4ATMA

Crystal structure of the bar domain of human amphiphysin, isoform 1 at 1.8 angstrom resolution featuring increased order at the n- terminus.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
221
structure length
221
Chain Sequence
RAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDESLLTLDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVFEEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Bar Domain of Human Amphiphysin, Isoform 1
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords AMPHIPHYSIN
total genus 107
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4atmA00
2ELBA 4I1QA 2X3VA 4NSWA 4AVMA 4FZSA 3LLLA 1X03A 3PLTA 3ACOA 1ZWWA 3Q0KA 2RAIA 3QNIA 4NQIA 1I4TA 5C5BB 3ABHA 1URUA 4ATMA 5C5BA 3SYVA 2Z0OA 4AKVA 4DYLA 3DYTA 2V0OA 1WDZA 3QE6A 2D1LA 3SOGA 3HAJA 1I4LA 1I4DA 4H8SA 3G9GA 2RAJA 2Q12A 2Z0VA 4DCNC 3Q84A 1I49A 2Q13A 3M3WA 2Z0NA 2FICA 2D4CA 1X04A 2RAKA 2YKTA 2X3XA 3I2WA 3HAIA 3OK8A 2X3WA 4BNEA 2C08A 2EFLA 4WPEA 3QWEA 3HAHA 2EFKA 4WPCA 3CAZA 1Y2OA
chains in the Genus database with same CATH superfamily
4EZYA 3T49A 2ELBA 3VKHA 4EZSA 2YLAA 4AVMA 2GF4A 3D4ZA 3PLTA 2F1AA 3T46A 2OBLA 1OA1A 3ACOA 1ZYLA 2OW7A 1ZWWA 3FD9A 4UDXX 2OZNB 3BUIA 3CZNA 2RAIA 4JWIA 4KIKA 3L3PA 4AZHA 3KAWA 1TQWA 1DKZA 5C5BB 1HWWA 1O7DB 3CV5A 3O3MB 4EZOA 2LM0A 3BUBA 4AZCA 1DKXA 2YIVX 1U00A 3BLBA 2F7RA 3I01A 3RPMA 1UPXA 4AZBA 2GAFD 3QE6A 4E81A 2O0I1 3BVUA 4H8SA 3G9GA 4HY9A 2RAJA 1R34A 1LQ7A 3D2FA 4H6HA 3I04A 2Q13A 4F01A 4JN4A 2Z0NA 3EJPA 4EZNA 3OK8A 2JNKA 2RAKA 4UDYX 3DPOA 4KIKB 4IM0A 2X3WA 1GNLA 2ALWA 2C08A 1YWMA 4IW0A 4EZTA 3QWEA 2GA9D 3D52A 2KHOA 4WPCA 4EZVA 2YL9A 3CAZA 1Y2OA 4I1QA 4EZXA 4FZSA 5TKYA 1OA0A 3LMFA 3OWGA 1GN9A 2MI7A 2OO2A 3A98A 3DDFA 4AZGA 4EZWA 3ER8C 4FZPA 4R5KA 2YLLA 3C7NA 4R5GA 4AZ7A 1JQKA 4AKVA 3I39X 4AZIA 3OHXM 2EX3B 4DYLA 2WINM 3EJSA 2WYIA 3ER9B 3EJUA 1WDZA 3O3NB 2OBMA 1I4DA 3CKDA 2ZXQA 2Q12A 4JWCA 2QXLA 4DCNC 4G6QA 4JWDA 3T47A 2D4CA 4R5LA 1SU6A 3HAIA 5FLEX 4H6IA 3T48A 4AZ6A 3L3OM 1R5EA 1TQVA 3CVRA 3CZSA 4BNEA 3EJRA 4WPEA 1SUFA 3KDRA 3EJQA 4F00A 2LXYA 1HXKA 3D2EA 2WYHA 3BVXA 4EZZA 1O7DC 1X03A 4IWPA 1SU7A 3QA8A 2PY6A 2YI8A 4R5JA 2RT6A 4B9QA 3Q0KA 1W9MA 4EZRA 3VEBA 4IWOA 4EZQA 4NQIA 1QWNA 4HR1A 2Z8YA 3ABHA 4ATMA 3EJTA 3SYVA 2Z0OA 3VEAA 4EZPA 3DX0A 2NCZA 3DYTA 1PS3A 4IWQA 2ND0A 4JWEA 3HAJA 1I4LA 1R33A 4NPHA 4E3CA 3T4AG 4EZUA 1E9VA 4HYBA 3F7WA 2Z0VA 1GNTA 1TQUA 3B51X 3DX2A 2FICA 2F7QA 1X04A 4HR1B 3I2WA 2X3XA 3B52X 3RV0A 5KBPA 3GI7A 3KAVA 2FYVA 1HTYA 1QWUA 3DX4A 2EFLA 2YL5A 3DDGA 2F7OA 2F1BA 3HAHA 4FM3A 5E84A 3LVTA 5FIGA 3UITA 4D8JA 2OW6A 2JNSA 2X3VA 4NSWA 1TQTA 4FZOA 3LLLA 1MJGA 3BVWA 2QKWA 4JLCA 3ERCC 2N3KA 3DPQA 3QNIA 1I4TA 2F7PA 2QFFA 3BVTA 3QNJA 3D51A 1DKYA 1URUA 4JNFA 5C5BA 4M0MA 2YIAA 3ZEDA 1TQSA 3DX3A 3RV1A 2F18A 2V0OA 1SU8A 1OAOA 2D1LA 3D4YA 3DX1A 4JNEA 2X5CA 3O3OB 4JL9A 4R5IA 3DPPA 3SOGA 2YIBA 1E1DA 1E2UA 2EWFA 2ND1A 1QX1A 3D50A 1I49A 2YL8A 3M3WA 3Q84A 4IM2A 2YKTA 3BUQA 2YL6A 3BUDA 3B53X 4AZ5A 2PMRA 3BVVA 2YI9A 2EFKA 4IM3A 4AZCB 3BUPA 4PO2A
chains in the Genus database with same CATH topology
2ELBA 4I1QA 2X3VA 4NSWA 4AVMA 4FZSA 3LLLA 1X03A 3PLTA 3ACOA 1ZWWA 3Q0KA 2RAIA 3QNIA 4NQIA 1I4TA 5C5BB 3ABHA 1URUA 4ATMA 5C5BA 3SYVA 2Z0OA 4AKVA 4DYLA 3DYTA 2V0OA 1WDZA 3QE6A 2D1LA 3SOGA 3HAJA 1I4LA 1I4DA 4H8SA 3G9GA 2RAJA 2Q12A 2Z0VA 4DCNC 3Q84A 1I49A 2Q13A 3M3WA 2Z0NA 2FICA 2D4CA 1X04A 2RAKA 2YKTA 2X3XA 3I2WA 3HAIA 3OK8A 2X3WA 4BNEA 2C08A 2EFLA 4WPEA 3QWEA 3HAHA 2EFKA 4WPCA 3CAZA 1Y2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELB A;  4I1Q A;  2X3V A;  4NSW A;  4AVM A;  4FZS A;  3LLL A;  1X03 A;  3PLT A;  3ACO A;  1ZWW A;  3Q0K A;  2RAI A;  3QNI A;  4NQI A;  1I4T A;  5C5B B;  3ABH A;  1URU A;  4ATM A;  5C5B A;  3SYV A;  2Z0O A;  4AKV A;  4DYL A;  3DYT A;  2V0O A;  1WDZ A;  3QE6 A;  2D1L A;  3SOG A;  3HAJ A;  1I4L A;  1I4D A;  4H8S A;  3G9G A;  2RAJ A;  2Q12 A;  2Z0V A;  4DCN C;  3Q84 A;  1I49 A;  2Q13 A;  3M3W A;  2Z0N A;  2FIC A;  2D4C A;  1X04 A;  2RAK A;  2YKT A;  2X3X A;  3I2W A;  3HAI A;  3OK8 A;  2X3W A;  4BNE A;  2C08 A;  2EFL A;  4WPE A;  3QWE A;  3HAH A;  2EFK A;  4WPC A;  3CAZ A;  1Y2O A; 
#chains in the Genus database with same CATH topology
 4EZY A;  3T49 A;  2ELB A;  3VKH A;  4EZS A;  2YLA A;  4AVM A;  2GF4 A;  3D4Z A;  3PLT A;  2F1A A;  3T46 A;  2OBL A;  1OA1 A;  3ACO A;  1ZYL A;  2OW7 A;  1ZWW A;  3FD9 A;  4UDX X;  2OZN B;  3BUI A;  3CZN A;  2RAI A;  4JWI A;  4KIK A;  3L3P A;  4AZH A;  3KAW A;  1TQW A;  1DKZ A;  5C5B B;  1HWW A;  1O7D B;  3CV5 A;  3O3M B;  4EZO A;  2LM0 A;  3BUB A;  4AZC A;  1DKX A;  2YIV X;  1U00 A;  3BLB A;  2F7R A;  3I01 A;  3RPM A;  1UPX A;  4AZB A;  2GAF D;  3QE6 A;  4E81 A;  2O0I 1;  3BVU A;  4H8S A;  3G9G A;  4HY9 A;  2RAJ A;  1R34 A;  1LQ7 A;  3D2F A;  4H6H A;  3I04 A;  2Q13 A;  4F01 A;  4JN4 A;  2Z0N A;  3EJP A;  4EZN A;  3OK8 A;  2JNK A;  2RAK A;  4UDY X;  3DPO A;  4KIK B;  4IM0 A;  2X3W A;  1GNL A;  2ALW A;  2C08 A;  1YWM A;  4IW0 A;  4EZT A;  3QWE A;  2GA9 D;  3D52 A;  2KHO A;  4WPC A;  4EZV A;  2YL9 A;  3CAZ A;  1Y2O A;  4I1Q A;  4EZX A;  4FZS A;  5TKY A;  1OA0 A;  3LMF A;  3OWG A;  1GN9 A;  2MI7 A;  2OO2 A;  3A98 A;  3DDF A;  4AZG A;  4EZW A;  3ER8 C;  4FZP A;  4R5K A;  2YLL A;  3C7N A;  4R5G A;  4AZ7 A;  1JQK A;  4AKV A;  3I39 X;  4AZI A;  3OHX M;  2EX3 B;  4DYL A;  2WIN M;  3EJS A;  2WYI A;  3ER9 B;  3EJU A;  1WDZ A;  3O3N B;  2OBM A;  1I4D A;  3CKD A;  2ZXQ A;  2Q12 A;  4JWC A;  2QXL A;  4DCN C;  4G6Q A;  4JWD A;  3T47 A;  2D4C A;  4R5L A;  1SU6 A;  3HAI A;  5FLE X;  4H6I A;  3T48 A;  4AZ6 A;  3L3O M;  1R5E A;  1TQV A;  3CVR A;  3CZS A;  4BNE A;  3EJR A;  4WPE A;  1SUF A;  3KDR A;  3EJQ A;  4F00 A;  2LXY A;  1HXK A;  3D2E A;  2WYH A;  3BVX A;  4EZZ A;  1O7D C;  1X03 A;  4IWP A;  1SU7 A;  3QA8 A;  2PY6 A;  2YI8 A;  4R5J A;  2RT6 A;  4B9Q A;  3Q0K A;  1W9M A;  4EZR A;  3VEB A;  4IWO A;  4EZQ A;  4NQI A;  1QWN A;  4HR1 A;  2Z8Y A;  3ABH A;  4ATM A;  3EJT A;  3SYV A;  2Z0O A;  3VEA A;  4EZP A;  3DX0 A;  2NCZ A;  3DYT A;  1PS3 A;  4IWQ A;  2ND0 A;  4JWE A;  3HAJ A;  1I4L A;  1R33 A;  4NPH A;  4E3C A;  3T4A G;  4EZU A;  1E9V A;  4HYB A;  3F7W A;  2Z0V A;  1GNT A;  1TQU A;  3B51 X;  3DX2 A;  2FIC A;  2F7Q A;  1X04 A;  4HR1 B;  3I2W A;  2X3X A;  3B52 X;  3RV0 A;  5KBP A;  3GI7 A;  3KAV A;  2FYV A;  1HTY A;  1QWU A;  3DX4 A;  2EFL A;  2YL5 A;  3DDG A;  2F7O A;  2F1B A;  3HAH A;  4FM3 A;  5E84 A;  3LVT A;  5FIG A;  3UIT A;  4D8J A;  2OW6 A;  2JNS A;  2X3V A;  4NSW A;  1TQT A;  4FZO A;  3LLL A;  1MJG A;  3BVW A;  2QKW A;  4JLC A;  3ERC C;  2N3K A;  3DPQ A;  3QNI A;  1I4T A;  2F7P A;  2QFF A;  3BVT A;  3QNJ A;  3D51 A;  1DKY A;  1URU A;  4JNF A;  5C5B A;  4M0M A;  2YIA A;  3ZED A;  1TQS A;  3DX3 A;  3RV1 A;  2F18 A;  2V0O A;  1SU8 A;  1OAO A;  2D1L A;  3D4Y A;  3DX1 A;  4JNE A;  2X5C A;  3O3O B;  4JL9 A;  4R5I A;  3DPP A;  3SOG A;  2YIB A;  1E1D A;  1E2U A;  2EWF A;  2ND1 A;  1QX1 A;  3D50 A;  1I49 A;  2YL8 A;  3M3W A;  3Q84 A;  4IM2 A;  2YKT A;  3BUQ A;  2YL6 A;  3BUD A;  3B53 X;  4AZ5 A;  2PMR A;  3BVV A;  2YI9 A;  2EFK A;  4IM3 A;  4AZC B;  3BUP A;  4PO2 A; 
#chains in the Genus database with same CATH homology
 2ELB A;  4I1Q A;  2X3V A;  4NSW A;  4AVM A;  4FZS A;  3LLL A;  1X03 A;  3PLT A;  3ACO A;  1ZWW A;  3Q0K A;  2RAI A;  3QNI A;  4NQI A;  1I4T A;  5C5B B;  3ABH A;  1URU A;  4ATM A;  5C5B A;  3SYV A;  2Z0O A;  4AKV A;  4DYL A;  3DYT A;  2V0O A;  1WDZ A;  3QE6 A;  2D1L A;  3SOG A;  3HAJ A;  1I4L A;  1I4D A;  4H8S A;  3G9G A;  2RAJ A;  2Q12 A;  2Z0V A;  4DCN C;  3Q84 A;  1I49 A;  2Q13 A;  3M3W A;  2Z0N A;  2FIC A;  2D4C A;  1X04 A;  2RAK A;  2YKT A;  2X3X A;  3I2W A;  3HAI A;  3OK8 A;  2X3W A;  4BNE A;  2C08 A;  2EFL A;  4WPE A;  3QWE A;  3HAH A;  2EFK A;  4WPC A;  3CAZ A;  1Y2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...