4AVMA

Crystal structure of the n-bar domain of human bridging integrator 2.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
230
structure length
230
Chain Sequence
KQVQKKFSRAQEKVLQKLGKAVETKDERFEQSASNFYQQQAEGHKLYKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKAQTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKLERQHSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the N-Bar Domain of Human Bridging Integrator 2.
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords BRIDGING INTEGRATOR 2
total genus 110
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2012-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4avmA00
1I4DA 2Z0NA 5C5BA 3DYTA 4H8SA 3OK8A 3ABHA 3SYVA 3Q84A 4WPCA 3QE6A 2X3WA 3ACOA 2EFLA 3LLLA 3HAJA 4DCNC 3SOGA 2FICA 2X3XA 4NQIA 2RAJA 2EFKA 2C08A 3Q0KA 3QWEA 2YKTA 3G9GA 4WPEA 2ELBA 1Y2OA 3M3WA 4AKVA 4ATMA 3PLTA 5C5BB 2Z0VA 2D1LA 2X3VA 4BNEA 3HAIA 1X04A 1WDZA 1X03A 2RAKA 1URUA 3CAZA 4FZSA 2RAIA 1I4TA 3I2WA 4I1QA 4DYLA 4AVMA 1ZWWA 1I49A 3HAHA 2Z0OA 3QNIA 2Q12A 4NSWA 2D4CA 2V0OA 1I4LA 2Q13A
chains in the Genus database with same CATH superfamily
1TQVA 3O3NB 2Z0NA 1O7DC 3CV5A 3B53X 4HR1A 3ABHA 3D4YA 3Q84A 4R5LA 3QE6A 2O0I1 1LQ7A 2X3WA 2GF4A 2EFLA 1TQSA 1SU8A 3BUPA 4IM3A 3I04A 2FYVA 3LLLA 4G6QA 2WYIA 2KHOA 4JWDA 3UITA 2FICA 4E81A 2ZXQA 4H6IA 1QWNA 2EWFA 4EZNA 4EZVA 4WPEA 4IW0A 3RV0A 1DKZA 1R33A 3DDFA 3PLTA 5E84A 3T4AG 4IM2A 2X3VA 3RV1A 4BNEA 1TQWA 1X04A 3FD9A 4FZSA 4EZUA 4EZPA 3D51A 4EZWA 3DPPA 2Z8YA 2WINM 1I4TA 4I1QA 4EZXA 3EJUA 2F7OA 4EZZA 1HXKA 3LMFA 2PMRA 2Z0OA 2D4CA 1HWWA 2F1AA 3DPQA 4JLCA 4JL9A 1OA0A 1OA1A 3BUDA 1I4DA 1DKYA 3BVTA 2JNSA 3DPOA 3DX1A 3I01A 2X5CA 2GA9D 4AZCB 3QA8A 2MI7A 4H8SA 4FM3A 4HY9A 3SYVA 3T47A 2OW6A 4IWOA 3BVXA 4AZ6A 3GI7A 1GN9A 1UPXA 4IM0A 4R5JA 4AZHA 4DCNC 1E2UA 4R5IA 2YI9A 2F18A 2EFKA 3CZNA 3EJSA 3QNJA 3QWEA 2F7PA 2YKTA 3G9GA 3O3OB 3VKHA 2OBLA 2ELBA 2F7QA 3I39X 3M3WA 1QWUA 2YL5A 5FLEX 4AKVA 2OW7A 3KDRA 4JWCA 4AZCA 4R5GA 3LVTA 1WDZA 1X03A 3CKDA 3D2EA 3KAWA 1MJGA 4EZOA 4AZGA 4NPHA 4EZQA 2PY6A 3C7NA 4DYLA 4KIKB 3BVWA 4AVMA 4M0MA 1E1DA 1ZWWA 2YI8A 3BVUA 3HAHA 2OO2A 3EJTA 3KAVA 3QNIA 2YIBA 4IWPA 4JNFA 2V0OA 3OWGA 4NSWA 5KBPA 3OHXM 1O7DB 2NCZA 2N3KA 1DKXA 2F7RA 3D4ZA 3DX3A 1R5EA 5C5BA 4B9QA 3EJPA 1SU6A 3OK8A 3B51X 3BUIA 4HYBA 3ZEDA 3CZSA 1JQKA 4FZOA 3EJRA 2YLAA 4JWEA 3HAJA 2YL6A 3A98A 4KIKA 3ER8C 2X3XA 3D50A 4IWQA 2RAJA 3Q0KA 4NQIA 3RPMA 3T49A 3EJQA 1W9MA 1Y2OA 3O3MB 4EZRA 3ER9B 4ATMA 2QFFA 5C5BB 2Z0VA 2LXYA 2LM0A 2RAKA 2YL9A 3CAZA 1URUA 3DDGA 3DX0A 3F7WA 3HAIA 4AZ7A 4JN4A 1GNTA 3B52X 2RAIA 3BVVA 3I2WA 1GNLA 2WYHA 3L3PA 4UDYX 1U00A 3D2FA 4AZ5A 4PO2A 3ERCC 1I49A 3T46A 2ND1A 1R34A 1SU7A 4AZBA 2Q12A 2YLLA 2ALWA 2JNKA 4JWIA 1E9VA 2QKWA 2EX3B 3DYTA 5FIGA 3VEBA 5TKYA 2GAFD 3BUBA 4EZTA 1HTYA 4WPCA 3ACOA 3BUQA 3VEAA 3DX4A 4R5KA 2OBMA 3SOGA 2ND0A 4F01A 2YIAA 2QXLA 2C08A 4H6HA 4UDXX 1QX1A 1OAOA 3L3OM 2OZNB 4F00A 1YWMA 4E3CA 2D1LA 4HR1B 4EZSA 1TQUA 4JNEA 1PS3A 1ZYLA 3T48A 4EZYA 3D52A 3CVRA 2YL8A 2RT6A 3DX2A 4AZIA 4D8JA 1TQTA 2F1BA 2YIVX 4FZPA 3BLBA 1SUFA 1I4LA 2Q13A
chains in the Genus database with same CATH topology
1I4DA 2Z0NA 5C5BA 3DYTA 4H8SA 3OK8A 3ABHA 3SYVA 3Q84A 4WPCA 3QE6A 2X3WA 3ACOA 2EFLA 3LLLA 3HAJA 4DCNC 3SOGA 2FICA 2X3XA 4NQIA 2RAJA 2EFKA 2C08A 3Q0KA 3QWEA 2YKTA 3G9GA 4WPEA 2ELBA 1Y2OA 3M3WA 4AKVA 4ATMA 3PLTA 5C5BB 2Z0VA 2D1LA 2X3VA 4BNEA 3HAIA 1X04A 1WDZA 1X03A 2RAKA 1URUA 3CAZA 4FZSA 2RAIA 1I4TA 3I2WA 4I1QA 4DYLA 4AVMA 1ZWWA 1I49A 3HAHA 2Z0OA 3QNIA 2Q12A 4NSWA 2D4CA 2V0OA 1I4LA 2Q13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I4D A;  2Z0N A;  5C5B A;  3DYT A;  4H8S A;  3OK8 A;  3ABH A;  3SYV A;  3Q84 A;  4WPC A;  3QE6 A;  2X3W A;  3ACO A;  2EFL A;  3LLL A;  3HAJ A;  4DCN C;  3SOG A;  2FIC A;  2X3X A;  4NQI A;  2RAJ A;  2EFK A;  2C08 A;  3Q0K A;  3QWE A;  2YKT A;  3G9G A;  4WPE A;  2ELB A;  1Y2O A;  3M3W A;  4AKV A;  4ATM A;  3PLT A;  5C5B B;  2Z0V A;  2D1L A;  2X3V A;  4BNE A;  3HAI A;  1X04 A;  1WDZ A;  1X03 A;  2RAK A;  1URU A;  3CAZ A;  4FZS A;  2RAI A;  1I4T A;  3I2W A;  4I1Q A;  4DYL A;  4AVM A;  1ZWW A;  1I49 A;  3HAH A;  2Z0O A;  3QNI A;  2Q12 A;  4NSW A;  2D4C A;  2V0O A;  1I4L A;  2Q13 A; 
#chains in the Genus database with same CATH topology
 1TQV A;  3O3N B;  2Z0N A;  1O7D C;  3CV5 A;  3B53 X;  4HR1 A;  3ABH A;  3D4Y A;  3Q84 A;  4R5L A;  3QE6 A;  2O0I 1;  1LQ7 A;  2X3W A;  2GF4 A;  2EFL A;  1TQS A;  1SU8 A;  3BUP A;  4IM3 A;  3I04 A;  2FYV A;  3LLL A;  4G6Q A;  2WYI A;  2KHO A;  4JWD A;  3UIT A;  2FIC A;  4E81 A;  2ZXQ A;  4H6I A;  1QWN A;  2EWF A;  4EZN A;  4EZV A;  4WPE A;  4IW0 A;  3RV0 A;  1DKZ A;  1R33 A;  3DDF A;  3PLT A;  5E84 A;  3T4A G;  4IM2 A;  2X3V A;  3RV1 A;  4BNE A;  1TQW A;  1X04 A;  3FD9 A;  4FZS A;  4EZU A;  4EZP A;  3D51 A;  4EZW A;  3DPP A;  2Z8Y A;  2WIN M;  1I4T A;  4I1Q A;  4EZX A;  3EJU A;  2F7O A;  4EZZ A;  1HXK A;  3LMF A;  2PMR A;  2Z0O A;  2D4C A;  1HWW A;  2F1A A;  3DPQ A;  4JLC A;  4JL9 A;  1OA0 A;  1OA1 A;  3BUD A;  1I4D A;  1DKY A;  3BVT A;  2JNS A;  3DPO A;  3DX1 A;  3I01 A;  2X5C A;  2GA9 D;  4AZC B;  3QA8 A;  2MI7 A;  4H8S A;  4FM3 A;  4HY9 A;  3SYV A;  3T47 A;  2OW6 A;  4IWO A;  3BVX A;  4AZ6 A;  3GI7 A;  1GN9 A;  1UPX A;  4IM0 A;  4R5J A;  4AZH A;  4DCN C;  1E2U A;  4R5I A;  2YI9 A;  2F18 A;  2EFK A;  3CZN A;  3EJS A;  3QNJ A;  3QWE A;  2F7P A;  2YKT A;  3G9G A;  3O3O B;  3VKH A;  2OBL A;  2ELB A;  2F7Q A;  3I39 X;  3M3W A;  1QWU A;  2YL5 A;  5FLE X;  4AKV A;  2OW7 A;  3KDR A;  4JWC A;  4AZC A;  4R5G A;  3LVT A;  1WDZ A;  1X03 A;  3CKD A;  3D2E A;  3KAW A;  1MJG A;  4EZO A;  4AZG A;  4NPH A;  4EZQ A;  2PY6 A;  3C7N A;  4DYL A;  4KIK B;  3BVW A;  4AVM A;  4M0M A;  1E1D A;  1ZWW A;  2YI8 A;  3BVU A;  3HAH A;  2OO2 A;  3EJT A;  3KAV A;  3QNI A;  2YIB A;  4IWP A;  4JNF A;  2V0O A;  3OWG A;  4NSW A;  5KBP A;  3OHX M;  1O7D B;  2NCZ A;  2N3K A;  1DKX A;  2F7R A;  3D4Z A;  3DX3 A;  1R5E A;  5C5B A;  4B9Q A;  3EJP A;  1SU6 A;  3OK8 A;  3B51 X;  3BUI A;  4HYB A;  3ZED A;  3CZS A;  1JQK A;  4FZO A;  3EJR A;  2YLA A;  4JWE A;  3HAJ A;  2YL6 A;  3A98 A;  4KIK A;  3ER8 C;  2X3X A;  3D50 A;  4IWQ A;  2RAJ A;  3Q0K A;  4NQI A;  3RPM A;  3T49 A;  3EJQ A;  1W9M A;  1Y2O A;  3O3M B;  4EZR A;  3ER9 B;  4ATM A;  2QFF A;  5C5B B;  2Z0V A;  2LXY A;  2LM0 A;  2RAK A;  2YL9 A;  3CAZ A;  1URU A;  3DDG A;  3DX0 A;  3F7W A;  3HAI A;  4AZ7 A;  4JN4 A;  1GNT A;  3B52 X;  2RAI A;  3BVV A;  3I2W A;  1GNL A;  2WYH A;  3L3P A;  4UDY X;  1U00 A;  3D2F A;  4AZ5 A;  4PO2 A;  3ERC C;  1I49 A;  3T46 A;  2ND1 A;  1R34 A;  1SU7 A;  4AZB A;  2Q12 A;  2YLL A;  2ALW A;  2JNK A;  4JWI A;  1E9V A;  2QKW A;  2EX3 B;  3DYT A;  5FIG A;  3VEB A;  5TKY A;  2GAF D;  3BUB A;  4EZT A;  1HTY A;  4WPC A;  3ACO A;  3BUQ A;  3VEA A;  3DX4 A;  4R5K A;  2OBM A;  3SOG A;  2ND0 A;  4F01 A;  2YIA A;  2QXL A;  2C08 A;  4H6H A;  4UDX X;  1QX1 A;  1OAO A;  3L3O M;  2OZN B;  4F00 A;  1YWM A;  4E3C A;  2D1L A;  4HR1 B;  4EZS A;  1TQU A;  4JNE A;  1PS3 A;  1ZYL A;  3T48 A;  4EZY A;  3D52 A;  3CVR A;  2YL8 A;  2RT6 A;  3DX2 A;  4AZI A;  4D8J A;  1TQT A;  2F1B A;  2YIV X;  4FZP A;  3BLB A;  1SUF A;  1I4L A;  2Q13 A; 
#chains in the Genus database with same CATH homology
 1I4D A;  2Z0N A;  5C5B A;  3DYT A;  4H8S A;  3OK8 A;  3ABH A;  3SYV A;  3Q84 A;  4WPC A;  3QE6 A;  2X3W A;  3ACO A;  2EFL A;  3LLL A;  3HAJ A;  4DCN C;  3SOG A;  2FIC A;  2X3X A;  4NQI A;  2RAJ A;  2EFK A;  2C08 A;  3Q0K A;  3QWE A;  2YKT A;  3G9G A;  4WPE A;  2ELB A;  1Y2O A;  3M3W A;  4AKV A;  4ATM A;  3PLT A;  5C5B B;  2Z0V A;  2D1L A;  2X3V A;  4BNE A;  3HAI A;  1X04 A;  1WDZ A;  1X03 A;  2RAK A;  1URU A;  3CAZ A;  4FZS A;  2RAI A;  1I4T A;  3I2W A;  4I1Q A;  4DYL A;  4AVM A;  1ZWW A;  1I49 A;  3HAH A;  2Z0O A;  3QNI A;  2Q12 A;  4NSW A;  2D4C A;  2V0O A;  1I4L A;  2Q13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...