4AZ5A

Differential inhibition of the tandem gh20 catalytic modules in the pneumococcal exo-beta-d-n-acetylglucosaminidase, strh
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
434
structure length
434
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the Family 20 Glycoside Hydrolase Catalytic Modules in the Streptococcus Pneumoniae Exo-Beta-D-N-Acetylglucosaminidase, Strh.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
total genus 172
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2012-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 4az5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4az5A01
2OSYA 4B3LA 4TXEA 3RM4A 1E71M 1G1YA 2Y2WA 4CD7A 3EDKA 1E0VA 1BYBA 3L2LA 3MSDA 2V5DA 1GOIA 1X6NA 2PF0A 1CNVA 1UWSA 4J3XA 4KRTA 1UWQA 3ARQA 3VIGA 3ZO9A 1VJZA 1E6QM 3L4UA 1E6XM 4AD2A 5LYRA 1HJXA 1NOWA 4UQ9A 4TTUA 4D72A 1EIBA 1OWQA 1US3A 4IUGA 3VIOA 1XD1A 4PMUA 4BA0A 2D20A 5BWFA 4DWSD 2Q8XA 1J18A 1CXKA 3KL0A 4OKDA 3KWXA 1BQCA 1FH8A 3SCWA 1IZKA 5LA1A 1QNSA 1V0LA 2WHLA 1MXDA 1BGAA 3A6OA 1CLXA 1UD8A 1A47A 3EYPA 4JKKA 3BGAA 5A1AA 1WB0A 4QAWA 1PX3A 3FHQA 2CYGA 4V2XA 4UFMA 4GQRA 3BCFA 3MO4A 4GXPA 5AY7A 3RCNA 3FY1A 1UD3A 1P6WA 1JI2A 3AS3A 2CHOA 3WNKA 1VEPA 3GDBA 3OBAA 1V03A 3AS0A 5A8NA 1OGBA 3AMLA 3A4XA 5M3WA 1B1YA 3THDA 4ACZA 2E40A 4DM2A 5IFPA 3M46A 3VM7A 4UR9A 3K8KA 1XH1A 4WSKA 4QCFA 3KEHA 5ABGA 5A2AA 2CBVA 5A8QA 4EANA 3T0BA 2JEPA 1C3FA 3VD4A 3W38A 4UFHA 5C8BB 3ARVA 1BGGA 1WNOA 1WKYA 3BMVA 3CTTA 2WKGA 3CLWA 1WAWA 3VDCA 4NZCA 2CIPA 3CHCA 1KGXA 3SCOA 3WENA 3ARYA 4L4OA 1KFWA 3RJYA 4W88A 4DWSA 2J25A 1QNOA 5I77A 1TVNA 3CUGA 4C7DA 4YHGA 1H2JA 3K4AA 3MSGA 3ZT5A 1MVYA 1H11A 4MB4A 2ZX7A 3VGHA 5CGTA 2J7GA 3AIVA 4GI8A 2WMHA 1R85A 3FAWA 3WSUA 2XWEA 2VQTA 5E70A 4F9DA 2FH8A 1QNRA 3GH7A 2VCAA 3CZKA 4AEFA 1GQKA 3GBDA 1MW2A 3ARPA 5FKYA 4IISA 1BG9A 4Z2GA 1CWYA 4AZ5A 5I24A 1EDGA 1KQYA 4RL3A 4UOQA 3MU7A 3AROA 3OLEA 3BAYA 1E15A 3D5HA 4FZOA 1YQ2A 5E0FA 3MUZ1 1CXLA 1XV8A 3W4RA 3FNDA 2V3GA 3GXDA 1ISVA 3ZSTA 2WK2A 2XFFA 1DWAM 3IJ9A 3LMYA 3WMBA 1W9DM 1HJSA 4JZ5A 3T0DA 4XX6A 3WY1A 1W9VA 2WSKA 1V3JA 2CITA 3G6MA 3ALFA 1RPKA 4U31A 2QPUA 3MUY1 2WBGA 4RE2A 1O6IA 1R8LA 3MV01 1J12A 4LQ1A 2E8ZA 2EEXA 4QCEA 4OOZA 3WH7A 1EA9C 5A6MA 2MANA 1E0XA 1UR1A 5DO8A 5E9AA 1H3GA 4PMDA 1VEOA 9CGTA 1JDCA 2J78A 3WIJA 4GKLA 1MWOA 1NH6A 1ECEA 5A6SA 3OIHA 1J0IA 1JGIA 1PX4A 4JFSA 1OGSA 3AFBA 4GO8A 4AD1A 4CU6A 5A3HA 1V0NA 4AMCA 4BQ2A 2OLHA 3WQ5A 1XH2A 1UR8A 2V38A 2BY2A 2DSKA 4H8UA 1PAMA 1QI2A 1NOFA 3SUVA 1HT6A 1SMAA 3M7SA 1ZBKA 4W8AA 1W1TA 2EQDA 5FL0A 5ABEA 1FFRA 2E3ZA 3F5JA 3K4DA 4HOZA 4GI9A 5EFDA 2JE8A 3CPUA 4AZCB 4J3WA 2A3EA 4LX4A 1ZS2A 4JAWA 3AMCA 2AAAA 1HJQA 3K8LA 5E6ZA 3RILA 2VZVA 3AHZA 4W7VA 1UOKA 2WVTA 3NDZA 4N42A 1H41A 1TMQA 3AJ7A 4W5ZA 3FHAA 4TVCA 1E6RA 3CZ8A 5BROA 3N18A 1VFFA 2ZUSA 4D1JA 1J10A 2YDQA 2EXOA 1JFHA 1L8NA 4H2CA 3HN3A 3U57A 1XSKA 4W89A 3EDDA 3M07A 3T2QA 3AQUA 1U2YA 1QHPA 1H5VA 1UD6A 4TVUA 2FGLA 2W5FA 1GQJA 2J8GA 3GM8A 1EHNA 1HKJA 1GVIA 3VD3A 4PUEA 4V27A 3TOPA 3OZOA 3UEQA 1QW9A 1QOXA 1FP8A 5HOSA 2J77A 3BCDA 2NT1A 3VDHA 1NP0A 2DT3A 3BXWA 2ZUNA 2ZX6A 3WEZA 5D8WA 4H7VA 1ZB5A 4E8CA 1MYRA 2VZTA 1WZKA 1Q4NX 4HA3A 2D0HA 3N9KA 5I2UA 2D22A 2V3FA 2VX7A 1Q6CA 2EPOA 1EO5A 1JI1A 1UR0A 3OLIA 1GONA 2E0PA 4OBSA 2WVUA 2CBIA 1J0JA 2WANA 1PIGA 1J0YA 3WUFA 2VR5A 2IXVA 3KL3A 2XVNA 2J4GA 3SCUA 4GIAA 1HL8A 4ATWA 2WHJA 2VQUA 3QHNA 3VIJA 1QI4A 3U5YA 2VUYA 2VRJA 2W66A 5BXRA 1PX8A 3LPOA 1LL6A 3CGTA 3MMWA 4MDPA 3AMKA 2B31A 3I3DA 4HZ8A 1B2YA 3ARTA 2YA1A 2XVLA 4Z2IA 4HMCA 3APGA 2CPUA 1NOUA 2F2HA 3K46A 1H1NA 3AMGA 3W26A 3LPPA 3BAWA 3TP4A 1W9BM 1TFVA 3ECQA 4KGJA 3TTYA 1ODUA 3A4WA 3N04A 4P7QA 1WP6A 1V6WA 5DT5A 3PBGA 4PMYA 2VVSA 3CBWA 4UQAA 2VZSA 1B90A 2GVYA 1KBKA 1BYDA 5D8ZA 4UOZA 1HJVA 2XFRA 2XG9A 5A6JA 1G0CA 3AZTA 3W29A 2JALA 1U33A 4X9YA 1E40A 1GJUA 2OSWA 1WDQA 1I1XA 1VENA 3ZJ7A 1UQYA 4CD4A 3B9DA 3CZEA 4R27A 3VIKA 1W2VA 4PTWA 2ZOXA 3WUBA 3IJ8A 1HKIA 1BHGA 4JL2A 2BHUA 3N11A 1H4PA 5D9OA 2WMGA 5BXSA 4NI3A 1MFVA 2EPKX 3GH5A 3UETA 3WF2A 4PTVA 1LG1A 3PZQA 1ZJBA 2WAGA 4HPGA 4HPHA 5I6SA 2WZEA 3PZMA 1BYAA 4B9ZA 3VD9A 1C7SA 4BQ5A 4EK7A 1CZ1A 2CBJA 1QNQA 2DGAA 3WBEA 3VDAA 4B9YA 5M17A 3CMJA 3ZSSA 4H8VA 3CUIA 4W5UA 3NSXA 3UR7A 2JIEA 4PTMA 3RO8A 2DIEA 1E3ZA 4OJYA 4LXFA 5CZKA 2VI0A 3VDBA 4OOUA 1CPUA 1NWUA 3MV11 5LA2A 4D6HA 1LF1A 1DWGM 2PWEA 1Q6DA 1W3KA 2CKRA 1MW3A 1CXEA 4BQ4A 1NWRA 1ZL1A 5DF0A 4MB3A 2YBTA 3WNMA 4HZ7A 1X6LA 1W3LA 1QHZA 1UHVA 5AYBA 3NIYA 3TTSA 2CESA 2ZWZA 4PMQA 2IXUA 2DPEA 3AXHA 2EJ1A 2X0HA 4P8UA 1XC6A 1OT2A 3PZIA 1QI0A 2E9BA 2RGLA 1GHRA 2XTKA 2A3AA 4UFLA 3GNRA 2X2YA 3VGDA 1UH4A 5LA0A 2ESCA 3WNPA 1PPIA 2JF6A 5HBFA 2EPNA 2DEPA 2PMRA 3ALGA 1PIFA 4U5IA 1Y7VA 4U3CA 4XZWA 1C8XA 2W91A 5HNNA 3EMZA 2Z1KA 1KB3A 2WMIA 2WHMA 1UWIA 1VBRA 5CXPA 2G3NA 5ABHA 2WLYA 4PYSA 4TX8A 1W9XA 4HOWA 1TZ7A 1HN1A 5BRPA 1V6UA 3W25A 4PN2A 4PSRA 3D3AA 3VGFA 4DWSC 2D24A 4JKLA 5CG0A 1TA3B 4H8HA 5CSUA 1TE1A 3O2LA 1WDRA 5EBAA 4HP5A 5BRQA 2W62A 1WE5A 2WWCA 1V6YA 1GW1A 1V02E 1Q6FA 4QFUA 3VIFA 2WC7A 4P8XA 2PBOA 2ZXDA 1B3XA 3NUKA 3WDHA 4ATLA 4DUWA 1AQHA 4HTYA 3FN9A 2OYMA 5KZ6A 1UR2A 1OD8A 3VIHA 2BV9A 3MANA 2Y8VA 3SCRA 1VFUA 2YKKA 3KZSA 2RGMA 3NDYA 2DH2A 3WDRA 3CIVA 1JZ8A 2FHFA 8CGTA 1PZ2A 4E4PA 1UH2A 1UKSA 4D6GA 4B16A 1E43A 4B15A 5E6YA 1UKQA 2ZUWA 3UG4A 3SCNA 3MUIA 3CUHA 3DHUA 1BPLB 1BF2A 2XYLA 1CXFA 6A3HA 2W4XA 4XUYA 1JXJA 3OA5A 2VOTA 1E6NA 1JXKA 5F7UA 5HPCA 4J28A 3PN8A 3N1AA 2YIHA 3AIWA 4Z2HA 2J8FA 3PTQA 1ISZA 3PZNA 3SUUA 2HVMA 1SMDA 1K9DA 2D3NA 2WNWA 3CHDA 1FFQA 5A69A 4ZE5A 2GJRA 5D4YA 2NSXA 2UWFA 4FLOA 1WZAA 4AISA 2W67A 2J62A 1ODZA 1C92A 5DEZA 4FLQA 3HJEA 5ABFB 4RE4A 4XZBA 4ZXOA 5I79A 4PEEA 1J0KA 2VX6A 1QW8A 2D23A 4GPNA 2XSBA 1ZBCA 3OB8A 3POHA 1V3HA 3WNOA 2ZX8A 2WHKA 3POCA 3RJXA 3I3BA 1J0HA 1C8QA 3IAQA 3DYMA 1HVQA 1JF6A 3OGRA 1GPFA 1GUVA 4W8BA 3CMGA 1GQIA 4HZ6A 3GZAA 5FL1A 1F4HA 4CVUA 1UD5A 1NWSA 2EO7A 5IXEA 4JCMA 1LJYA 4RE3A 2AOSA 2PBGA 4AEEA 1GNXA 2WCGA 3GYCA 4NSBA 1MFUA 4UZUA 1WDSA 1EXPA 2QHAA 1TG7A 2GSJA 1CGUA 3IJ7A 4UFKA 3T08A 4MNJA 3L4TA 3GH4A 4IPNB 4UNIA 3VMNA 1UR4A 2QMKA 1MW0A 3GNOA 1W2PA 1CIUA 4A3HA 1EOKA 4FMVA 4PCSA 1Q6GA 1XSIA 4PTXA 1TCMA 3T09A 3ARXA 4CUCA 5IDIA 2FHCA 3WH6A 3U7BA 1H0GA 3N12A 3SEPA 1BLIA 1FH7A 2XHYA 3WMCA 2X8RA 1HF6A 3OGVA 4M80A 4AIOA 4HOXA 3EBVA 4IM4A 2YL6A 3VIMA 3CZLA 5ABFA 1E9LA 3VKKA 5DT7A 4TVDA 1B3WA 3DYPA 3WQ6A 2VO5A 2JFEX 3A47A 1JDAA 2BFGA 2DDXA 2VX4A 1F4AA 3KL5A 1VAHA 5FD0A 2VR4A 4MJ2A 4PUDA 4PMOA 5C71A 3ARZA 1JNEA 4AZGA 3AYSA 1WDPA 2VX5A 1CENA 4F9JA 1E6PA 5M5DA 4OIFA 5CPTA 5AC5A 1JYXA 4P7OA 3VILA 1UA3A 3BAJA 3SCSA 4D6FA 2J47A 1W32A 4BF7A 4IPLA 2VTFA 4GO9A 1WCGA 3BC9A 1RH9A 1QBBA 3VGEA 4W7WA 2G41A 3WD1A 1VB9A 1W91A 4PMRA 1E6SM 1FOBA 2BXZA 2D2OA 2ZUUA 3WD4A 2G4FA 3VPLA 1V0MA 3ZIZA 4WK9A 1US2A 4JHOA 5M03A 2VNCA 2VJXA 4D6IA 1RP9A 5D9MA 1M53A 3RIKA 4BS0A 4MDOA 4P7RA 1MW1A 2VRKA 3AISA 4HA1A 4WF7A 1QHOA 4YPJA 2VCCA 4MAVA 2BY3A 1UQZA 2GFTA 4PMZA 1Z32X 2Y24A 4M29A 1N82A 3SUTA 2VZUA 4M8UA 3WEOA 3TA9A 1HKKA 3ZJKA 4OUEA 1VEMA 4KRUA 2DH3A 4WLCA 2VMFA 3L4ZA 1D3CA 1I1WA 2Y8KA 2D1ZA 1KCLA 1EHAA 3NSMA 1KWKA 3W6LA 2XJ7A 1A3HA 1K6AA 4CKQA 3SIMA 3PZGA 6CGTA 3A3HA 4L4PA 1HX0A 1H09A 3VM5A 2PWGA 1PJ9A 3WH9A 1B30A 1G5AA 2DIJA 3W82A 4AIUA 2DSVA 2YL8A 3AXXA 1EDQA 1E4MM 2XVGA 3THCA 4TX6A 3WF1A 3L4WA 5I23A 1LLOA 1E0WA 4H41A 1GOOA 1PEZA 1MQQA 1JZ7A 4GZEA 3AIUA 1JD9A 3SUWA 3WH5A 4PBGA 4MPKA 5A2BA 3K8MA 4AW7A 2CETA 4NRRA 2G8ZA 3IAPA 4P7NA 1C8YA 2X1IA 1DP0A 3F5KA 4CCCA 1LG2A 1E3XA 1XYFA 3ARSA 1CBGA 3BMWA 4K68A 5BXTA 1QPKA 1UG6A 2E8YA 2WKLA 4HMEA 5EFFA 4JKMA 1MXGA 4KWUA 3UG3A 1C90A 1UD4A 2OYLA 1XYZA 5CGMA 2XIIA 4CD5A 3ZMRA 1H0IA 1ISYA 1B0IA 1QBAA 3WELA 2E9MA 4WKHA 2Z1SA 1CDGA 1E4NA 1XCWA 3FW6A 1B31A 2ZUVA 1XH0A 2VURA 5GNYA 1ZJAA 1PZ3A 2VZOA 3ZJ6A 2YA2A 1GVYA 3VIPA 4Z2KA 2A3BA 2WMJA 2WYSA 1VF8A 4UQCA 1VIWA 2WVVB 1ZBVA 1W1VA 1NQ6A 3OGSA 2BXYA 4AIEA 2D3LA 1E4LA 1CTNA 1RD6A 2EPLX 4CN4A 2O9OA 3BLKA 4EAMA 3WF3A 3W28A 1S46A 2EPMX 1C93A 1JZ5A 1JG9A 1B3ZA 1HIZA 4U3AA 1UUQA 4OBRA 3LPGA 4LYQA 2XVPA 1XRVA 3MS8A 3T0AA 4AY1A 1LL4A 3BAXA 1M03A 3ZM8A 3VGGA 5IHSA 2DT0A 1E5JA 2JEQA 5BXPA 1NM9A 4P7LA 4Y7EA 4ZE4A 4HMDA 1KBBA 4JFVA 5JUVA 4YHEA 3CUFA 3WL0A 3VD5A 4A3YA 2WWDA 2QMJA 1EQPA 1GOMA 1QI5A 1W9UA 2PWFA 3EMCA 1JD7A 1OCQA 4AD3A 3WDIA 4GINA 6TAAA 4J3SA 1PBGA 2VVNA 3PZOA 3QHOA 4OZOA 4CN6A 3VNYA 3W0KA 4J27A 1H49A 3WFZA 4JCLA 2C7FA 2CNCA 4WIWA 5D9PA 1IT0A 4W7UA 4UQEA 1UKOA 3UG5A 1J11A 1DWFM 3RM9A 4TUFA 3N15A 3SCQA 3WNLA 1UD2A 1KR1A 1XSJA 4FK9A 3AHVA 1JAKA 2J7BA 5A6AA 2VRQA 5DMYA 1W9PA 2ZX9A 1J0ZA 2VC9A 3AICA 2W92A 4AD0A 1HNYA 1JDDA 2WC4A 1GCYA 4AD4A 4WSJA 1JZ6A 2PI6A 3AI0A 4U5KA 4MTVA 5I5RA 2ZUTA 2GUYA 3WUEA 4W84A 3VU2A 4CCDA 3OLGA 3DYOA 4UTFA 2GK1B 4ZENA 3NYDA 5A8MA 3SCTA 1BFNA 5GNXA 1OINA 2ZXBA 4KGLA 1JNDA 4U2YA 5KEZA 2ZXQA 5FIPA 3WN6A 1V3LA 3DHPA 1EDTA 5A6KA 1WZLA 2WC3A 4J3VA 4FF5A 3TTOA 2E9LA 5DFAA 2WBKA 1AQMA 2DT2A 1HVXA 3PTKA 4LPCA 2BVYA 3GBEA 2J7EA 1UKPA 1QI3A 2ZWYA 4BQ3A 3L2MA 2UY4A 3TTQA 1BSIA 1E1FA 2XSAA 4AC1X 1ISXA 4ZXLA 4X0NA 3ARRA 1VBUA 3B9EA 1V6VA 2OYKA 2XIBA 3UERA 4JFUA 1G9HA 1D2KA 3SUSA 3ZR6A 2C8NA 4CCEA 3DECA 3BSGA 2WXDM 4ACZB 2ZXAA 1TR1A 4CN1A 1BG4A 3WUGA 1BTCA 3B9AA 1EO7A 3CHFA 3ZOAA 4AZIA 3VINA 3BH4A 1RP8A 4AWEA 4E8DA 2YL5A 4F79A 3MMDA 5CSYA 2V3DA 4M81A 4MNKA 1TUXA 2DSWA 1UR9A 4ACYA 2PC8A 1HP4A 4MADA 4QP0A 1V3IA 1KWGA 3DC0A 2J7HA 2GDVA 2O9PA 3W53A 3W6MA 4AZ7A 3WEMA 2D0GA 1SFSA 1SYTA 1CLVA 1EH9A 1W1PA 3VX0A 4EE9A 1SR0A 2J7DA 3BLPX 5EB8A 1LWHA 1V6XA 4NF7A 4M1RA 1EOMA 3GXMA 1D7FA 2WZHA 3QOKA 2XUCA 2QF8A 2YLAA 5FOOA 1W3HA 1LWJA 1JFXA 1DTUA 3CZJA 5AYIA 1ESWA 3AZRA 2ZICA 4ATDA 2G3IA 4B3KA 5JIPA 3WD2A 3VUPA 3WDPP 2X05A 1E4IA 5CLTA 5AC4A 2XGIA 1EGZA 3WF0A 3QOMA 2PWDA 2DSUA 1OM0A 2O92A 4J3TA 5CQ1A 4PRWA 3O6AA 3U5UA 1R86A 4FLRA 1V0KA 3WQWA 1BVNP 2WMFA 3B8SA 4W85A 3AHYA 1HXJA 1W3JA 1G94A 2VL4A 4CU8A 5A2CA 2GJXA 3PZUA 3WQ8A 1E55A 1CXHA 1MQPA 3UESA 4XB3A 5GPRA 2VCBA 4PMVA 2E4TA 3U7VA 2OO2A 3MUAA 4MNMA 4JFWA 4GI6A 1DWIM 1E5NA 3UCQA 1VRXA 3WDJA 2AMGA 5A6BD 4D6CA 4LGXA 3RM8A 4D1IA 4BCEA 4NRSA 4DWSB 2ZIDA 2EBNA 1HJUA 4S3KA 5HDRA 4D6JA 5I3DA 1HP5A 1AVAA 4AYSA 1OD0A 4CU7A 2CBUA 1C7TA 2XWDA 4MJ4A 1NWTA 2TAAA 2ZUMA 2ZE0A 4JHZA 3SCVA 3T2PA 1E6ZA 1DWHM 3AYRA 3ZT7A 3WD3A 1J9YA 3L4XA 5I78A 1E73M 1OSEA 2OWWA 5A8OA 1AMYA 1Q6EA 4HU0A 4JFTA 3NJ3A 4KMQA 2JNKA 1GJWA 4EKJA 5A8PA 4CVWA 2F8QA 1KXHA 1JL8A 3OG2A 1U30A 1KXVA 3EDEA 2BY1A 3EDJA 4X0VA 1HKMA 1XHGA 1JYVA 3WQ4A 2WVSA 3VMOA 4AZHA 3RPMA 4AZ6A 1DHKA 4UFJA 3MMUA 2VT0A 3QGVA 4UOJA 4MB1A 2Y4SA 4AD5A 5CPSA 2GK1A 3AIEA 1ISWA 2FGZA 3AIBA 2C0HA 2NT0A 2YLLA 3S2CA 3AS2A 1IV8A 1JZ2A 1KGWA 3QR3A 4URIA 1TVPA 4DM1A 1W1YA 5CJ5A 2DQXA 4PMXA 2ZX5A 3N13A 1KR0A 3F4VA 2OZNB 3IK2A 5A6LA 3HMCA 2XGBA 5CLWA 4TOQA 3CHEA 3E1F1 3OLDA 1CGWA 1R7OA 2PWHA 3IANA 4QLJA 1VJSA 3W27A 5D9NA 1E70M 1JAEA 1B9ZA 3KE0A 1XCXA 3ZT6A 2BNJA 4M56A 1LL7A 3PZVA 4N0RA 1O7AA 4UZSA 3FAXA 1CGVA 5GQBA 1ZU8A 1FH9A 3FXYA 4C7FA 2XM2A 1ZBWA 3WH8A 2YA0A 1WZMA 3WBAA 3AHTA 1BVZA 4F8XA 2WW5A 3CH9A 2J7CA 1OIFA 3AIQA 3PHAA 4ZEPA 1GQLA 1BAGA 7TAAA 1MQRA 3VIIA 1UYQA 4CGTA 2WMKA 3QHMA 4CD8A 4PCTA 1UZ4A 4Q22A 1E1EA 1GOQA 1QNPA 1CYGA 2YDSA 1HL9A 3CZGA 4QDMA 2WCSA 1UKTA 2GJPA 2Y5EA 3S6TA 5IFTA 5JIWA 1C91A 1K9EA 1GOWA 1LQ0A 3AMDA 2FDMA 2HISA 1UH3A 1V08A 2WB5A 2F61A 4W86A 1GHSA 2JF7A 1E56A 2BY0A 5JBEA 1GORA 4U2ZA 1OIMA 2IUZA 4D71A 4WKFA 4V28A 2OSXA 4D6EA 1AQ0A 1UWUA 1HJWA 2FH6A 2V5CA 4FLSA 4GZIA 5BCAA 3M6DA 5E09A 1V3KA 3J7HA 5A95A 3LPFA 2WLZA 4W93A 4Z2LA 3W24A 1XGZA 4ZFMA 3ZQ9A 5GNZA 3L4VA 4CD6A 3BAKA 1JF5A 2A3CA 1CEOA 2O9RA 4MB5A 1KXTA 1M01A 4HA4A 3I3EA 1V3MA 5A94A 3AHXA 4W87A 1FHLA 1CXIA 2YOCA 5FCZA 4ML4A 2XPKA 5I0DA 4M82A 1OT1A 2O9TA 2BVTA 3II1A 5ECUA 1VFMA 4DUXA 1K9TA 3G6LA 3WF4A 4WKAA 3ZJ8A 4JL1A 2WVVA 2J79A 1UZ1A 4KH2A 3VVGA 3HU7A 2BHZA 3AXIA 3VO0A 4WJXA 3ARUA 2FHBA 4HU8A 3WD0A 1OB0A 3WFLA 3K1DA 4C7GA 4R5EA 2QPSA 4PMNA 1I75A 4LYPA 1FHDA 4S3JA 7CGTA 3NSNA 2CKSA 8A3HA 5A6BA 2UY5A 3BAIA 4FZPA 1IZJA 3SURA 1V02A 2CHNA 2V3EA 2WCAA 1B3VA 3VTRA 1J01A 2X0YA 3JUGA 7A3HA 2WPGA 3L4YA 1CGXA 2D0FA 2UY3A 4XV0A 4QLKA 2NW0A 4U33A 3AIRA 4BZYA 2UY2A 3GXFA 2PB1A 2DSZA 4J7RA 4H04A 3WDQA 4A4AA 2DT1A 1ITXA 1K9FA 3OZPA 4M24A 3W81A 2XFYA 3BSHA 1BYCA 1OBAA 2W63A 5BYWA 1UA7A 4Z2JA 1M04A 3PTMA 1KXQA 2XM1A 4UQDA 3VNZA 2GJXB 1UWTA 1KCKA 3CUJA 2G3JA 3VOCA 4MAZA 5HPOA 2YBUA 3AZSA 5EMYA 4AZBA 2CEQA 3VD7A 3PZ9A 1M7XA 2OWXA 4GQQA 2G3MA 3CO4A 2WM0A 1UWRA 3GTNA 5CPQA 1NARA 1CGYA 1QVBA 3VMPA 4J3UA 3O9NA 1GZJA 3UR8A 2WMIB 2GDUA 5JBDA 2CERA 3RDKA 3N17A 4TTGA 3RMEA 2XVKA 4P8VA 1KGUA 1OGGA 5C70A 5HXMA 4GZJA 1NP2A 1B3YA 1TA3A 4PSPA 2YJQA 3VGBA 1E72M 1GOKA 5IHRA 1FP9A 1CECA 1X1NA 4AZCA 1FA2A 1JZ4A 5TD4A 3WQVA 1VFOA 4Q7NA 2OWCA 3EDFA 2YL9A 1G01A 3T2OA 1JIBA 1JZ3A 4UFIA 1DWJM 2BS9A 2BHYA 1JYWA 4F66A 4UCFA 2A3HA 1DEDA 4LYRA 2CCRA 1CGTA 1XD0A 3GXIA 4W8LA 4JIEA 3GNPA 2WSPA 3MKKA 3AOFA 3VX1A 2QLYA 2JIWA 3PZTA 5JBFA 1EQCA 2CXGA 3WMSA 1JYNA 2QV4A 2BVDA 3W37A 3EMQA 1KQZA 1ITCA 5E0CA 3SCPA 4D6DA 4UQBA 1L0PA 2J75A 2J74A 3A4AA 3WL1A 2W61A 2J7FA 4DUVA 4P8WA 4MNLA 4YN5A 3F5LA 4QLLA 2YDRA 1R7AA 1R87A 1WO2A 3ARWA 3TONA 2X09A 4E2OA 1YHTA 3ZR5A 2WZIA 4AXNA 1WPCA 3AS1A 3WKZA 3WNNA 3NCOA
chains in the Genus database with same CATH superfamily
1A0EA 3DHDA 3RM4A 2QCMA 4O8AA 5LNUA 1TQWA 4CD7A 1Q6OA 1VCFA 3L2LA 2V5DA 1LLWA 1CW2A 1GOIA 4G5DA 4KRTA 2NUYA 3ZO9A 1K1DA 3S3GA 2WKJA 1M65A 1I9CB 5DMMA 2GSEA 2HBVA 4PMUA 4BA0A 2D20A 4HTBA 4DWSD 2XU2A 3G0XA 1J18A 1CXKA 4PA8A 2PRMA 1W5PA 4ZB5A 4XO6A 4DI8A 3R0UA 1AG1O 4A05A 3EOUA 1BGAA 2QCLA 3O15A 2ZDRA 3A6OA 5A1AA 3HPXA 4QAWA 2CYGA 4UFMA 3W23A 3BCFA 3MO4A 3FY1A 3V3WA 3W7PA 3ZVHB 4DYJA 5L6UA 3KOFA 3PG8A 4GBDA 2I14A 1VEPA 3TWAA 5BZAA 4UTIA 5I3FA 1OGBA 3E0LA 4EF8A 3AYVA 1R2TA 2AAMA 3LXCA 4XKMA 3V5CA 4AVNA 3A4XA 3KAWA 1ADDA 4FSAA 4C6NA 2X30A 2D4CA 4UR9A 2G95A 1VFSA 3L2IA 3OP2A 4DBSA 2ZZ3A 3C0LA 1QJWA 3KEHA 3NQEA 4ZA0A 3W74A 1KBLA 3T0BA 1C3FA 3W1XA 5C8BB 3E0FA 1TV8A 1BGGA 1WNOA 3GIQA 4NZCA 3WQGA 3MJYA 4O8RA 2CIPA 3PPCA 1I2PA 1LTDA 3UY8A 4HNLA 4X63A 1HKWA 4DPQA 2I5QA 4IWOA 4W88A 4DWSA 4JQ1A 1QNOA 2FB3A 3CUGA 4C7DA 3U9IA 3T47A 4AUBA 3GFYA 4FIRA 3STFA 2J7GA 4XKYA 3SB0A 2XIOA 3BVJA 4EZUA 4G7EA 8XIAA 1SGJA 2XWEA 3ZYZA 5J5DA 2G97A 5D2TA 3W2LA 1FWBC 3GH7A 3QPEA 5FKYA 4E4FA 4IISA 3S2MA 5G4WA 1GVRA 4Z2GA 4AZ5A 1TV5A 5I24A 3EWZA 1OFOA 1X7IA 3OVRA 3EJSA 2OR2A 3FYOA 1RBOB 3PBWA 1F73A 1XV8A 2UZ9A 3NQBA 1TMHA 3M3WA 1ISVA 2JKPA 3ZSTA 2WK2A 1BVWA 3KVKA 3FD9A 1DWAM 4B5SA 3LSCA 1XQLA 4N2YA 4HNUA 4PTDA 1HJSA 3FEQA 1XFBA 3GR4A 3WY1A 1W9VA 2EAWA 2ZZ5A 1R3VA 1V3JA 3E49A 3ABSA 4JTTA 1I0DA 1I4NA 2QCDB 1X96A 2QPUA 1UPPA 4L80A 3PUGA 1R8LA 3MV01 3SADA 4LQ1A 3BJFA 2EEXA 3B8TA 4QCEA 3KLKA 3P5YA 3CV2A 3HG4A 3WH7A 3VKDA 3RLHA 3QYSA 2MANA 3DFQA 2ZQ0A 4PMDA 5AVHA 2VEMA 4GKLA 1MWOA 1YYAA 1NH6A 4KW2A 5A6SA 1Z6KA 3W2JA 3OIHA 4FZSA 1VYRA 1TR9A 1GZGA 3B9NA 1PX4A 3H2MA 3ATYA 1DKZA 2GOKA 1H50A 3DFSA 4NX0A 3S83A 3T44A 4AD1A 3W1RA 4CU6A 1V0NA 3GXNA 3W71A 4H6HA 4H6KA 4BQ2A 3WQ5A 2V38A 3STGA 2BY2A 3LGEA 1R9YA 3TLQA 1PAMA 1R5YA 3HAIA 4LVFA 1QI2A 1I4TA 1F5ZA 4IMCA 1WQ5A 3ITVA 3PAJA 1UUMA 1X97A 3ABHA 2PLJA 5FL0A 5ABEA 3EPNA 2E3ZA 3EB2A 2IMRA 4JTSA 5FF2A 3WJXA 5C9UA 1BSLA 4QEHA 1QR7A 4GI9A 1QOQA 2EF9A 1AUSL 4EZQA 4LVDA 3CPUA 4AZCB 2XN1A 3K2GA 4QITA 4RX0A 4G8TA 4UTJA 2AAAA 3K8LA 3LB0A 4JNMA 4C6JA 3B40A 2VZVA 3VOGA 1N8FA 1N7KA 1BD0A 1TMQA 4GUFA 3UFYA 3UBPC 1E6RA 5CBBA 2N3KA 3DKLA 3DX0A 2FDSA 4ZO6A 5CZTA 4AEOA 3EDDA 3T2QA 3P82A 3AQUA 2PTYA 1QHPA 1ME7A 1H5VA 2FGLA 2W5FA 3WQDA 1O95A 2V9DA 4HY9A 4JGDA 2HVOA 4H01A 4D8LA 3GDKA 3HOJA 1QOXA 2EKGA 5HOSA 4MWAC 3E6EA 1I60A 1EBHA 4E8GA 4RNHA 3B53X 3FYPA 1NP0A 2ZUNA 1QXLA 1Q7MA 2V5KA 3SFWA 1XLEA 4DJEA 4HA3A 4MWAD 3AWNA 3N9KA 3UYCA 1E0UA 5HMDA 2V3FA 3TN5A 4BWLA 3FDKA 1UR0A 4DEFA 1GONA 3JS3A 3BCJA 2WVUA 3TLLA 3RX4A 4EIVA 3GC5A 1JRBA 3WBWA 4EWND 2IXVA 3VNKA 3N3TA 3GTXA 4GABA 1XJBA 4B9QA 2NXGA 3SM0A 3LI1A 3KDNA 1HL8A 4ATWA 3GHRA 4WPCA 1QI4A 5GJMA 3UGVA 1YDNA 4X3ZA 3KLLA 3LA4A 2B31A 3I3DA 1B2YA 4C1NB 1XLFA 1YPXA 4Z2IA 1A49A 3K46A 4JYEA 5AYZA 3AMGA 3BAWA 1XX1A 3OVQA 1W9BM 4XTIA 4GVHA 3KBMA 3TTYA 3A64A 3QKEA 2NQ5A 5DT5A 5H8MA 1SFJA 5SWUA 4XQ6A 1X1ZA 3L68A 2VZSA 3MWAA 3UJFA 5BNKA 4EF9A 2VEPA 4HU4A 2YI9A 3O16A 2YB1A 5HMSA 1K03A 3QW4B 3M0JA 5E84A 1HJVA 1VLIA 3G0UA 5A6JA 4RLIA 2PDHA 4NUWA 2DUZA 1GJUA 1WDQA 1LQ2A 3TYUA 4C6OA 1GKQA 1UQYA 2E6FA 4C60A 3A13A 2Z26A 3QW3A 2REQA 1RVKA 1GNTA 4ZCWA 3REQB 4PC8A 1X8CA 1HKIA 1BHGA 3QR1A 4JL2A 1DTNA 1VBJA 1H4PA 5D9OA 5FJTA 3ONBA 3QTGA 3F1QA 1MFVA 2QEZA 1Z3NA 3UETA 2X0SA 3UQNA 2BBFA 3PZQA 2WAGA 3VKJA 1YPIA 5LNWA 1H7RA 4C6LA 3PZMA 4B9ZA 3R79A 2PDMA 4J35A 4BQ5A 1K8CA 1QNQA 4AH7A 3JZUA 2DGAA 2QPXA 1XPGA 4HZMA 3WBEA 1O66A 3CMJA 3P81A 4H8VA 3CUIA 4B2DD 2NSOA 4PTMA 4L56A 3TN3A 5L9FA 2XH2A 1IXQA 3NL5A 4GUHA 2OO0A 1U1HA 4LXFA 4BKNA 3MV11 4KEVA 5LA2A 1VCVA 1LF1A 2C14A 2PWEA 3SGZA 1W3KA 2KHOA 3FA3A 2DY3A 1MW3A 2GL5A 4YYFA 3H23A 1NWRA 3G1SA 3SY5A 5KTLA 3MI2A 4MB3A 4RE0A 2YBTA 1W5OA 1NY1A 1X8FA 3NIYA 2IXUA 4WOQA 2VGIA 3SO7A 2X1TA 4ASTA 2QUVA 2E9BA 2XTKA 4UFLA 4O13A 1UH4A 4HNOA 5T91A 3DFYA 1RUSA 4JNYA 1UC5A 1JVNA 2GOUA 3LCXA 2GGIA 3WNPA 4M1BA 4MFEA 3EWXA 3QPYA 2DEPA 2GGGA 2PMRA 2BVWA 4U5IA 1DJXA 1C8XA 5HNNA 4L9XA 2WMIA 3NEHA 2WHMA 3GO2A 5DRCA 5KINA 4C6FA 4S3FA 1UP2A 1HN1A 4Q32A 4AVOA 4A8RA 3D3AA 3W7LA 1O12A 5CG0A 4H8HA 3ER9B 4EZTA 3VKAA 1XIGA 2H8XA 2GAFD 5EBAA 2W62A 2PGEA 3T4CA 1HGYA 1GW1A 4UDXX 2J88A 3UZXA 3T8LA 5TKYA 3I39X 2QJNA 1EB3A 5DN1A 4P8XA 3AUOA 1AQHA 1XXXA 2FFCA 3WQOA 3MP3A 3S5NA 1XIFA 4H6IA 2BV9A 2INEA 2Y8VA 1AODA 2YKKA 3KZSA 1FHUA 1XRFA 2RGMA 4OE7A 3MY9A 2DH2A 5HJXA 3URQA 4LS0A 2PU1A 4IGNA 8CGTA 4E4PA 1UH2A 4EZZA 1T41A 4D6GA 1XG4A 2V63A 2R24A 1LBLA 4HNCA 3DHUA 1BF2A 1Q5MA 1TRDA 3QY8A 1OEPA 4XBJA 3C0JA 1JXJA 1TJ2A 2VOTA 2VEGA 2PD5A 1XWYA 3PN8A 5IBXA 1FY6A 5G2IA 1R46A 1ISZA 3PZNA 3O6CA 2HVMA 1Q6RA 1K9DA 2HJPA 4NPHA 1HQTA 4CCZA 3CHDA 3FX4A 3FEMA 4ZE5A 2ALDA 5EMJA 3G24A 5JQ9A 5CKSA 3CWOX 5HR7A 2OX4A 5DEZA 4FLQA 2XISA 3KCJA 2VUNA 4RE4A 3WMLA 2HMCA 4PEEA 4EX4A 4C6IA 1SZGA 4GPNA 3BE7A 3DFOA 1M9HA 1ZBCA 4DO4A 1V3HA 4QAIA 3POCA 4HK7A 3DFNA 3PB2A 4MY1A 3DYMA 1J2BA 1HVQA 1JF6A 1S2CA 4W8BA 3W3OA 4L61A 3DZ1A 1J8VA 1YLVA 3NTYA 1XKYA 1F4HA 1XLDA 2EO7A 1VS1A 4RE3A 3E96A 4DJED 3N29A 1MFUA 3CPGA 1WDSA 4DF1A 2GSJA 1TJ1A 3N4FA 4K36A 1CGUA 1UB3A 5KZDA 3ITGA 4UFKA 3SZ8A 1LRNA 3W7HA 3V0TA 2DJXA 1UR4A 2XINA 1CIUA 1KKRA 2RKXA 4A3HA 4FMVA 4NHVA 4PCSA 1Q6GA 2BTMA 3P5ZA 4HK6A 1Z89A 3ARXA 1XYMA 5LIWX 1MO0A 3U7BA 4GKTA 4IGMA 3TYCA 3NQ2A 2XHYA 3EPMA 3VKBA 3EBVA 2GJNA 3NQGA 3C2EA 4H3DA 3VKKA 5DT7A 3QF0A 4WUIA 2QUUA 3CAKA 3DYPA 3RCYA 3KZPA 3CTLA 4JY8A 4JD4A 3HAJA 1LUCA 3RU8X 4FXSA 2DDXA 1FWDC 4IP4A 4E38A 3TYZA 2A21A 2VR4A 4PUDA 3CZSA 5C71A 1VH7A 1SSGA 3LYEA 3L67A 1OHLA 1AJ2A 2R9RA 5AC5A 1SSDA 4ATMA 2A5HA 1VGAA 4P7OA 3M5YA 3QNJA 1MI3A 4BF7A 3NZQA 1RH9A 3G8EA 1QBBA 3VGEA 4QNWA 2YCJA 1VB9A 1W91A 5AOUA 1U22A 4XD3A 4ZQOA 3LI0A 3HQNA 1E6SM 3K4WA 2HXUA 3F03K 4GJ1A 3GHUA 5I03A 3FYYA 1V0MA 3TX9A 3NZPA 3O6YX 3ZIZA 4WK9A 1G4EA 1US2A 2VJXA 3W2KA 1RP9A 2Z0VA 1M53A 3RIKA 4LT9A 2POZA 4FR1A 4FNRA 4I5UA 3D3FA 3R4IA 3TTEA 4P5UA 1QHOA 3VCRA 4NX5A 2VCCA 3GSMA 1FWCC 4B90A 2GFTA 1Z32X 4M8UA 2PDJA 3RG6A 3IARA 3OVGA 4KRUA 2DH3A 1V51A 4S39A 5E93A 4PB5A 4Z1YA 1BWVA 3NO1A 7XIMA 3NSMA 4DF0A 5BW6A 2TMDA 2XJ7A 2OZ3A 3B0PA 3SIMA 5D38A 4A22A 1XDMA 1ME9A 4UTTA 3MYPA 1ECQA 1YDVA 2OPJA 3OZMA 5JMUA 3C8FA 2B4GA 1PJ9A 1S5WA 2DIJA 4AIUA 4N9DA 2A2IA 1O1ZA 1IWBA 3FKKA 2G5WA 3AXXA 2NWRA 4OHQA 1E4MM 3THCA 3WF1A 2VGBA 5I23A 1LLOA 4B4FA 1TWDA 3UA4A 1JRCA 3LLFA 1JD9A 3SUWA 3I6RA 3CWHA 1SZRA 4EPKA 3MMTA 4AX7A 4QSFA 1TO3A 2GWNA 2CETA 3TSDA 4ZOCA 3KRSA 2AL2B 3BUBA 3F5KA 2F6UA 4HNVA 1UPXA 1E3XA 3ARSA 1CBGA 3BMWA 3GK0A 4R85A 3VC6A 2J6VA 1AFSA 4HMEA 2IPWA 2C71A 1QWNA 1C90A 1XYZA 1WKDA 1QNVA 1DJGA 1PO9A 5D37A 1RZMA 5CZJA 1CDGA 1XCWA 3FW6A 2ZUVA 3A24A 1XH0A 1ZJHA 3W1TA 4N6FA 3RPDA 2Z0IA 3ZJ6A 3VIPA 2CHRA 1JR1A 2HZGA 3C52A 3KM8A 1NQ6A 5LIXX 2BXYA 2D3LA 2UBPC 1E4LA 1CTNA 2EPLX 4AVMA 3K30A 3WFAA 4D9PA 4EAMA 2ATMA 2HK1A 4YNGA 3S1XA 4PUJA 1P1XA 1UUQA 1TZZA 1T5AA 4MKVA 2VDIA 1XRVA 2PU0A 3T0AA 3CV5A 3DPPA 4AY1A 1ONXA 3GNDA 2V0OA 3PFMA 2CZVA 5HULA 4MYAA 4GYKA 5BXPA 3MHUA 1NM9A 4Q8WA 4P7LA 4Q4OA 3VEAA 1DVJA 1V7YA 4HYRA 1DV7A 3WL0A 4JWIA 2QMJA 1GOMA 2A1YA 3E0VA 1QI5A 1W9UA 3TVAA 2XSXA 4GINA 4Q8QA 2Q8LA 1R3WA 1PBGA 2EG7A 3VNYA 3W0KA 1EP1A 3WFZA 4J4KA 2QJGA 3WLJA 2ZYFA 1R9ZA 2X7VA 1UKOA 5DMLA 2R1LA 1ICQA 3MJMA 3RLGA 3N15A 1XL9A 1O5XA 4HSHA 3SCQA 2E25A 3WNLA 5DMYA 4KWSA 3AICA 2W92A 2C91A 3BUDA 2A3LA 4ORMA 3B06A 1HNYA 3ABZA 4JTCA 1X6UA 1JDDA 1NFPA 1GCYA 4NNCA 1EX5A 5HANA 1FWTA 1PKNA 1TPH1 4A29A 2VC6A 2ZXBA 2BWGA 5H91A 3EKZA 4KKXA 1V3LA 1KM6A 1UC4A 4NAFA 2WC3A 3H7VA 4JEJA 2WBKA 3PTKA 4LPCA 2VR2A 5CC3A 1VCGA 1M7JA 1GWJA 2J7EA 1E1FA 2ACRA 3V35A 1ISXA 3RO6A 4EZOA 1F7BA 4X0NA 1VBUA 2Z4GA 3B9EA 3NFUA 4GY0A 3B3DA 3ZR6A 2C8NA 4HD5A 1XLJA 4CN1A 1BG4A 3WUGA 1BTCA 4AWUA 1XBVA 4AZIA 4IMGA 5G1YA 3SJ3A 3VINA 3NYZA 1L9WA 3BVWA 3H6OA 3PBUA 4TU1A 4E8DA 4YVXA 4C5ZA 1SUFA 2V3DA 4BWLC 3PUDA 1TUXA 2HVNA 4QP0A 5HJYA 1V3IA 1KWGA 2J7HA 4GLEA 4XZHA 2D0GA 2FLIA 4J40A 1RJRA 3Q94A 3VX0A 4KWVA 1IXPA 2J7DA 3AU2A 4QG8A 1V6XA 1XISA 1B57A 2PPGA 1EOMA 3GXMA 1D7FA 1FWWA 2H6RA 2XUCA 2YKTA 2PDYA 2PDFA 3LDVA 2ODOA 1DTUA 3CZJA 2I5IA 1NFGA 2IPJA 4UB9A 1YTDA 2GQ9A 4FX8A 1DJQA 4RDWA 3VUPA 5C9XA 3WDPP 1KCZA 5CLTA 4NKCA 5AC4A 2XGIA 3W83A 2PWDA 2DSUA 4J3TA 4GX8A 4PCFA 3M44A 1R86A 4FLRA 3WQWA 2QIWA 2BOFX 3I7RA 3OODA 3WK2A 1OF6A 4HYBA 1NEYA 2WMFA 5AFDA 3HAHA 3ZVIA 1W3JA 1TVLA 4CU8A 5A2CA 1AH3A 1E55A 1MQPA 3MZNA 4XB3A 2ZC8A 2E4TA 3G1YA 3U7VA 5BOFA 4ZTXA 4XIMA 4F0KA 5FJIA 3TC3A 1C9WA 3UNDA 1NJJA 3WLPA 4NL1A 2ON3A 3WDJA 2AL1A 1VFLA 1FWEC 5A6BD 2AKZA 4LGXA 4POCA 4BCEA 4DWSB 5CZ0A 2EBNA 3DFHA 3PULA 1VBGA 1AVAA 4FNTA 4JL9A 3S2NA 2ICSA 5C2GA 2XWDA 3BZJA 3S9IA 3OOQA 3HFYA 4H9XA 3S5SA 1BRLB 2ZE0A 3SCVA 3GVQA 3V36A 4NXSA 2GJLA 4MHBA 5I78A 3LLXA 4GE8A 5K9XA 4RW3A 3LQGA 5C0QA 3CPRA 4JFTA 2VGGA 3NJ3A 3CL8A 1S5VA 3G77A 4DJFC 1XLAA 4GH1A 1EKOA 1GJWA 4CVWA 1U5HA 3N6JA 5K9DA 3LM3A 4IZGA 3WLOA 4Z1CA 2O4QA 3V1HA 3EDJA 4RPQA 2D69A 4IXXA 1UPMB 1HKMA 1XHGA 2J27A 1JYVA 1GG1A 4JYFA 5G1TA 1DHKA 2QCHA 4IQLA 2DVUA 3QGVA 4MB1A 2Y4SA 3GY1A 1QMLA 3G5EA 1NU5A 4IFKB 2FPTA 1TJPA 2GK1A 3DDMA 5CPSA 1TJ0A 5FAJA 4H9TA 2YLLA 3AS2A 1IV8A 4U4MA 5MKGA 3UXDA 2VFGA 5CJ5A 1TJRA 1TPFA 4FOKA 3O05A 3KAVA 3HMCA 3USBA 1H7OA 1CGWA 8RUCA 2J9YA 1I2OA 1XCXA 3OW1A 2FPVA 3PZVA 1LL7A 2V30A 5GQBA 1FH9A 3FXYA 2WSYA 3JR2A 3TR9A 3AHTA 4UTLA 4ZR8A 4F8XA 2OODA 4TR9A 3AIQA 1A50A 4RK8A 1BAGA 7TAAA 5KZMA 4CGTA 4HHLA 2WMKA 3RCMA 1UZ4A 5EKYA 2P10A 1E1EA 1CYGA 2AMXA 5CAHA 1HL9A 4BI5A 1FWSA 1IEXA 2IPFA 3FV9A 6REQB 2PE4A 5IFTA 4DHGA 2PP3A 4CEUC 4KIEA 3UJSA 3NXFA 2HISA 1UH3A 1V08A 1DXFA 4W86A 3N2MA 1GHSA 1AMKA 4EZVA 4ENLA 3SN1A 3D46A 1OIMA 2R6OA 2IUZA 4XSMA 1UBSA 3BUVA 4YLWA 3G0SA 3E2QA 3TMLA 3GR7A 3T4AG 1JGMA 2V67A 4IP5A 5DY3A 3J7HA 3LPFA 3NQDA 4RDVA 3NZGA 4HCDA 4W93A 1XGZA 2BZNA 3ZQ9A 2CLKA 3HPAA 3ITYA 4XVDA 1EFZA 5DBUA 2PLCA 4MB5A 1R3TA 3TKFA 3QC0A 4W87A 3LCLA 3AXKA 3HZ3A 4UNLA 2X3VA 1CXIA 1FHLA 2A4AA 4O10A 2I57A 2ZZ4A 4M82A 1OT1A 3TXVA 5I09A 5D33A 1IEQA 3PWGA 1VFMA 1LT7A 4Q4RA 5I7GA 4WRHA 2F84A 1DOSA 3N9SA 1UZ1A 1M3UA 1CX9A 2YCEA 3W7EA 2QCNA 4N4QA 2A79A 2GDQA 5C54A 1SVDA 4DJFD 3CJPA 3LSBA 4C7GA 3AWOA 4PMNA 1DPMA 2ANUA 1FHDA 7CGTA 3JZEA 4WJEA 4B4HA 5A6BA 2UY5A 4LYKA 3LLDA 2WCAA 1B3VA 3VTRA 4JDYA 4GIYA 1QW7A 1IIGA 2WPGA 1EF2A 3R89A 3L4YA 5HR6A 3LOTA 2NW0A 2E09A 1GZ1A 4JX4A 4TV5A 3GU2A 4H04A 4A4AA 2DT1A 1SUXA 3ITCA 4G6CA 3RYSA 2Q3OA 3OZPA 2XFYA 3I4KA 4K7YA 1URUA 3NURA 4AB4A 4UQDA 3VNZA 5D2XA 1KCKA 1XLBA 4Q8PA 3HFTA 1PYMA 3NQCA 2CZEA 1DKWA 3T48A 5HPOA 2RJGA 4R3UA 5EMYA 4AZBA 4ES4A 3OO2A 4LFYA 5CBJA 4GQQA 2W6RA 3U8GA 2G3MA 3GXPA 3CO4A 3GTNA 4ZMGA 2FGBA 1T8QA 3M4HA 1OX6A 1QVBA 3PK7A 3PUEA 4NAEA 3W1UA 4E2BA 1C9DA 3G1HA 1G4SA 4Q4SA 4R34A 1S2WA 4P8VA 1KGUA 4GZJA 5JXQA 2W3ZA 1TUFA 1NP2A 2BOEX 3RUBL 1V8EA 1HFBA 2P3ZA 1V4YA 3VGBA 3L66A 3MTWA 1W56A 2PZ0A 3ZLFA 4QJ4B 1QWKA 1JZ4A 4JTFA 2YXOA 3SJNA 4Q7NA 4ZO7A 3T8QA 2VKZG 4XZIA 4UFIA 1P1MA 5BMXA 2NVAA 1K77A 1CGTA 2ZA3A 4MZ1A 4Z1AA 4QX4A 1IXNA 3ORWA 1EP3A 3MKKA 3F2CA 2QLYA 3PZTA 1EJ7L 2CXGA 3WMSA 3W1MA 3T9PA 5AHIA 1PCWA 1ZALA 2D2GA 4UQBA 2J74A 3THAA 1EJSC 1KM0A 4S3CA 3WLLA 1MZHA 3BK0A 1HW6A 4ZQCA 2BX7A 1QOPA 1JCLA 4EZRA 3RMJA 3UZYA 1UZDA 3WZ0E 5EA9A 2X09A 4E2OA 2CWNA 4HJFA 4JS3A 1WPCA 1BXCA 3GXTA 3I01A 3C8NA 3WNNA 3NCOA 1OFRA 5C7HA 9XIMA 4TXEA 1G1YA 1BF6A 3UWEA 3L7RA 2YPIA 4UR7A 2PZNA 1BYBA 4KETA 1X6NA 2PF0A 4UC5A 4KRZA 1W0MA 3TZNA 3H4GA 1VJZA 5LIUX 1YPFA 4DXKA 1HJXA 4FALA 1OWQA 2WV8A 3VIOA 3SAZA 1XD1A 3PBMA 4LCRA 3GYEA 5BWFA 1KFKA 2FYMA 3MSRA 2QCCA 1LROA 3S1UA 2IS7A 3UJEA 5AHMA 2BASA 3LK6A 1BQCA 1FH8A 4JIIX 4N9BA 4FNSA 3CB3A 1DQXA 3NPVA 1MXDA 4CQCA 4L65A 4EZSA 2VEKA 5CCZA 3ZEDA 1A47A 4UDYX 2ZRWA 3BGAA 1WB0A 3ABXA 3FHQA 4GQRA 5FA5A 3HQOA 3KHDA 3RCNA 1E1CB 1UD3A 1P6WA 1PVNA 1VIZA 1TWWA 3WLKX 1IIHA 1MXSA 1IZCA 3LRMA 1XYLA 1QWUA 2OGJA 3OBAA 4Z0JA 3AS0A 4NI8A 5A8NA 1V77A 1ZTVA 5M3WA 4DYEA 2NUWA 5DRIA 4ACZA 2E40A 4DM2A 4O1FA 3M46A 1UMLA 1X38A 2Q8ZA 3BUPA 3VM7A 3K8KA 1XH1A 4G9PA 3Q2DA 1JPIA 4QCFA 8XIMA 1LOQA 5ABGA 5A8QA 3IIPA 4HHHA 1P4CA 2Y8UA 4GUIA 3T55A 3ARVA 3QQ1A 4GYPA 3EAUA 2WKGA 1WAWA 3VDCA 1R38A 4R5JA 3CHCA 4K3ZA 4U28A 1KGXA 3NVTA 3SCOA 3FJ4A 3WENA 4HNNA 3C2YA 2YBVA 1KD0A 3PUOA 4XZLX 1KFWA 1EL3A 4RKAA 1XCFA 3GDRA 2NLYA 4QG9A 2VHLA 5I77A 2Q01A 4IFRA 3HG3A 1H2JA 4FXRA 2NV1A 3QV9A 3ZT5A 1Q13A 1DQUA 5AHNA 2GA9D 3G2GA 4WXYA 1H11A 3EJQA 1VHCA 3MC5A 5CGTA 4H9UA 2E28A 3QXBA 4IWWA 1LQAA 4NQ1A 2VQTA 3QPZA 2R8WA 4F9DA 1QNRA 1AZ1A 1PCKA 3INPA 4JX5A 3APTA 2E7FA 3RR4A 4IMAA 3T07A 4WR3A 4LALA 1MW2A 5FLEX 1BG9A 3N6QA 4R7WA 1TTIA 1UMYA 1F2JA 2GSHA 3ERCC 4LS1A 4UOQA 2RHGA 4PO2A 3BAYA 3D5HA 4XO7A 4Y8FA 1YQ2A 5E0FA 3KOWA 5DQPA 3FNDA 2V3GA 1FUYA 3BSMA 4MZYA 1R3YA 4OTKA 1QK0A 2E5DA 2XFFA 3LMYA 4DYLA 3P0WA 4GXMA 1PDYA 4HCHA 3G1AA 6TIMA 1NDYA 5I3KA 2OG9A 3WMBA 1W9DM 2HQAA 4M51A 4I8YA 1LWIA 4DAFA 1RPKA 4U31A 4GD0A 1ADOA 2E8ZA 3MVTA 2OFJA 1DKXA 3I6TA 3QY6A 1UR1A 3KTSA 2PDWA 1VEOA 1JDCA 4QNEA 2DIKA 3PG9A 2OMAA 2X40A 3DN5A 5GVJA 4IJCA 3H2EA 4GO8A 1ALDA 5A3HA 2PDNA 4AVFA 3TW7A 5LSMA 2G3FA 1VKFA 3FGCA 4DO5A 3CAWA 3WQEA 3G1DA 3LHTA 4Z17A 1TWZA 4W8AA 1S3HA 3PFRA 3S2LA 4MMWA 4HN8A 3DG7A 3K4DA 3DGBA 1DL3A 1LLZA 2GUBA 2B7PA 2VWTA 1W31A 4ZVJA 1EYWA 5REQA 4LX4A 1ZS2A 4JAWA 3AMCA 1HJQA 5E6ZA 4IMDA 4GG9A 1HO4A 4WD0A 4Z1DA 4RDZA 4W7VA 1RR2A 4PB4A 4AHPA 5GJPA 3F4CA 1ZPTA 2Z29A 1H7WA 2IQ0A 3G3DA 5J5RA 1P5BA 4D1JA 1J10A 1I6NA 1L8NA 1Y2OA 1QT1A 4H2CA 1XSKA 4LY4A 1UD6A 4UBPC 1LUCB 4DBDA 7TIMA 1TX0A 2QNEA 1HKJA 4KEZA 2Y5SA 1XG3A 1SZEA 2DW7A 4V27A 3GC4A 1QW9A 3IRDA 2ONEA 3T81A 9RUBA 4KFOA 1EJXC 1XIHA 2PD9A 5U7SA 1J2WA 2ZX6A 5M1TA 4CQDA 4H7VA 4A8LA 1XGDA 5LNSA 4JTIA 2EPOA 3ZLHA 2CBIA 1FBAA 4ZOBA 2VR5A 3LVTA 4KEUA 4A2RA 5AC8A 2XVNA 4LANA 3SCUA 5I02A 1GVEA 2QF7A 1FWNA 4QE5A 1UUOA 3TSMA 2VUYA 2PMQA 3EA2A 2ACSA 2VRJA 1R30A 2W66A 5BXRA 2VDHA 2PDKA 3MMWA 4R53A 3MA8A 3ARTA 1XFCA 2YA1A 4ZTYA 2B0MA 3IJ6A 4GI4A 2OT1A 2FYVA 1M7PA 3W26A 3LPPA 1TFVA 2R1MA 3MSYA 2FZMA 3LEPA 1ZCOA 3GG8A 2GZXA 2J9XA 3N04A 5AVNA 1WDWA 4JNFA 3S5ZA 1R0MA 4PMYA 3OU8A 1L2QA 3BGGA 3QH2A 4RCXA 1ZSXA 4LAZA 2P5NA 4EWJA 1UJPA 3BVTA 2GVYA 1KBKA 1BYDA 1P0BA 4TV6A 1FCBA 2XFRA 2XG9A 1G0CA 1U33A 4X9YA 3B0UX 1BXNA 3BV7A 1XDLA 2J9ZA 5LKYA 1VENA 3ZJ7A 3O3RA 3BANA 3UT0A 2LM0A 4EZXA 4LEFA 4PTWA 2ZOXA 5CPNA 3M0LA 3GG7A 1EEXA 1OC5A 3H22A 2XH4A 5BXSA 3N2BA 3E2VA 4NI3A 5C9ZA 1EWDA 4A35A 3GRIA 4P2VA 3WF2A 3U4AA 3WLIA 4WPEA 1QO5A 4IFOA 1BYAA 3LHUA 1CZ1A 4DZIA 4LF2A 4LU0A 4MUPA 4QR6A 2NV2A 2G0WA 4B9YA 2NXIA 3TNOA 4IQJA 4W5UA 4ORIA 3NSXA 3UR7A 4KIKB 3DHFA 2V0TA 1E3ZA 3Q37A 2C08A 3RV1A 3UXLA 5CZKA 4AWTA 4IX0A 1F9CA 4OOUA 3WLNA 1M6JA 3W1QA 4AIBA 2P53A 3M47A 4US5A 4LAMA 5D2VA 1SO3A 1JQVA 1ZL1A 2C1HA 3GNXA 1UASA 1W1A1 3SSZA 4HZ7A 1W3LA 3TTSA 1XGEA 4PMQA 2DPEA 4IIBA 4LCSA 1QI0A 4CQ9A 3GNRA 3H2CA 4L6OA 4CNUA 5LA0A 2ESCA 4IG2B 3S5YA 5IOBA 2JF6A 1OX5A 2EPNA 2NQLA 4GCXA 3ALGA 1SFTA 2PFHA 2H9AA 4W4QA 3E12A 3D6NA 4KS0A 2NVDA 2Z1KA 1KB3A 4L6HA 1RPXA 4GXWA 1UWIA 1VBRA 1RLCL 3CQ0A 3IWPA 5ABHA 3GG1A 1W9XA 4HOWA 1TZ7A 1V6UA 3TOYA 4PN2A 3O3OB 3IIZA 3RFAA 3VGFA 2D24A 3CASA 3W22A 4M6UA 1M68A 2PP1A 3S42A 3H12A 1TE1A 3RK8A 1SU7A 3ES7A 3O2LA 3DX1A 2ZZ7A 2O56A 1JPDX 3DC8A 2GQ8A 5AHLA 1JPMA 1V6YA 1V02E 1Q6FA 5JVLA 3F4WA 3NO3A 5FJOA 4LJ3A 2PBOA 3NUKA 2GWGA 4HTYA 3W7GA 2ZDSA 3BLBA 1E51A 1OD8A 2FTPA 4Z42C 3MANA 3THQA 3L12A 2YXXA 2ABAA 4UMBA 4ICNA 3NDYA 4WGXA 3S6OA 2Z1BA 3H26A 1DE5A 4DB7A 3CIVA 3EWCA 3NO5A 1JZ8A 2ZADA 4GK8A 3LENA 4QRNA 1FDYA 4B16A 3HPFA 1IWAA 3VNDA 5E6YA 2ZUWA 3Q45A 3SCNA 1DBTA 2DP3A 4EVZA 3TFXA 3L5LA 4E2VA 2O0I1 3BG9A 2V81A 4WDTA 3C2RA 1ZQ5A 3ICJA 4ZOAA 1CXFA 1K7EA 3RX2A 1A0CA 4XAFA 3KXQA 3S1WA 3HMJG 1JXKA 3RXZA 3GVVA 5B7ZA 4LC6A 2VC5A 4H7ZA 3N2CA 2TRSA 3PTQA 5EBUA 2D3NA 1A4LA 1OC6A 1FFQA 5A69A 5D4YA 2NSXA 5REQB 2UWFA 4FLOA 3L3OM 4AISA 2W67A 3DXIA 2OZ0A 1C92A 4J9JA 4KEMA 1GYMA 5ABFB 4XZBA 5I79A 4Q6JA 4ICCX 1NDVA 1J0KA 1QW8A 5G4EA 3UR5A 3DPOA 3RJXA 3I3BA 1C8QA 1PV8A 3IAQA 3R25A 3OGRA 1GUVA 3CMGA 4RDYA 1GQIA 3H53A 3GIPA 2X41A 1R3QA 3NGFA 2YCLB 1NWSA 2AL2A 2YR1A 5C6MA 1CCWB 4JCMA 4HPJA 3KOZA 3GYCA 1AW2A 3DX4A 4GFIA 3KVLA 4NAEB 1S5NA 3V5FA 3S47A 1TG7A 1EWEA 5K4ZA 5AYYA 3BO9A 4DBUA 3IJ7A 1RQBA 3T08A 4MNJA 3ERPA 2Y61A 1KFEA 4DNHA 4LBUA 3VMNA 2QMKA 5HMFA 5DCBA 1EOKA 4O19A 5DMNA 3RLUA 3W01A 1TCMA 4IL0A 3T09A 5IDIA 2CZ5A 2FHCA 1DHPA 1H51A 1WKEA 1H0GA 1GOXA 4EXBA 4LUSB 1BLIA 3SEPA 1FH7A 3WMCA 1HF6A 4O16A 3PJWA 4M80A 2YXGA 4WVXA 3VIMA 4GNKB 2XDFA 2QKFA 4TVDA 1B3WA 3TCSA 4YU1A 2REQB 3A47A 4AHQA 3QLDA 1XRTA 3EXRA 1F4AA 1RCOB 3DKJA 1ZRQA 2E6DA 2OOGA 4MJ2A 1JQXA 1T40A 4PMOA 1JNEA 4AQLA 4CNTA 4S2CA 1WDPA 4PCNA 3BGJA 3MUCA 5CPTA 4LS2A 5T26A 1W5QA 3BAJA 4D6FA 4NJKA 3BC9A 1H61A 3ELFA 1REQB 4W7WA 3I7QA 4Q4QA 1RY0A 1FOBA 2BXZA 1CLKA 3NA8A 1RA0A 1SQ7A 1QTWA 1ZENA 3EKGA 4NNBA 3ZXWA 3QKZA 1SJBA 4NZ4A 4D6IA 4BS0A 1U00A 4WF7A 3T0CA 4CLMA 4YPJA 4FHAA 3DFTA 1YTKA 4PMZA 5FI8A 1Q2RA 2Y24A 4HKPA 2OBMA 2Z25A 4M29A 1ZY9A 1SO6A 3GHTA 2LLEA 2Q6ZA 4IJBA 1D7KA 2HTMA 2GUUA 4WLCA 4ZODA 1D3CA 1W1ZA 3H24A 4JTDA 1KCLA 1M7OA 5DXXA 3DDGA 4MZ8A 5K7JA 3S9ZA 1TE6A 1K6AA 2ISDA 4C1LA 3PZGA 4JYDA 6CGTA 1TPDA 4ADSA 3S8HA 4LOCA 5F4XA 2I9UA 1HX0A 5LHFA 3CAQA 3LLLA 2V5JA 3WH9A 1B30A 4I3GA 4LAKA 5TF0A 1YNPA 2EFKA 2XVGA 3OBEA 1JUEA 4DLMA 1E0WA 1PHWA 3PS7A 1JZ7A 4GZEA 1FKWA 1NQKA 1X04A 4PBGA 1OFDA 2PDGA 1XUZA 3EEZA 5A2BA 3GAKA 3IAPA 3PVFA 2PURA 4G2DA 3QGAC 5BXTA 1ZFJA 3OHXM 4GUGA 4I90A 1UG6A 2E8YA 1YX1A 4JKMA 1J96A 1KCXA 3D4ZA 3BDKA 2XIJA 2XIIA 1QK2A 1M41A 4JN4A 2DZUA 1MEHA 1Q4WA 1H0IA 1F07A 1B0IA 1QBAA 1XQKA 1UCWA 2E9MA 3WELA 4XZMX 1A53A 1YIXA 2XGZA 3F7JA 3CIWA 3KBNA 3W1NA 2VURA 4L1GA 1ZJAA 3KUMA 1XS2A 3KVMA 4H9YA 1PZ3A 2FQIA 4CNOA 4CEXC 4UQCA 1VF8A 2ZVIA 2QT3A 4UR8A 2WVVB 1B9BA 1A4MA 3I10A 3BLKA 4FNQA 3W28A 3GDTA 1JZ5A 1MDRA 1B3ZA 2QJMA 4OBRA 3R58A 3LPGA 2XVPA 1E0TA 5EY5A 1LL4A 1M03A 5IHSA 1TPC1 2JEQA 1S39A 4F2TA 4K8EA 4Y7EA 3S46A 4HMDA 1KBBA 2CLOA 5JUVA 4YHEA 2Y88A 3CUFA 3LM7A 3VD5A 3EXTA 2WWDA 1WKFA 2PCEA 2PWFA 3C0QA 1V5XA 4DRSA 1JJKA 3PZOA 3HB9A 1I2RA 3QHOA 3KDRA 1ITUA 4AY7A 4N4PA 1O5QA 1F61A 1OCNA 4FIQA 1E9VA 5I06A 2IW0A 1OK4A 4GOAA 3RM9A 4GRSA 3EJTA 2E5CA 1UD2A 1I45A 1R5EA 5A6AA 4GCAA 2VRQA 2HV5A 2ZX9A 3T40A 1UP0A 4IJRA 1WX0A 1N8IA 4AD0A 2ATSA 4FB7A 3FVMA 1PYFA 2DZPA 4WSJA 2PI6A 4ZZ9A 4FNPA 4R5KA 5I5RA 4ZQPA 2FFIA 3PPGA 1GNLA 5A8MA 3L0KA 3VAVA 2ZXQA 3CVRA 4HPXA 3CC1A 1W5MA 2PTXA 3LBCA 3S6DA 4AF0B 2XZ9A 2RAKA 3B9OA 4FF5A 1DJIA 5DFAA 1AQMA 3KW3A 1LDCA 3VA8A 4NP7A 3TNBA 1UKPA 4BQ3A 1OG6A 1TQXA 3L2MA 3IIOA 1OA1A 4L64A 3IIVA 4AC1X 3OYXA 2I1OA 4UNKA 1IR1A 1E9YB 1V6VA 4GQ0A 3ENLA 3UERA 4XD4A 1QU4A 3DI0A 1EZWA 4O11A 4HA0A 3TIMA 1D2KA 3SUSA 1UIOA 2FZBA 1T8XA 5AC6A 1XLIA 3CHFA 3UWQA 3LHWA 1LQ7A 4I7WA 3BH4A 4YTSA 5CSYA 2WZMA 1UR9A 2R82A 4WCJA 4ACYA 3TQKA 2PC8A 1HP4A 4MADA 3UGRA 3OTRA 3GS6A 1DIEA 5LGXA 3KOXA 1RQEA 3W53A 1PIIA 4WGHA 4AZ7A 1X7FA 1R2SA 3QBUA 1SFSA 2QR6A 4K39A 2EFLA 1CLVA 1EH9A 2ALRA 1GKPA 1TQTA 1HTIA 3HV9A 3RPTA 4F2BA 4C91A 4DPPA 1L6SA 1TPWA 1O60A 5DCEA 2D2HA 4RZ4A 4QROA 1ZCCA 3G1VA 1W3HA 3GW3A 5B7YA 1JFXA 5CAKA 3D50A 3VZZA 3EJPA 4ATDA 1S3TC 1DIOA 2KZHA 1KRMA 3WD2A 1XUUA 4NQIA 2RDUA 1JCYA 4ZBCA 2I7GA 3S0CA 2CZDA 1EUAA 4FNUA 3W9ZA 1V0KA 3C61A 1BVNP 5FJRA 3T46A 1Q63A 4W85A 3I7SA 1HXJA 1G94A 1YNYA 2GJXA 3WQ8A 2ALWA 3IUHA 3BOLA 4PMVA 3MUAA 4MLJA 3SECA 2Z6IA 3EJUA 1QFEA 4AF0A 3M6YA 1VRXA 4QISA 5CPOA 2AMGA 2GVEA 4AYGA 2YZRA 4D6CA 5FJPA 1WBHA 4OGZA 1RBLA 4NRSA 3I68A 4H9MA 2PCQA 4OT7A 4QXIA 3SN4A 1AJZA 2Z2BA 5HDRA 3QVQA 1Y8BA 4D6JA 1HP5A 4AYSA 3HG5A 1OD0A 4UCGA 2KX9A 1C7TA 4Q8OA 2FMNA 1S38A 1SU5A 1AQFA 4GH3A 1ZP3A 2PDUA 4JHZA 5C2XA 2GQ3A 3HPZA 1ONEA 1DWHM 3AYRA 3ZT7A 5DX7A 4BI6A 3WD3A 1J9YA 3L4XA 1E73M 1NF7A 1GKRA 1TTPA 3SSJA 1OFBA 4GA8A 2OWWA 4US6A 3SI9A 4HU0A 3GDMA 4GJJA 1KXHA 4A3RA 4KCWA 3VK5A 1KXVA 3EDEA 3BLDA 5D03A 3B8UA 4OUIA 3RPMA 3R11A 2VT0A 3EXSA 4EPDC 1DJWA 4AD5A 3AIEA 2VFFA 3WK1A 4NSWA 4QQ3A 2C0HA 5FEPA 3UXKA 4NZ5A 1KGWA 1W1YA 4PMXA 4XK2A 2ZX5A 4LBSA 1MDLA 4TMCA 3P6LA 3OWGA 1KR0A 4LUSA 1UR3M 3IK2A 4BK9A 3ZR4A 3WLMA 4TOQA 1XLMA 3CHEA 3RU6A 4H9VA 3VFCA 3OK8A 2PWHA 3STPA 1VJSA 5FESA 5D9NA 4LVAA 3W02A 3ZT6A 3AUJA 1FKXA 1O7AA 1CGVA 1ZU8A 1XDJA 2PDXA 2XM2A 1ZBWA 1VQTA 3WH8A 2HS6A 2YA0A 4XKYB 1BVZA 3LGDA 5FF4A 2XIQA 1U5JA 2J7CA 3LXBA 3UP8A 3OQ8A 3EX3A 1MQRA 3VIIA 3CL6A 4J3ZA 3QHMA 2OW6A 2AGKA 1GOQA 1A5LC 4I5XA 3R0KA 3O63A 2YDSA 2WCSA 2GJPA 3S6TA 4TQTA 4R5LA 4V15A 3W2NA 2YYTA 3DDFA 2FDMA 3KDOA 2UV8G 3S1GA 1E56A 3VZYA 1GORA 4ZO8A 3B8DA 5LNRA 3W85A 4WKFA 3QV6A 2YW3A 2RUSA 1UWUA 4KIRA 1UP3A 1S2VA 2FH6A 3WQFA 3S4TA 3NQMA 1JCTA 2FVLA 4LRSA 1FXPA 1V3KA 5A95A 1KM1A 2Z0NA 2WLZA 1EP2A 2OEKA 4ZFMA 3MPGA 2C6QA 2GQAA 4I5RA 4G6QA 4O17A 1E9IA 2ZFAA 1OCJA 4IH3A 3S5OA 1V3MA 5A94A 2RH9A 2CXEA 2GLKA 1KV8A 4DWDA 2WPBA 3TC6A 4LW7A 2BVTA 3II1A 3UPBA 2MI7A 3P74A 5CC6A 3WF4A 4WKAA 2WVVA 3P93A 1EJUC 4KH2A 2GGJA 2WYHA 3AXIA 4GQBA 4WJXA 2BODX 1M5WA 3LCHA 4NXKA 4J1OA 2FHBA 3B03A 3M5XA 4HT3A 2A7NA 3WFLA 3NM1A 2CLHA 2ISWA 3VE9A 2QPSA 2Z00A 1HUVA 3RF9A 4DZ5A 3VC5A 5H1WA 3BUQA 2HNHA 8A3HA 1ZAHA 1DJNA 1Q8JA 1T7LA 3GR8A 2D0FA 4L7ZA 2UY3A 3ISIX 5LNVA 2QJHA 4U33A 3LV5A 4QDPA 1JUBA 2PUZA 2UY2A 3GXFA 4Z0SA 3CEUA 3PC0A 3T0TA 1FWGC 2QGYA 3WDQA 4FM3A 3IJQA 1K9FA 4M24A 2EJAA 3BSHA 4PFHA 1OBAA 2OVLA 1IT8A 3VOJA 5EU9A 1KXQA 2GJXB 1KC7A 3UY7A 5KBPA 3VOCA 1S5TA 3NDOA 2DZAA 4MAZA 3AZSA 3LCFA 3W6YA 2X1SA 3VD7A 2DZVA 3PZ9A 1M7XA 3TEVA 2WM0A 3ANYA 1CGYA 1WOAA 3WLTA 3VMPA 2CU0A 1U83A 3BLEA 3JU2A 3CEPA 3O9NA 2C16A 4O18A 2JKEA 1LYXA 2E1DA 2GDUA 5JBDA 3N17A 5EYWA 2DV0A 2MNRA 3LRKA 5C70A 3E2SA 3CKDA 2QKWA 5EMLA 1WXJA 4MY9A 2ACUA 3XINA 1B3YA 1TA3A 4PSPA 1FCQA 1E72M 1A5CA 4WDXA 4PGLA 5IHRA 1FP9A 4IPIA 3GD6A 3EWUA 4AZCA 1FA2A 4WSHA 4FOJA 2WNNA 3WQVA 1FWIC 1QWGA 5HINA 1VFOA 4MM1A 2V8ZA 2OWCA 1P48A 4Q8TA 2H90A 3A5FA 2YL9A 2QAPA 1G01A 1RK6A 1JZ3A 4FS9A 1DWJM 1Q66A 4F66A 2D2JA 4UCFA 3GFXA 3LBOA 3UITA 4LYRA 4GIEA 5H2ZA 1Q7QA 4W9TA 3I4EA 1EF3A 2OQHA 5HQLA 3GNPA 2WSPA 4PR4A 1SO5A 5HNRA 1OYCA 4BF9A 2JIWA 2HNEA 5JBFA 1JYNA 1GEHA 3BLOA 3NQ8A 2QV4A 1VFHA 5TQLA 1T0OA 2BVDA 3W37A 4J5NA 3EMQA 1ITCA 3IJDA 4GZ7A 1DJYA 1NDZA 2RJHA 4LUYA 3OA3A 4K8GA 2PA6A 3R8GA 3A4AA 4DUVA 3NZRA 3GU1A 2VELA 4YN5A 3EB3A 4ZSUA 2ZKMX 3MW7A 1R87A 2BGSA 5F2GA 2PWUA 3W7IA 3QC3A 4Y6GA 1QPQA 3EOOA 3ES8A 4E4UA 5MHBA 5I3HA 4XSLA 1O5KA 8TIMA 4JN6A 4B3LA 1IEIA 2ASHA 3SQMA 3EDKA 1OF8A 1E0VA 3PNUA 4GMEA 4QHRA 1UWSA 4J3XA 1FX6A 4Y96A 1PUDA 3ARQA 2CLPA 7PTDA 3NOEA 1E6XM 2J24A 4AD2A 5LYRA 3NPUA 4TTUA 1NOWA 4D72A 1C29A 1EIBA 1US3A 1XLGA 2OEJA 2QGHA 4IUGA 1D3GA 1TB3A 4LV9A 1TPB1 5AECA 5DXYA 1XP3A 3SY8A 1UZHA 3SCWA 3H7UA 4INFA 4K1WA 5LA1A 2Q71A 4XAYA 1QNSA 2WHLA 5HWJA 1UW9A 3BARA 1CLXA 1AL8A 1UD8A 4JKKA 4IIFA 3M5ZA 5CPMA 4CNNA 4ALDA 4KPLA 2GGEA 5CG7A 2HCVA 4DO6A 4EAYA 4NJHA 1EC8A 4DBWA 3TDFA 1FWRA 3G18A 1J6PA 3QZAA 1FTXA 1V03A 3N14A 4UTHA 2X1RA 1Q65A 4F0MA 3GUGA 1PKMA 3AMLA 4RUBA 1B1YA 1JUKA 3THDA 1GW9A 5D04C 4WSKA 1XIEA 4H6QA 3KWSA 4KF1A 2JEPA 4A2SA 3P62A 2VFHA 3VD4A 4PCPA 1OYBA 3QA8A 4DVOA 3CTTA 1GVQA 4JWEA 2P0IA 3NQ6A 3W00A 5DLCA 2L5HA 3NG3A 1X98A 1XM3A 3ARYA 4DZAA 4XWUA 4O0ZA 3ZWTA 2QZRA 1P0DA 3RJYA 3D52A 3FOKA 4NZ3A 3UXAA 2VFIA 2Z7KA 4BFAA 1TYGA 3K4AA 1Z48A 4KCUA 4XAGA 2XN2A 4PE8A 1YKWA 1MVYA 1F6PA 3MBFA 2ZX7A 3VGHA 3LMZA 3AIVA 3GZ3A 2C79A 3P2VA 3FAWA 1R85A 4O28A 4UMAA 3W2MA 4S3GA 2VCAA 3W1LA 3BQ6A 1Q3NA 4AEFA 4GVIA 3ARPA 1F3XA 5AHEA 1CWYA 2HEJA 4RNFA 1MEWA 1EDGA 1KQYA 4RL3A 4Q7IA 1HZYA 3MU7A 3AROA 3OLEA 2E5BA 1E15A 4FZOA 3BJTA 2RT6A 1E2UA 1TTQA 2E6YA 3QMRA 1TRIA 3MUZ1 1CXLA 4LVGA 3G22A 3GXDA 4NZ1A 2YGYA 4O0KA 1RALA 1X39A 1J6OA 1Y65A 3IUIA 2OKTA 4IGHA 3QV8A 5A6TC 1JCXA 4HR1B 3EOEA 1XLLA 3T0DA 4WY0F 3FXGA 2WSKA 4C6CA 2CITA 2BMBA 3NWRA 3HG2A 2WBGA 4RE2A 1EGVA 1J12A 1OYAA 3URAA 1VC4A 2F6KA 4C6EA 2QDHA 4OOZA 5A6MA 3TE9A 1E0XA 5DO8A 2E68A 4IIEA 9CGTA 2YFOA 4ERGA 1Z8AA 4HN4A 3WIJA 3SGUA 5IRPA 2WJEA 4MJMA 1J0IA 1JGIA 3LZ3A 2YSWA 4JFSA 1OGSA 4GQGA 2F9RA 5HUOA 1R34A 4HBKA 1SW7A 2OLHA 5BRBA 1XH2A 3A21A 3DYTA 2DSKA 2Q09A 4H8UA 3P7YA 2PRHA 3PAOA 4JTEA 4MVAA 1YADA 3SUVA 3IPWA 3MO7A 3M7SA 4BEQA 3DG3A 1RBAA 3WLSA 4JNZA 2GGHA 4RXFA 4HOZA 4DELA 3LN3A 5EFDA 5A8GA 4L9ZA 2JE8A 1FRBA 1VFTA 4JTQA 5H8PA 4J3WA 3GWQA 3BQ5A 4M3PA 3RILA 3MI6A 3N9RA 2WVTA 4W5ZA 3FHAA 4TVCA 3CZ8A 3N18A 3WJWA 3LG3A 1VFFA 1RD5A 3FS2A 2ZUSA 2YDQA 2EXOA 1JFHA 2ZE3A 1SU6A 5ECVA 3HN3A 1KM4A 4AY8A 2FICA 3M07A 5F4SA 1H7PA 4S38A 5AC7A 5C5BA 4HNTA 4TVUA 4D8JA 3HBLA 1GQJA 3T7VA 1HWWA 2A6NA 2J8GA 1GVIA 4DY1A 2D73A 1YDYA 3VD3A 3N2TA 4GNJA 4PUEA 3OZOA 1RVGA 5KZEA 1FP8A 2PP0A 2OKOA 2PWVA 4GVFA 1KBIA 2IPGA 4XZ9A 2DT3A 3BXWA 5D8WA 1VPYA 4PUUA 1ZB5A 2VZTA 5CZSA 2H9AB 2FTYA 4JNEA 4R33A 2D0HA 5I2UA 2D22A 2EG6A 2VX7A 2FKPA 2G50A 4S3AA 2WYIA 1JI1A 3OLIA 2I16A 4QG6A 1HL2A 4OBSA 4O4WA 2OZTA 4E2DA 2EKCA 1MJGA 3AAMA 3S2JA 1J0YA 5AN7A 1P0EA 5KITA 3UCCA 3KL3A 3GLCA 1I2QA 3IVUA 3DX5A 4FF7A 4GIAA 4HYVA 2WHJA 3QHNA 1OADA 2R14A 3C56A 1W6TA 3VDGA 1KTBA 1PX8A 1LL6A 2ZVRA 3CGTA 4L1WA 4I9TA 4NJIA 1AD1A 2XVLA 4XTDA 4Y9OA 5H6HA 2PTWA 1NOUA 1KFBA 1H1NA 2ZRYA 3QNIA 2CLEA 4NYYA 3TP4A 4L4LA 1AL7A 4KGJA 4LC8A 1ODUA 5T9BG 4P7QA 4IFKA 5BWAA 4C6KA 1OA0A 5I3GA 4FP1A 2CLIA 2OO6A 4AKVA 1RCXB 5D8ZA 5AYXA 3W29A 2JALA 2OSWA 4PL1A 1I1XA 1GGOA 2OBLA 4A6GA 4CD4A 3B9DA 1PTGA 3CZEA 2JGYA 3PJXA 3IJ8A 1DXIA 3VNMA 2ISFA 4NU7A 2WMGA 4AWSA 5DBTA 3D51A 3UZJA 5U4NA 2RDXA 3CUZA 3IRSA 3LNPA 2EPKX 2YCIX 3CAZA 3KRZA 1VPXA 1LG1A 1ZJBA 4HPGA 4JR5A 4D8AA 1ITQA 4PRRA 3IGUA 3R6IA 4IX2A 3LS9A 2WZEA 3VD9A 2QW5A 4EPEC 2CBJA 3FGCB 1ZWWA 2P3EA 1KNWA 1L8PA 2ADAA 4BF5A 3DGRA 1TELA 3VDAA 4B92A 3KRBA 3VOIA 4LSBA 3GHSA 2JIEA 3RO8A 2DIEA 4YTRA 4UTTC 2C19A 4OJYA 3DFPA 2VI0A 3N2OA 3CZNA 2E1WA 1CPUA 3SRHA 1DWGM 1Q6DA 4JIQA 2CKRA 3ZVHA 1EBGA 2VXNA 3IGSA 2HRWA 4Q4KA 2ABBA 4BQ4A 1H1YA 2ZC1A 3W7QA 3CXOA 1X6LA 1QHZA 1UHVA 5AYBA 4LAOA 3RN6A 3AXHA 2EJ1A 3CU2A 2X0HA 5BU6A 4F0LA 1XC6A 2OW7A 6PTDA 3LU2A 1ZUAX 3TV8A 1XI3A 3CT2A 4M0MA 4JIHA 4IM0A 2Z0OA 1PPIA 3TH6A 3HURA 1PIFA 4XAPA 1Y7VA 3SRDA 1UROA 3TROA 4U3CA 1W1IE 4AU0A 1TQUA 3PJUA 3EMZA 4GJIA 2Y1HA 4ZGYA 2WLYA 4TX8A 2QVHA 4B2DA 4AAJA 1EJRC 5BRPA 3PF3A 2QYGA 4IW0A 5J8LA 5JH2A 5FJJA 1C8VA 5LIKX 3OG3A 2A7RA 2FVMA 3IK4A 4QDWA 4A3UA 1XIMA 1YW1A 1TA3B 4O50A 5HUPA 2EWFA 4R7JA 4DO7A 3RX3A 1BQGA 4XG1A 3AYTA 5BRQA 3KOYA 3W7CA 2ZZ1A 4IM2A 1ICPA 3BPWA 3M5VA 1JPKA 4QFUA 3OVPA 4US5D 3VIFA 3VFLA 2WC7A 3IGXA 1P0KA 1B3XA 2X1UA 4DUWA 4CNPA 3CAVA 1OK6A 3FN9A 2OYMA 1K02A 1F74A 4NYUA 5C5BB 4HHMA 3SCRA 1VFUA 1GQNA 5F2MA 3SIZA 2C1GA 4KESA 1P6BA 4QM1A 1QAPA 2AGTA 1ME8A 2PDIA 1PZ2A 1UKSA 4XZNX 1T96A 1E43A 4B15A 1UKQA 3UG4A 3U3HA 2WO5A 5EGRA 1P7TB 3V5OA 1TSIA 9XIAA 2NQ9A 4JWDA 1MZRA 5E9XA 1FDJA 1ENUA 4O52A 2XYLA 4PULA 3LCWA 3RHGA 3EWWA 1E6NA 4GACA 1QX1A 2OXNA 1TPUA 2B7QA 1O4UA 2P50A 1BXBA 4LUJA 2YIHA 1QRQA 1IEWA 3U0HA 3B0XA 3NQ7A 3H2NA 3SUUA 5LIYX 2WNWA 1EYEA 4IWQA 4ERAA 1TMLA 2J62A 1ODZA 1K4HA 4ZFCA 3DH7A 4M6QA 4WXZA 1MEIA 4ZXOA 3FK4A 5HK4A 1YXCA 2D23A 2XSBA 3OQEA 3OB8A 3POHA 3WNOA 2LXYA 2ZX8A 1G67A 5D02A 1J0HA 2FJKA 1F3TA 1RA5A 2FJUB 1GPFA 3BW4A 4HZ6A 5MF5A 5FL1A 3HF3A 4CVUA 4QSHA 3C3UA 3TYEA 2VENA 1Y5XA 2X5CA 5HNUA 3E0WA 4LWWA 2YIAA 2ZZ6A 4UZUA 1EXPA 4MKNA 5TAOA 3UCDA 4RNIA 2HXTA 2NX9A 4ZO9A 1SFLA 3H55A 4MWAB 3NEVA 3TJXA 3H2FA 1UJQA 2A6LA 3GH4A 3L4TA 3ACOA 2QCFA 1OY0A 3M16A 4CUCA 1EA0A 3U2EA 3WH6A 4EXAA 1A5NC 1PTAA 2VM8A 3B4UA 4AIOA 2YL6A 1XICA 4GBUA 4PZVA 1E9LA 2V5BA 1AZ2A 2GVLA 3KVJA 3UJ2A 4Y9NA 2PLMA 3LTYA 4YYCA 3WQ6A 3HGRA 2JFEX 5HA7A 4GNVA 3ATZA 4BI7A 2BFGA 2VD8A</