;  2AH0 A;  2YBA A;  2IWF A;  3CIK B;  3P4F A;  3I7N A;  2OJY A;  5HE0 B;  3OKY A; 
#chains in the Genus database with same CATH topology
 2HU8 A;  4OWR A;  3L4O D;  4ZOX A;  3ULE C;  5EM2 A;  3EI3 B;  2H3X A;  4WK2 A;  2P9S C;  4JT5 C;  2EIE A;  3C75 H;  1UOO A;  2Z2N A;  2XDW A;  2AH1 A;  1VE7 A;  3JZN A;  5EAL A;  3UVO A;  3JZG A;  4ZOV A;  3T3M A;  2PM7 B;  3N0E A;  2HES X;  1O6G A;  3UVM A;  4BL0 A;  4MMX A;  1ERJ A;  3DWL C;  1A0R B;  4QRJ A;  3QI0 A;  4Y5R D;  2IAA A;  3FCU A;  3EG6 A;  3VH0 A;  2G99 A;  4JHP C;  4TZ4 A;  4U1E I;  5TF2 A;  4WK4 A;  3SXT D;  2XU7 A;  3DDU A;  5H14 A;  5FKR A;  4JT6 C;  2HKM A;  1MG2 A;  3IUJ A;  4FB1 D;  2EID A;  4UI9 R;  2AGL A;  4UM8 A;  4RE5 A;  1PGU A;  2CO0 C;  2H47 A;  3PXS D;  1BPO A;  3O4H A;  3MZL A;  3AH8 B;  1QFM A;  4AMY A;  4ES0 A;  4JSV C;  5CXB A;  5HDB A;  3GD1 I;  1SHY B;  2I0R A;  3RFG A;  1MDA H;  4JSP C;  4JSX C;  3SBP A;  3MUO A;  3F3P A;  5FLX g;  3DM0 A;  4Z7Q A;  2AGW A;  3UKR C;  3AL9 A;  3EI1 A;  3N0D A;  1H2W A;  3KRX B;  4J86 A;  2PM9 B;  5IT9 g;  2H68 A;  4J87 A;  3C99 A;  1E5T A;  1PBY B;  2HXC A;  4XYI A;  4CI1 A;  4PBZ A;  3NID A;  4D9S A;  3EI2 A;  4G1M A;  3CFV A;  5C9Z B;  1UOP A;  2G9A A;  2H9P A;  3MVD K;  4XEI C;  4NAA A;  4O2W A;  5H17 A;  3EI4 A;  5CXC B;  1JJU B;  3JRP A;  4QL1 A;  3SLE D;  4FA4 D;  2B4E A;  4Z8L A;  3UVL A;  5GSA A;  1XIP A;  2P9I C;  4CY1 A;  2IUR A;  4BCC A;  3IUN A;  3O4I A;  2YNO A;  4AMZ A;  3J81 g;  4ERY A;  4BP9 A;  1VZ2 A;  1FWX A;  2XL3 A;  2CE9 A;  2H9N A;  3HFQ A;  2I0S A;  4PSX B;  1RI6 A;  4HDJ A;  4Z7O A;  3JRO A;  3NVX A;  3EQ7 A;  1SQJ A;  3PSC B;  3V7D B;  2GC7 A;  4IMM A;  5K19 A;  2J57 G;  4NSX A;  4AN1 A;  1U8C A;  3VGZ A;  5M5S A;  2VDP A;  3MKS B;  1A12 A;  2IWK A;  3SFZ A;  3PXT D;  4YVD A;  2EBS A;  4A7J A;  2OVR B;  1VYH C;  3VA6 A;  1NEX B;  2HJB A;  2AGY A;  4E5Z B;  4E54 A;  2HU5 A;  4A08 B;  4EWR A;  3OL2 B;  1Q47 A;  3IUL A;  5FFG A;  3AL8 B;  5HYN B;  5K1C C;  2CNX A;  5A2Q g;  3UR4 A;  5I5M A;  1H2X A;  4H5I A;  3IKO A;  2H14 A;  4X3E A;  5EMJ B;  3SMR A;  4A0B B;  3K72 A;  4GQB B;  4L1M A;  1C9L A;  4PBY A;  1QNI A;  4JHN A;  3C9C A;  4MMY A;  2HJ4 A;  5CYK A;  2XYI A;  5TEE A;  5I5I A;  5EAR A;  1O6F A;  2B5L A;  3IUM A;  3SVW D;  5C92 A;  3MMY A;  4WK0 A;  4FA9 D;  5M5U A;  4J77 A;  4WJK A;  4GGC A;  4J81 A;  4O02 A;  3MZK A;  4CZX A;  4FWW A;  4J8G A;  2CE8 A;  3UKU C;  3ZE0 A;  3IJE A;  4CI2 A;  3L4M D;  1JOF A;  4J8B A;  3GC3 B;  3IJ1 A;  4QAM A;  3EI3 A;  2P9L C;  4I79 A;  4K3I D;  4FHL A;  2XL2 A;  4GM3 A;  3J80 g;  4GMB A;  3W15 A;  3O4J A;  3I8E A;  3K6S A;  2CO0 A;  3SBR A;  2I3T A;  3JB9 L;  3ZE1 A;  2VZ3 A;  3FGB A;  4CI8 A;  4MMZ A;  3T3P A;  2W18 A;  4JXM A;  3BG0 A;  1I2M B;  3GRE A;  4JSN C;  4O9D A;  1VE6 A;  5AFU 3;  5M5T A;  2BKL A;  2YB8 B;  1K8K C;  1N6D A;  2I0T A;  2WQ8 A;  4NBM A;  2OVP B;  3MXX A;  1GP2 B;  3SWS D;  2VDQ A;  1B9X A;  2TRC B;  4X63 B;  5GXH A;  4D0K A;  4G55 A;  4PXW A;  4X60 B;  3JPX A;  3AFC A;  3I7L A;  3F3F A;  4GQ1 A;  5IJ7 E;  4GZ8 A;  5HE2 B;  3EQ9 A;  3DSM A;  4MK0 B;  2Z2O A;  2GNQ A;  5KDO B;  2I3S A;  4ZOZ A;  2UZY B;  4U7A A;  3EMH A;  4AOW A;  4BCD A;  2YMU A;  2OIZ A;  4L3H D;  4CY2 A;  2H13 A;  3F3G A;  2QR5 A;  5FXY A;  5E6R A;  4A0A B;  3PVW B;  3ZWL B;  3KRW B;  2BCJ B;  1OLZ A;  5FKQ A;  2PM9 A;  1L0Q A;  4CZV A;  4GQ2 P;  5IJ8 E;  4Y7R A;  4ZN4 A;  3KCI A;  1TYE A;  4LG9 A;  4PNK B;  3NIF A;  2PBI B;  2Q7Q A;  2OK6 A;  2HKR A;  5IC7 A;  3EU7 A;  4Z7N A;  5CXC A;  5GMK n;  4ZOY A;  1PI6 A;  2B5N A;  5FKT A;  5IGO A;  4A09 B;  3IIW A;  2VDM A;  2YNN A;  1XKS A;  3UVK A;  3IUQ A;  3K27 A;  1P22 A;  4OZU A;  2XE4 A;  5C86 A;  3QHY B;  4PSW B;  3BWS A;  4ERZ A;  4A11 B;  3E0C A;  2IUQ A;  5FA5 B;  2H9M A;  2VDO A;  1JMX B;  3PSL A;  3IJC A;  3NVQ A;  3OKW A;  1L5G A;  5E6U A;  4FAV D;  5TDH B;  3UVN A;  4K3J B;  3FCS A;  3OKY B;  4PC0 A;  1TYQ C;  1UTC A;  4J82 A;  1M1X A;  3I7K A;  1TBG A;  4O1Q D;  5EM2 B;  2MTA H;  4GM9 A;  3O4G A;  3RMZ D;  4O45 A;  3I7O A;  3OF7 A;  1UOQ A;  3I89 A;  1C9I A;  5SXM A;  4E5Z A;  3K71 A;  2J56 H;  4A08 A;  4H5J A;  2J55 H;  1JMZ B;  2OK4 A;  3B7F A;  1H2Y A;  3EQ8 A;  3I2N A;  3OL2 A;  3A0F A;  3NIG A;  3AL8 A;  4GGA A;  5THA A;  5HE1 B;  5EML B;  4X61 B;  4D6V A;  3MUN A;  1OMW B;  5GXI A;  4FA5 D;  3JZH A;  2Z2P A;  4CY3 A;  3RFH A;  4A0B A;  3RN0 D;  4FAN D;  3V4V A;  1E8N A;  5AMS A;  1GXR A;  5IGQ A;  1T2X A;  5EMM B;  4FA1 D;  2EIB A;  3DXM C;  2HYE A;  4J79 A;  3I7P A;  2H6Q A;  4J84 A;  2H6K A;  2QXV A;  4O3U B;  1N6E A;  4CI3 A;  2VZ1 A;  5CXB B;  3MKQ A;  3I8C A;  4RE6 A;  5TEF A;  3ZE2 A;  3C5M A;  1N6F A;  3JAM g;  2PM6 B;  2P9K C;  3RSE C;  1K3I A;  3SCY A;  5C2W B;  3EI1 B;  3V9F A;  2JKX A;  4CC9 A;  4DNW A;  3OTT A;  3FRX A;  3RN1 D;  4GGD A;  2H9L A;  5EAP A;  5FQD A;  5EAM A;  3V5W B;  4JD2 C;  4L3G D;  4DNU A;  2H6N A;  5H1M A;  3DXK C;  4L9O A;  2VDK A;  3RLM D;  3ZDX A;  2YNP A;  1PEV A;  3EI2 B;  3EI4 B;  2AGZ A;  2P9U C;  4NC4 A;  3CFS B;  3SBQ A;  4QT8 A;  2UZX B;  5M61 A;  3SN6 B;  1GOT B;  5I5J A;  2OVQ B;  4QQE A;  2AGX A;  3VI4 A;  3K26 A;  1K32 A;  1YFQ A;  4AEZ A;  5HQG A;  3SJL D;  2BBK H;  1E8M A;  4IRZ A;  4BH6 A;  4XYH A;  3GFC A;  3RRM C;  3ODT A;  4J0X A;  3I7H A;  3ORV D;  5AJA A;  1QFS A;  4O3T B;  4J73 A;  1NR0 A;  4DNV A;  2B5M A;  4LG8 A;  3IUR A;  5HE3 B;  3PXW D;  2VDL A;  2VDR A;  2VDN A;  4J78 A;  3IJ0 A;  4L1Q D;  4AX4 A;  5FFO A;  1R5M A;  2IUP A;  2QC5 A;  4A0A A;  2IUV A;  1JTD B;  4CY5 A;  1B9Y A;  1GOH A;  4J0W A;  5E6S A;  1S4U X;  3EWE A;  4A2M A;  4UM9 A;  3IVM A;  2HU7 A;  2O9K A;  3OKT A;  4LGN A;  4G1E A;  4IA9 A;  4E54 B;  2XZG A;  3BG1 A;  5EMK B;  3U4Y A;  4G56 B;  4N14 A;  4ESG A;  2EIC A;  4NEN A;  4KFM B;  4A2L A;  1YR2 A;  1U4C A;  3FM0 A;  5M5R A;  2CN2 A;  2P9N C;  2P9P C;  3ZDZ A;  2CN3 A;  1SQ9 A;  2QZP A;  2AQ5 A;  4A09 A;  1GOF A;  3IIY A;  3V4P A;  3ZDY A;  4ERQ A;  3OW8 A;  2GC4 A;  4R7A B;  1GG2 B;  1VZ3 A;  4BP8 A;  5B4W A;  5FKS A;  4BCB A;  5CYK B;  1XHM A;  1JV2 A;  5C2V B;  5JWZ A;  3PE7 A;  1GOG A;  1MG3 A;  4A11 A;  2VC2 A;  4CZY A;  3NVN A;  4BUJ C;  5M5V A;  3PVU B;  4GM8 A;  3VI3 A;  1U2V C;  3SHF A;  2AH0 A;  1H2Z A;  2YBA A;  2IWF A;  3CIK B;  3P4F A;  3I7N A;  2OJY A;  5HE0 B;  4AN0 A;  3OKY A; 
#chains in the Genus database with same CATH homology
 4OWR A;  3L4O D;  4ZOX A;  3ULE C;  5EM2 A;  3EI3 B;  2H3X A;  2P9S C;  4JT5 C;  3C75 H;  2Z2N A;  2AH1 A;  3JZN A;  5EAL A;  3UVO A;  3JZG A;  4ZOV A;  2PM7 B;  3N0E A;  2HES X;  4BL0 A;  3UVM A;  1ERJ A;  3DWL C;  1A0R B;  4QRJ A;  4Y5R D;  2IAA A;  3EG6 A;  3VH0 A;  2G99 A;  4TZ4 A;  4U1E I;  5TF2 A;  3SXT D;  2XU7 A;  5H14 A;  5FKR A;  4JT6 C;  2HKM A;  1MG2 A;  4FB1 D;  4UI9 R;  2AGL A;  1PGU A;  2CO0 C;  2H47 A;  3PXS D;  3MZL A;  3AH8 B;  4ES0 A;  4JSV C;  5CXB A;  1SHY B;  2I0R A;  3RFG A;  1MDA H;  4JSP C;  4JSX C;  3SBP A;  3F3P A;  5FLX g;  3DM0 A;  2AGW A;  3UKR C;  3AL9 A;  3EI1 A;  3N0D A;  3KRX B;  4J86 A;  2PM9 B;  5IT9 g;  2H68 A;  4J87 A;  3C99 A;  2HXC A;  1PBY B;  4XYI A;  4CI1 A;  4PBZ A;  3EI2 A;  3CFV A;  5C9Z B;  2G9A A;  2H9P A;  4XEI C;  5H17 A;  3EI4 A;  5CXC B;  1JJU B;  3JRP A;  4QL1 A;  3SLE D;  4FA4 D;  2B4E A;  4Z8L A;  3UVL A;  5GSA A;  1XIP A;  2P9I C;  4CY1 A;  2IUR A;  2YNO A;  3J81 g;  4ERY A;  1FWX A;  2XL3 A;  2CE9 A;  2H9N A;  3HFQ A;  2I0S A;  4PSX B;  1RI6 A;  4HDJ A;  3NVX A;  3JRO A;  1SQJ A;  3PSC B;  3V7D B;  2GC7 A;  4IMM A;  5K19 A;  2J57 G;  4NSX A;  3VGZ A;  3MKS B;  2IWK A;  3SFZ A;  3PXT D;  4YVD A;  2EBS A;  4A7J A;  2OVR B;  1VYH C;  3VA6 A;  1NEX B;  2HJB A;  2AGY A;  4E5Z B;  4E54 A;  4A08 B;  4EWR A;  3OL2 B;  1Q47 A;  3AL8 B;  5HYN B;  5K1C C;  2CNX A;  5A2Q g;  3UR4 A;  5I5M A;  4H5I A;  3IKO A;  2H14 A;  4X3E A;  5EMJ B;  3SMR A;  4A0B B;  4GQB B;  4PBY A;  1QNI A;  3C9C A;  2HJ4 A;  5CYK A;  2XYI A;  5TEE A;  5I5I A;  5EAR A;  2B5L A;  3SVW D;  3MMY A;  4FA9 D;  4J77 A;  4GGC A;  4J81 A;  3MZK A;  4CZX A;  4FWW A;  4J8G A;  2CE8 A;  3UKU C;  4CI2 A;  3L4M D;  1JOF A;  4J8B A;  3IJ1 A;  3EI3 A;  2P9L C;  4I79 A;  4K3I D;  4FHL A;  2XL2 A;  4GM3 A;  3J80 g;  4GMB A;  3W15 A;  3I8E A;  2CO0 A;  3SBR A;  2I3T A;  3JB9 L;  3FGB A;  4CI8 A;  2W18 A;  4JXM A;  3BG0 A;  3GRE A;  4JSN C;  4O9D A;  5AFU 3;  2YB8 B;  1K8K C;  1N6D A;  2I0T A;  2OVP B;  3MXX A;  1GP2 B;  3SWS D;  1B9X A;  2TRC B;  4X63 B;  5GXH A;  4D0K A;  4PXW A;  4X60 B;  3JPX A;  3AFC A;  3I7L A;  3F3F A;  4GQ1 A;  5IJ7 E;  4GZ8 A;  5HE2 B;  3DSM A;  4MK0 B;  2Z2O A;  2GNQ A;  5KDO B;  2I3S A;  4ZOZ A;  2UZY B;  4U7A A;  3EMH A;  4AOW A;  2YMU A;  2OIZ A;  4L3H D;  4CY2 A;  2H13 A;  3F3G A;  5FXY A;  4A0A B;  3PVW B;  3ZWL B;  3KRW B;  2BCJ B;  1OLZ A;  5FKQ A;  2PM9 A;  1L0Q A;  4CZV A;  4GQ2 P;  5IJ8 E;  4Y7R A;  4ZN4 A;  4LG9 A;  4PNK B;  2PBI B;  2Q7Q A;  2OK6 A;  2HKR A;  5IC7 A;  3EU7 A;  5CXC A;  5GMK n;  4ZOY A;  2B5N A;  1PI6 A;  5FKT A;  5IGO A;  4A09 B;  3IIW A;  2YNN A;  1XKS A;  3UVK A;  3K27 A;  1P22 A;  4OZU A;  4PSW B;  3BWS A;  4ERZ A;  4A11 B;  3E0C A;  2IUQ A;  5FA5 B;  2H9M A;  1JMX B;  3PSL A;  3IJC A;  3NVQ A;  3OKW A;  4FAV D;  5TDH B;  3UVN A;  4K3J B;  3OKY B;  4PC0 A;  1TYQ C;  4J82 A;  3I7K A;  1TBG A;  4O1Q D;  5EM2 B;  2MTA H;  4GM9 A;  3RMZ D;  4O45 A;  3I7O A;  3I89 A;  5SXM A;  4E5Z A;  2J56 H;  4A08 A;  4H5J A;  2J55 H;  1JMZ B;  2OK4 A;  3B7F A;  3I2N A;  3OL2 A;  3A0F A;  3AL8 A;  4GGA A;  5THA A;  5HE1 B;  5EML B;  4X61 B;  4D6V A;  1OMW B;  5GXI A;  4FA5 D;  3JZH A;  2Z2P A;  4CY3 A;  3RFH A;  4A0B A;  3RN0 D;  4FAN D;  5AMS A;  1GXR A;  5IGQ A;  5EMM B;  4FA1 D;  2HYE A;  3DXM C;  4J79 A;  3I7P A;  2H6Q A;  4J84 A;  2H6K A;  2QXV A;  4O3U B;  1N6E A;  4CI3 A;  5CXB B;  3MKQ A;  3I8C A;  5TEF A;  3C5M A;  1N6F A;  3JAM g;  2PM6 B;  2P9K C;  3RSE C;  3SCY A;  5C2W B;  3EI1 B;  3V9F A;  4CC9 A;  3OTT A;  3FRX A;  3RN1 D;  4GGD A;  2H9L A;  5EAP A;  5FQD A;  5EAM A;  3V5W B;  4JD2 C;  4L3G D;  2H6N A;  5H1M A;  3DXK C;  4L9O A;  3RLM D;  2YNP A;  1PEV A;  3EI2 B;  3EI4 B;  2AGZ A;  2P9U C;  3SBQ A;  3CFS B;  3SN6 B;  4QT8 A;  2UZX B;  1GOT B;  5I5J A;  2OVQ B;  4QQE A;  2AGX A;  3K26 A;  1K32 A;  1YFQ A;  4AEZ A;  5HQG A;  3SJL D;  2BBK H;  4BH6 A;  4XYH A;  3GFC A;  3RRM C;  3ODT A;  4J0X A;  3I7H A;  3ORV D;  5AJA A;  4O3T B;  4J73 A;  1NR0 A;  2B5M A;  4LG8 A;  5HE3 B;  3PXW D;  4J78 A;  3IJ0 A;  4L1Q D;  1R5M A;  2IUP A;  2QC5 A;  4A0A A;  2IUV A;  4CY5 A;  1B9Y A;  4J0W A;  1S4U X;  3EWE A;  4A2M A;  2O9K A;  3OKT A;  4LGN A;  4IA9 A;  4E54 B;  3BG1 A;  5EMK B;  3U4Y A;  4G56 B;  4N14 A;  4ESG A;  4KFM B;  4A2L A;  1U4C A;  3FM0 A;  2CN2 A;  2P9N C;  2P9P C;  2CN3 A;  1SQ9 A;  4A09 A;  2AQ5 A;  4ERQ A;  3IIY A;  3OW8 A;  2GC4 A;  4R7A B;  1GG2 B;  5B4W A;  5FKS A;  5CYK B;  1XHM A;  5C2V B;  5JWZ A;  3PE7 A;  1MG3 A;  4A11 A;  4CZY A;  3NVN A;  4BUJ C;  3PVU B;  4GM8 A;  1U2V C;  3SHF A;  2AH0 A;  2YBA A;  2IWF A;  3CIK B;  3P4F A;  3I7N A;  2OJY A;  5HE0 B;  3OKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...