4AZBA

Differential inhibition of the tandem gh20 catalytic modules in the pneumococcal exo-beta-d-n-acetylglucosaminidase, strh
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
425
structure length
408
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGGGNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDAIRSLDSNLSRAQQDTIDQAIAKLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the Family 20 Glycoside Hydrolase Catalytic Modules in the Streptococcus Pneumoniae Exo-Beta-D-N-Acetylglucosaminidase, Strh.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
total genus 154
structure length 408
sequence length 425
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 4azbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4azbA01
1W1PA 4IPLA 2J7CA 1D3CA 1CBGA 3F5JA 3SCNA 1WDRA 2WC7A 4W88A 1CLVA 1C90A 3WENA 2WCGA 4FZOA 3L4XA 3WSUA 3S2CA 1DEDA 1HIZA 2A3AA 5I3DA 3NJ3A 3N17A 9CGTA 1GQLA 3ZSSA 4MB4A 4CVUA 1KQYA 1ISWA 4KGJA 3DHPA 3AIEA 3ZR6A 4F9JA 3POCA 2DSWA 1X6NA 4MDOA 2ZUSA 4MADA 1E4LA 1UA3A 4JKMA 1FA2A 4UR9A 3W82A 1V6VA 3RMEA 1W2VA 3WF4A 1SR0A 4MB5A 4LQ1A 4ZXOA 4FF5A 3AOFA 1C8YA 1WZAA 1CGUA 1PPIA 1W3JA 2BHYA 3CHEA 4QAWA 2OO2A 4GPNA 1R87A 1KCLA 2E4TA 1UG6A 5EB8A 3AMKA 2D3LA 2Q8XA 3VTRA 4F66A 3B9DA 4RE2A 3GTNA 1UR9A 1UWUA 2WXDM 1NP0A 4UOZA 4FLQA 4JCLA 4S3JA 3RIKA 1HJSA 4J3TA 5JBDA 1QNOA 4HZ7A 3N13A 2WKLA 3K8KA 1EO5A 3ZJKA 1WP6A 3UG5A 5IHRA 1OCQA 5I23A 3GM8A 3OGVA 3W6MA 3PTMA 1QW8A 3OG2A 3W38A 1I1WA 2HVMA 1Q6CA 3L4VA 2DQXA 3OBAA 1PX4A 5HDRA 1OD8A 2DT2A 3UCQA 5HNNA 5M3WA 4JKKA 2XGIA 2FGZA 2VZOA 2J75A 3AHXA 4MDPA 1BHGA 2WWCA 3TTYA 3AQUA 1GORA 4QLLA 4XV0A 2XFFA 3PN8A 4PN2A 1I75A 1OWQA 1US2A 4OBRA 4P7QA 1CZ1A 2CHOA 2VQTA 1VFMA 2B31A 3GXMA 2XIIA 2ZUTA 4MNMA 1AQMA 4X9YA 2EPMX 3F5LA 1DP0A 4KH2A 4W93A 5A95A 2UWFA 1LWHA 3DHUA 3AIUA 4FZPA 4C7GA 1WB0A 3QOMA 3BAIA 3AI0A 1ECEA 1W9UA 3WELA 4J3VA 3NCOA 3WNOA 4Q22A 3A4WA 3PZVA 3T2OA 3VGDA 1OGSA 1UOKA 2G3NA 3SUVA 3BH4A 4WKHA 2YIHA 1CGXA 4TX6A 2WNWA 2PWDA 1K6AA 2E0PA 3AIQA 1XC6A 4HU8A 4LX4A 3VIIA 1FHDA 4AMCA 3OZOA 2BXYA 2G3IA 1SMAA 3KL5A 1JZ3A 1BVZA 1UZ4A 1BG9A 4RL3A 1W9DM 1OBAA 3O2LA 2VTFA 1W1VA 4JHZA 1E4NA 2YA1A 2WZIA 1MWOA 3VX1A 2VNCA 5BWFA 4AD3A 1NWRA 4V2XA 4OUEA 4ATWA 1QI0A 4U5KA 1HF6A 1TFVA 1UWRA 4CN1A 3L2LA 1OD0A 2J7DA 4PMYA 2D23A 2J47A 3AXIA 4GO8A 2GJRA 1QPKA 1WNOA 2PWHA 1CPUA 1J01A 2CXGA 1OIFA 4D72A 2VX6A 4NF7A 1QNQA 4WKFA 6CGTA 5TD4A 1VBRA 1W9BM 4CCEA 5EFDA 4NRRA 1GOWA 1E0XA 2X8RA 1XGZA 1CGTA 3WKZA 5C71A 2BVTA 2WVVA 1MW2A 1V0NA 2ZWYA 2CBIA 3ALFA 3LPGA 2E9BA 5A2AA 1QI2A 1B3XA 3SCRA 1KCKA 3OGSA 5D8ZA 4TTUA 5A8PA 1XCWA 4PTMA 4URIA 2BVYA 1XYZA 2XVKA 2J78A 1QHZA 1VFFA 3MUZ1 3WMBA 2PWEA 2DSZA 4YPJA 3VIPA 2JNKA 4LPCA 5CXPA 4CU6A 2WLYA 3VD7A 2WHLA 2V38A 5LA2A 3WY1A 1E6SM 2FDMA 1UH3A 3WNPA 1KXQA 2VURA 3GNPA 1GHSA 4UOQA 2D22A 1BGAA 2QMKA 2A3HA 2EJ1A 3CHCA 3VD5A 3BMWA 1ZJBA 3WQ8A 1GOIA 4J3WA 4H41A 1V0MA 3WF2A 4JFTA 4E4PA 2GK1B 1GOKA 2OZNB 3LMYA 3UERA 1CXLA 4CD7A 3OB8A 4C7DA 1WCGA 4FLOA 1JI1A 4D6GA 3BLKA 3ZO9A 1G5AA 5BXSA 2QPUA 2FHFA 4AW7A 1TVPA 4JFUA 1UR8A 2YOCA 5AY7A 5A6BD 2ZX5A 2ZXAA 5C70A 2CPUA 2QLYA 3VUPA 2QV4A 3IAQA 3WDRA 1J18A 1WE5A 3VIKA 2VR5A 1HJWA 1KXTA 2D1ZA 2CYGA 3OLGA 1Y7VA 3AHZA 4KGLA 4P8UA 3WNMA 5D4YA 2OSYA 1PX3A 5A6MA 2VQUA 1B3VA 2PI6A 4ZENA 2A3EA 2WMJA 1UH4A 5HBFA 1WDSA 1U30A 3OLEA 4PUEA 4NI3A 1M03A 4UCFA 1OM0A 1JL8A 4J28A 1MFVA 2J7BA 2O92A 2JFEX 3K4DA 1ZBKA 4M24A 3GH7A 4UQDA 5CLTA 3PTKA 3ZIZA 3SCSA 4WIWA 4OJYA 5CJ5A 1H0GA 3FW6A 2WZEA 1TZ7A 5EMYA 1K9EA 1QVBA 1E3XA 4AZHA 4ML4A 3N18A 1GUVA 3QR3A 1ODUA 1JFXA 3WF3A 1KFWA 3SCPA 4LYQA 5DO8A 2VZSA 4BQ4A 1RH9A 3RJXA 3M6DA 3U57A 3ALGA 1CWYA 2CKRA 2XIBA 2VX5A 2CIPA 1HX0A 3VDCA 1JZ2A 4TXEA 1I1XA 1E55A 3N12A 4HPGA 2CERA 3TA9A 2ZXQA 4W5UA 3NSNA 4W8LA 1VEMA 5LYRA 4MPKA 3VKKA 3VDHA 4X0VA 4P8XA 1KXHA 1XSJA 3M7SA 2J25A 2VVSA 1H41A 1G01A 5I79A 2WYSA 4E8DA 4DWSC 4PTWA 3CZLA 3II1A 5I2UA 4PMRA 1J0HA 4KMQA 2ZX8A 1W1YA 4GQRA 1JYWA 2YLLA 1SMDA 2O9TA 1V0KA 1V3LA 1B3YA 1BYCA 2WMKA 3FHAA 3BCFA 3GXDA 1BSIA 3AIVA 4N42A 4L4PA 3TONA 2F61A 2YL5A 2DIEA 4UNIA 1RP9A 2O9OA 1BYDA 1N82A 2BHUA 2BFGA 5ABHA 2YLAA 2VJXA 1J10A 3VU2A 2IXUA 1W3LA 2OYKA 1JGIA 4CU7A 4DWSA 1AQ0A 3ZMRA 1FFRA 1DWHM 3ARYA 5BRPA 1WO2A 3BAWA 2VOTA 2GSJA 4W8BA 1V03A 1R86A 1QOXA 5DT7A 4ZE5A 5LA0A 4HA3A 1W2PA 4M80A 4W5ZA 5GQBA 2NW0A 4W85A 4PMVA 1LWJA 2OLHA 1AMYA 1A47A 3CBWA 3WQVA 5BXRA 2GK1A 4LXFA 1GOMA 4C7FA 4W84A 3WH8A 1XCXA 4J7RA 4DUWA 2EPNA 4GI8A 4AIUA 1H1NA 1CENA 1VENA 1LLOA 4L4OA 4NRSA 2DT0A 1V6XA 1QI4A 1XD1A 3L4YA 1E1EA 2GDUA 4AIOA 2WK2A 2F2HA 4P7LA 1KGUA 3FAXA 4MJ2A 1BYBA 3N04A 2E9LA 3VMNA 3MMWA 2WPGA 1E6PA 5JIPA 2ZUWA 2JALA 3THDA 1CGWA 3K1DA 5A6LA 3CUIA 1DWIM 1GOOA 4CN6A 4GINA 1UD8A 3GYCA 1KB3A 4KRUA 4E2OA 5BXPA 1V0LA 5JIWA 5ECUA 1VJSA 1GHRA 5LA1A 4E8CA 4AYSA 3VIFA 2CESA 4GIAA 5I0DA 4AZCA 1GJUA 3SUSA 1OB0A 4GI6A 4MB3A 1G9HA 1F4AA 5E6ZA 1V3IA 4M8UA 2G4FA 3IAPA 3QHMA 1VIWA 1E6XM 1WKYA 2Y8KA 3CUFA 4ACZA 1R8LA 4AC1X 1PBGA 3PZUA 1GOQA 3GDBA 4PMDA 4B9YA 2WHKA 4Z2KA 1X6LA 2W66A 4GZEA 4BZYA 4CD6A 1FFQA 3K4AA 3MMDA 1ZS2A 4S3KA 1ZL1A 1VF8A 2VR4A 2OWXA 3ZR5A 3W37A 3VPLA 2WBKA 4JL1A 1VEPA 3PZTA 1EOMA 1E0WA 3THCA 4Z2HA 3AZTA 4ZFMA 1EA9C 1W3KA 4QCFA 1KR0A 3WEMA 2WMIA 1LQ0A 4R5EA 2YJQA 2YDQA 4WLCA 2XPKA 1KBBA 1LL4A 3WH5A 1J9YA 1J0YA 3OGRA 2XVLA 2ZUNA 1EQCA 2VUYA 3VIGA 3VNYA 1RD6A 3CHDA 3O9NA 3UR8A 3ZT7A 1GW1A 2RGMA 2ZX6A 1BQCA 1CTNA 4XX6A 1Q6DA 3AIRA 2VI0A 2ZUMA 2AMGA 1E70M 3RCNA 3B8SA 1VB9A 4UFIA 1NOWA 1W9PA 1OIMA 1HJQA 3MUY1 4NZCA 3CZ8A 1JZ6A 3DC0A 2WW5A 3ZJ7A 1TG7A 3WL1A 4GZIA 5FIPA 2XM1A 4GQQA 1A3HA 1NH6A 4WSJA 4YHEA 1V02E 4H7VA 4HOWA 1KR1A 3NIYA 4D1JA 4QFUA 3WH6A 3AS0A 2WSPA 3PTQA 3A6OA 3I3BA 5M17A 2J7GA 3EDKA 3UEQA 5AYBA 3QGVA 3AS1A 2VC9A 5I78A 1HVQA 4U33A 3T0DA 2VZVA 4D6IA 4FLRA 2VCBA 1US3A 2J62A 1E4IA 1VBUA 4OZOA 5DFAA 1BFNA 2JF7A 2Y2WA 2QPSA 4UFLA 1V08A 2YDSA 3LPFA 3AJ7A 5A2CA 1MXDA 5CGMA 2W63A 3IJ8A 4B3LA 1WPCA 2YL8A 3VM5A 1E72M 3N15A 4JCMA 3B9AA 2XYLA 3A4XA 3ARUA 2EBNA 2J79A 2FHBA 1Q6GA 1PAMA 4MTVA 2OWCA 4BQ5A 1UD2A 1TVNA 1TR1A 3WH7A 2A3BA 2WBGA 3CZKA 3RM4A 1CECA 4AZ7A 5D9MA 1CXFA 1FP8A 4ATDA 5KEZA 4CVWA 3VNZA 3APGA 1XYFA 3EDFA 4UOJA 5BRQA 1H2JA 4BA0A 5A3HA 4DUVA 8A3HA 4XB3A 3W24A 5GNZA 3WQ6A 2GJXA 2X2YA 5CGTA 4D6CA 3ARSA 2BS9A 1RP8A 4H2CA 4IUGA 2IUZA 4Z2LA 1OT2A 3WN6A 5D9OA 2DH2A 1QHOA 3BLPX 2PWFA 4MJ4A 3WDQA 3ARPA 2YDRA 4D1IA 5HOSA 4JFVA 2C8NA 5CQ1A 3RILA 2V3EA 2WM0A 5FL1A 1WAWA 3K46A 3D5HA 4LYRA 4JZ5A 4HU0A 1VAHA 4TX8A 1NOFA 5A8OA 4A4AA 4UQBA 2ZUVA 2WC3A 4JIEA 1JDAA 4WSKA 3AIBA 1D2KA 5CZKA 2DT1A 2XFYA 5A6JA 3K8LA 3MO4A 4JKLA 3IK2A 4M29A 3SCOA 2WMGA 3RJYA 2BNJA 2UY2A 3EMQA 4DWSB 4CKQA 2JIEA 2E3ZA 4H8VA 3WD1A 3CO4A 4AXNA 2XWEA 4JAWA 1ISXA 1MQQA 1V6YA 4M82A 3W81A 2F8QA 4TTGA 5ABEA 3W27A 1WZMA 3AZRA 1JNEA 1BF2A 2VT0A 3KEHA 1UD6A 2W4XA 3UETA 3BC9A 3ARZA 5IDIA 5A8MA 1JZ4A 6TAAA 1E0VA 3NUKA 3T0BA 2PB1A 4W7WA 2DEPA 4D6FA 1CYGA 2J74A 3VINA 1HKIA 4F79A 3MSDA 1MFUA 4AWEA 1J11A 3L4WA 2CITA 4QDMA 3A3HA 4IISA 1UQYA 2W61A 1UUQA 3FXYA 3WNKA 4V27A 4WK9A 1GCYA 4JFSA 1DWGM 3WDJA 1GNXA 1GQKA 5CPQA 3PZ9A 1UD5A 1E6QM 1J0ZA 3CHFA 4OOZA 3RM9A 1JXJA 4LYPA 1QNPA 3VX0A 1UWIA 5IHSA 4RE4A 3MV01 4J3XA 4U3AA 5JBFA 2VRJA 3VGGA 1DWAM 4UQ9A 3VIMA 3ARQA 5A6KA 1E56A 1L8NA 4M1RA 3MKKA 4MNJA 2ZOXA 1Q6EA 4Y7EA 4P8VA 2C7FA 2ZUUA 2X05A 3WD2A 2EO7A 1ESWA 4TOQA 1X1NA 1ISVA 1TMQA 1M53A 2VL4A 3PZMA 4AD4A 2XFRA 1OT1A 2BVDA 1JAKA 3AFBA 5FCZA 4BQ2A 4P7OA 3TTQA 4CCCA 5A94A 1EDQA 3AHVA 5BXTA 2V3FA 4PMNA 4MAZA 3OIHA 2UY5A 1E5NA 3MS8A 4AEFA 2Y4SA 3KZSA 1S46A 1DWJM 5E0CA 4MNLA 1H4PA 1BVNP 1M01A 1C93A 3U7VA 1XD0A 5E9AA 2WMIB 4AZBA 2EQDA 2W92A 3VIHA 3AMDA 1U33A 2J7EA 3AS3A 3WIJA 2JIWA 2V5DA 2O9RA 1WDQA 4PMUA 3WD3A 2ESCA 4AZCB 1EOKA 2GUYA 1UA7A 3IANA 1UH2A 4FLSA 2CBJA 1BAGA 2D20A 3VD9A 2WLZA 1W9VA 3W53A 4UFMA 1E9LA 2C0HA 5EBAA 4PSRA 5BROA 2BY3A 3PZNA 3ARRA 3SEPA 4WKAA 4UZSA 4HZ8A 1XH2A 1NOUA 3WQ5A 3MU7A 1ITXA 3PZIA 2TAAA 1LL7A 2A3CA 4PYSA 1XH0A 3GXIA 4B3KA 1MQPA 4UTFA 3WMCA 1R85A 2WB5A 4JFWA 2WHMA 1PIGA 2BV9A 3CZGA 5I6SA 1GVIA 2XSBA 4KWUA 4EANA 1E6NA 4DM2A 4J3UA 1SYTA 1EGZA 2V3GA 2YKKA 4HA4A 5A8NA 3WUGA 3HU7A 3TTSA 2XWDA 1R7OA 1UKOA 3TTOA 1HL8A 1UZ1A 1XV8A 3N11A 1JDDA 4AZGA 1ITCA 1UR4A 1W3HA 1KXVA 3OZPA 4XZWA 3UESA 4DUXA 1CGVA 1Z32X 2FGLA 5ABFB 1UR1A 1ZJAA 1QHPA 3RPMA 5I77A 1C3FA 1JAEA 4WJXA 2DSVA 1FP9A 2CCRA 2XUCA 2XJ7A 4YN5A 3G6MA 4B16A 1BGGA 3FN9A 3W26A 2J8GA 1KWKA 1JNDA 3N1AA 3UR7A 4DWSD 1O7AA 3SUTA 4HTYA 3CUHA 2VZTA 1UYQA 4OBSA 2X09A 2Z1KA 1K9FA 2Y5EA 5AC5A 1KQZA 4ATLA 3ARTA 3AHTA 5A1AA 3UG4A 1TUXA 1NP2A 3WUBA 2J77A 5GNYA 5E6YA 3UG3A 3EDDA 2DH3A 1ODZA 1FOBA 1B3WA 3WEOA 4BF7A 1QNSA 3LPPA 1HXJA 1LG1A 5ABGA 5AC4A 1B1YA 3ZOAA 1TA3B 3L2MA 3CH9A 4U3CA 1NWSA 4OOUA 3WNLA 4R27A 1AVAA 1R7AA 4CCDA 2JEQA 2IXVA 5DEZA 2XVPA 1GJWA 3RM8A 2EPKX 3BAXA 3DYOA 3HJEA 4M56A 3T2PA 1VEOA 5M5DA 1KWGA 1XSKA 4M81A 2PMRA 2WSKA 2AAAA 2WCSA 3AISA 5A6SA 3BCDA 3GZAA 3GH4A 3MMUA 1E4MM 1CXEA 3VIJA 5A69A 1K9TA 1VJZA 1GQIA 5GNXA 8CGTA 4U2ZA 3GBDA 1GONA 2CEQA 1WZLA 2D2OA 1EH9A 1HJUA 1J0JA 3MSGA 1DWFM 2YBTA 1E6ZA 2WKGA 4EKJA 1HKJA 3BGAA 3GNOA 3W6LA 3VVGA 5BCAA 2ZIDA 1QI5A 2YA2A 4HPHA 1G94A 1YQ2A 1JFHA 4AD1A 3BAYA 2J7FA 4P8WA 1E3ZA 2GFTA 4AY1A 5IFTA 2V3DA 1PEZA 2WVSA 1UKTA 4PCSA 1M04A 2VVNA 3QHNA 4H8UA 1D7FA 1WZKA 1EDTA 1HP5A 1JI2A 1E15A 4PTXA 3LPOA 2XG9A 2Y24A 3WNNA 1V3KA 3KWXA 3KL3A 3GNRA 4PRWA 3SCTA 3WF1A 1KGWA 5IFPA 3WUFA 1JF6A 1GQJA 2VCCA 3HMCA 3EDJA 2ZX7A 1WDPA 5CG0A 3BSGA 1MVYA 4W8AA 1CGYA 4J3SA 1MW3A 3F4VA 3ZQ9A 2XSAA 1HJXA 3SURA 3M46A 1H5VA 3DYMA 3CLWA 3GH5A 1UD4A 2D0GA 3VIOA 1G1YA 1TCMA 2GJXB 3WD0A 1B3ZA 2PWGA 5A8QA 1ISYA 3ARXA 3PBGA 3VGFA 4FMVA 1XHGA 1B31A 4UZUA 4MAVA 4XZBA 3CIVA 4EK7A 1UQZA 3VGEA 4AD5A 3I3EA 3WDIA 1GPFA 4Z2IA 2VRQA 3U5UA 1W32A 2VCAA 1CDGA 1YHTA 5FKYA 2G3MA 1GVYA 1HKKA 1GZJA 3BXWA 1HN1A 2BY2A 4XUYA 3G6LA 1PJ9A 4HP5A 4UQAA 1RPKA 5D8WA 4W87A 5D9NA 2DSKA 3BAJA 1LL6A 3ZJ6A 4AD0A 4WF7A 1AQHA 3U5YA 3CMGA 7TAAA 5C8BB 1UKQA 5M03A 4ZEPA 3CZJA 3AYRA 1EIBA 1V3MA 3BSHA 1ISZA 4X0NA 1ZB5A 5BYWA 2WHJA 5D9PA 3WQ4A 3GBEA 1QBAA 1MW0A 3NYDA 1E73M 2BHZA 2XGBA 4A3HA 2OWWA 1V02A 4F8XA 3VO0A 3AZSA 1JZ7A 1MYRA 4TVUA 3WUEA 3W0KA 1C92A 3WDPP 1BPLB 2O9PA 2AOSA 2Y8VA 2JE8A 4P7RA 3GXFA 2ZX9A 2WWDA 4EAMA 1BTCA 1HL9A 4PMZA 4UFHA 2XHYA 3PHAA 3VD3A 3N9KA 3AXXA 1JYXA 4N0RA 1BYAA 1CEOA 4IM4A 2VZUA 3AXHA 1V6UA 1OSEA 3WEZA 4D6JA 2WVUA 2WMHA 2OYMA 1XRVA 3AROA 4V28A 1B9ZA 2ZWZA 3CGTA 2VRKA 5E09A 3W28A 3VDBA 5E0FA 3EMCA 4TVDA 2FH6A 3ZM8A 1E71M 1TE1A 2DPEA 5CPSA 4AD2A 1H49A 4HA1A 2CKSA 4HMDA 1CXIA 3WL0A 7A3HA 4QLKA 3CZEA 1F4HA 1VRXA 2UY3A 3WBAA 4BS0A 2D0FA 3TOPA 1HT6A 2X0HA 3MANA 2E8YA 1LJYA 1DTUA 3VOCA 3WBEA 5CPTA 3EDEA 3MUIA 2WVTA 4Q7NA 5KZ6A 2NT1A 2JEPA 1JD9A 3AMGA 5HPCA 2PC8A 4TUFA 1JD7A 2WCAA 2E9MA 3WMSA 2RGLA 3BMVA 4B9ZA 5CLWA 2G41A 5HXMA 5JUVA 3W25A 2W5FA 1UKPA 3WQWA 1HKMA 3VGHA 3ZSTA 4OKDA 3BAKA 1NWUA 1JG9A 1B30A 2W91A 1EXPA 3AHYA 1ZBVA 1UWTA 1QI3A 4HMEA 2HISA 1V6WA 3AMLA 2D3NA 2WAGA 4U31A 1J0KA 2X0YA 4JHOA 2YL6A 4MNKA 1MQRA 3OLIA 2DT3A 3D3AA 4W89A 3RDKA 1E6RA 1MXGA 3SUUA 4AZ6A 4K68A 1V3HA 1ZBWA 5EFFA 4PSPA 1HVXA 2X1IA 2VO5A 1VFUA 1BG4A 3SIMA 1C8XA 2E40A 1C91A 3L4ZA 1O6IA 3E1F1 3JUGA 1LG2A 1UWQA 3EBVA 1TA3A 2EXOA 5GPRA 1CLXA 2Z1SA 4PMQA 1SFSA 2PBOA 3RO8A 1B0IA 3B9EA 3CMJA 2BY1A 1FH9A 2ZE0A 4AISA 3ARVA 4ZE4A 3ECQA 1MW1A 4A3YA 2OYLA 3EYPA 1EO7A 2D0HA 1KBKA 1C7SA 1XSIA 1EDGA 1UWSA 3I3DA 4RE3A 1OINA 1L0PA 3K8MA 5DF0A 2ZXBA 3VMOA 3U7BA 2YBUA 1Q4NX 2UY4A 3AMCA 2NT0A 4PUDA 2CBVA 1E43A 3T08A 3S6TA 1J12A 1HNYA 2XVNA 1PX8A 5CSYA 1B90A 4Z2JA 3O6AA 3PZQA 3HN3A 1CXKA 4BQ3A 3IJ7A 3SCWA 1G0CA 1CIUA 2DSUA 1E40A 2G3JA 2DGAA 5CSUA 1JIBA 1UR2A 3CPUA 4AZ5A 2WZHA 4CD8A 4PBGA 4D6HA 3W29A 1EHNA 1QNRA 3WH9A 1C7TA 4ACZB 1E1FA 5FL0A 3WD4A 1UKSA 1KGXA 1V3JA 2PBGA 2CHNA 3DYPA 3PZOA 2J8FA 4PEEA 3T09A 3SUWA 4B15A 4OIFA 3FNDA 3MV11 3OA5A 4HOZA 1OGBA 1ZBCA 2EPOA 4W7VA 3J7HA 5E70A 3CTTA 1QW9A 5FOOA 1PZ3A 3F5KA 5JBEA 4ZXLA 3NDYA 2OSWA 3QOKA 1NQ6A 1FH8A 2ZICA 3L4TA 4UFKA 1JXKA 7CGTA 1DHKA 2CBUA 1UD3A 3T0AA 2J4GA 3QHOA 2WMFA 1JYNA 2QF8A 3WFZA 4GZJA 4FK9A 1W91A 1B2YA 1K9DA 3POHA 1W9XA 3SCQA 4Z2GA 3NSXA 2J7HA 3AICA 2XVGA 1H09A 3DECA 4PMXA 4F9DA 4GO9A 4QLJA 1J0IA 2QHAA 2VMFA 2FHCA 4HMCA 4CU8A 1EQPA 4AEEA 3AYSA 2GVYA 3WF0A 3VMPA 4ACYA 2CETA 4GXPA 1FHLA 3VGBA 2WVVB 4U5IA 4NSBA 1PZ2A 5I24A 3KE0A 1H11A 1E5JA 4CD5A 4CUCA 1H0IA 3SCUA 4PMOA 1LF1A 2WANA 1JF5A 3A47A 3OLDA 1IT0A 4PCTA 4AIEA 4CN4A 5A6AA 4IPNB 4YHGA 4D6DA 4HOXA 1P6WA 2CNCA 4W7UA 2JF6A 1XH1A 2EPLX 1M7XA 1JZ5A 4CD4A 3W4RA 3TP4A 2GJPA 5AYIA 3ZT5A 1IZKA 2YL9A 3AS2A 3CUJA 5A6BA 2DIJA 2XM2A 2YA0A 4AZIA 1ZU8A 2ZXDA 3VD4A 4QCEA 2E8ZA 2FH8A 2W67A 4UQCA 1UHVA 2V5CA 2VX7A 4CGTA 1JDCA 2BXZA 3EMZA 1IZJA 4D71A 1NWTA 1UR0A 4DM1A 1EHAA 1QBBA 5DT5A 4JL2A 5F7UA 1H3GA 1OGGA 4U2YA 1CXHA 3ZT6A 3SCVA 4BCEA 3WDHA 1PIFA 4QP0A 4J27A 4W86A 2MANA 1HP4A 2QMJA 4PTVA 3M07A 1HJVA 3PZGA 6A3HA 2PF0A 4P7NA 4KRTA 3T2QA 3AIWA 4HZ6A 3ARWA 1BLIA 4EE9A 4LGXA 5FD0A 1W1TA 2EEXA 4H04A 3MUAA 4UFJA 3IJ9A 3KL0A 1VFOA 1C8QA 3NSMA 3FAWA 2W62A 3FY1A 2D24A 3VM7A 2WC4A 4MB1A 1Q6FA 1NM9A 2OSXA 1IV8A 4UQEA 4H8HA 1CNVA 4TVCA 3A4AA 5I5RA 2G8ZA 2BY0A 3CUGA 3VDAA 1JZ8A 5DMYA 3L4UA 4GI9A 5A2BA 4GKLA 3ZJ8A 5IXEA 2DDXA 1JYVA 3VILA 1U2YA 4D6EA 5HPOA 1FH7A 3NDZA 2VX4A 1NARA 2XTKA 3WFLA 2NSXA 3FHQA 2GDVA 5ABFA
chains in the Genus database with same CATH superfamily
1ZZMA 4IPLA 4KT2A 4B5UA 4W88A 5C9UA 1CLVA 1Z9AA 2BP1A 1FWNA 2YB1A 2GVLA 3KVMA 1GQLA 4C65A 1CX9A 2VC5A 1KQYA 4LSBA 1POJA 2ZE3A 3A3WA 1S39A 1FA2A 1OABA 3WF4A 1W2VA 4YXGA 4EPBC 4ZXOA 3BPWA 4R9OA 4AY8A 4EZOA 1CGUA 4YTQA 1PPIA 2BHYA 3CHEA 3L9CA 4QAWA 5CC6A 1VHCA 2E4TA 4PL2A 2Q8XA 1F3WA 3VTRA 4BK9A 2WPBA 1O7DC 3GTNA 4ZB2A 4Q8VA 3PNZA 4PFHA 1WDZA 2PRHA 4FLQA 4B91A 4W9TA 1HJSA 2JK2A 3I6TA 3S0CA 3LHTA 2RH9A 2VFIA 1TQJA 3KS5A 2IS7A 3W87A 2I17A 1WP6A 5CEWA 4LUSA 5GVJA 2QCDA 3OGVA 3QGKC 1I1WA 2BBFA 2QAPA 3L4VA 3DZ1A 4M7TA 1OD8A 5HNNA 4FB7A 4JKKA 1JCTA 2HE5A 2CZEA 1WA3A 2XGIA 2PDLA 4MDPA 3AXKA 3RPDA 4LJ3A 4E8GA 2WWCA 4NJJA 2IQTA 3TTYA 4QLLA 2XFFA 3PN8A 4H9TA 3VZYA 3L12A 1US2A 3F2DA 2ZA3A 3APYA 3EJRA 1XX1A 1F8IA 4DN1A 3T8QA 5HATA 2XIIA 1AQMA 1A0CA 1EJTC 2FVMA 3F5LA 4W93A 3LXBA 3VNDA 4JN4A 5HAOA 3DX5A 2GVJA 4C7GA 3F7WA 4EPDC 3BAIA 3AI0A 3C2EA 2PPGA 3GDMA 4J3VA 4XBJA 2QGHA 2P10A 1K8YA 5KMYA 2YIHA 4A3UA 4J2MA 2PWDA 4X9SA 4F2BA 2QDHA 2KZHA 3F4NA 1TRIA 1ADSA 1FHDA 3DX0A 2BXYA 2J6XA 2WKJA 1W8SA 1RLCL 1QPOA 5CC3A 4M0XA 4UTHA 1JQXA 1Y5WA 1BG9A 4N4QA 4L9XA 1BWVA 3VOFA 2NUWA 4ONVA 1W9DM 4GUHA 1OBAA 3VNJA 4EPEC 3QV6A 4PB4A 2VM8A 1EA0A 1E4NA 1SM9A 4H4IA 1ZALA 4AD3A 4QJ5B 1PWMA 4ATWA 1QI0A 3NQCA 4N6EA 4U5KA 1TFVA 2NX9A 1IIGA 2ZYFA 3I4KA 3ZWTA 1TTIA 2D23A 4QAIA 3AXIA 1GK8A 1QPKA 2PWHA 3W74A 2OX4A 3L0GA 1R3QA 3W23A 2VX6A 4NF7A 4KEVA 2GQ9A 6CGTA 1GVRA 4S39A 5XIAA 2QUUA 3NQDA 1IGSA 1FKXA 2XH0A 1CGTA 5C71A 2BVTA 3LB0A 3C0QA 1YADA 3BUQA 1RQHA 3LPGA 1XFCA 2J6VA 3CHVA 3CV6A 3CUZA 5A2AA 8XIAA 1KCKA 4PC8A 4UNLA 4DJEA 3OGSA 2W0UA 3EX2A 5A8PA 1FCBA 2B4GA 5CSSA 5AYYA 5KZDA 3CV2A 4GC3A 4JD4A 4DIAA 2HEJA 2BVYA 1XYZA 2J78A 4Q8PA 1VD6A 4R5GA 3WMBA 2PWEA 4AH7A 3T07A 4YPJA 1JPIA 1RBLA 2WLYA 3VD7A 2X42A 4DF1A 1P0KA 2WHLA 4GJ1A 3TMQA 4EX4A 4UDYX 5HINA 2VGFA 1A50A 3ONCA 2FDMA 4DLFA 4JDBA 4ZQOA 3PJTA 4FX8A 3QC0A 2EJ1A 1JCNA 3HAJA 1GOIA 4LVDA 1V0MA 4G7FA 4E4PA 3LMYA 3NQAA 3UERA 1CXLA 4CD7A 4D6GA 3BLKA 4IH3A 1FX6A 2F7OA 1RY8A 3VUPA 3BGJA 1H7XA 2V30A 1SW7A 1J18A 3NQBA 2ASHA 2XN1A 1SU7A 4AMAA 2D1ZA 4P8UA 5FJOA 2WQDA 5D4YA 1VHNA 3KRUA 2OSYA 4I9JA 3H2MA 2OOGA 2PI6A 5CJNA 2A3EA 1T99A 3C2YA 1JCYA 4G8TA 4R88A 5IOBA 1U30A 1TX2A 4C90A 1A5CA 2E68A 5G2IA 2Z1VA 4C6BA 2P5NA 2HCVA 2JFEX 3K4DA 4LBRA 1ZBKA 3TN4A 4HN4A 2ZRZA 3PUEA 3LMZA 3PTKA 4BEQA 4Y8FA 3ZIZA 4WIWA 3FW6A 2QCNA 1TZ7A 4YIWA 2VEFA 3VFLA 1ICPA 4H1ZA 1QVBA 3TC7A 1E3XA 4S2CA 4UTMA 2FFIA 1GUVA 2A5HA 3QR3A 1Q7MA 5K9XA 2P0IA 4I5XA 2BB0A 3OYZA 2VZSA 2YCLA 3W2MA 3M6DA 4L6DA 3KBSA 5HMSA 1OFPA 3ALGA 4PE8A 3KTSA 1HO4A 1HKVA 3EKZA 4KIEA 2CIPA 3VDCA 1JZ2A 4K2SA 1DJGA 1E55A 1XDMA 3H2EA 2ZXQA 5LYRA 4W8LA 4MPKA 4R5IA 1TV4A 4A3QA 3DX2A 4LUYA 3I68A 4P8XA 3M7SA 2J25A 3V35A 4H6HA 1R5YA 3I7RA 1F07A 4DEFA 5I79A 4E8DA 4DWSC 4PTWA 4PMRA 1LQ2A 1K70A 2C18A 1JYWA 3CV5A 3VUSA 1V3LA 1S2AA 1BYCA 2PDMA 3QKEA 1AW2A 1TREA 3AIVA 4JY8A 2YXOA 4RZBA 3TLLA 3T6CA 4NJHA 4Q4QA 1RP9A 4PR4A 4DO6A 1RSCA 1KLYA 2BHUA 4A35A 4O52A 3T4CA 1J10A 1W3LA 2YR1A 1AJ2A 2OEMA 3HFTA 2Z29A 3ZMRA 2EGZA 1DWHM 3CUXA 2VOTA 3H4XA 4M6QA 1TQSA 4O4VA 1OK4A 1W1B1 1R86A 5JU6A 3R8GA 4BHYA 5GQBA 2NW0A 1B9BA 4LAKA 2E77A 5DXYA 4MY8A 1LWJA 2OLHA 1AMYA 1XR2A 3WQVA 4X60A 5KSWA 5HJXA 4Y6GA 3URQA 2AL2A 4MUZA 1E1CB 1TV5A 4C7FA 3LHUA 2NQZA 1S38A 4FX7A 4J7RA 1OG6A 5AZ0A 3DFNA 1JPHA 3W1PA 1CENA 1VENA 4JWCA 4L4OA 1IEWA 1GEHA 3PPHA 3M0IA 4JTJA 1V6XA 2I5IA 1QI4A 1XD1A 3W00A 4KWSA 3TYUA 3UJFA 4IP5A 2F2HA 5CSRA 4YTUA 4J4KA 1IE7C 3UZYA 3N04A 3VMNA 4H6IA 1BXCA 3NEVA 1E6PA 3K1DA 5A5WA 2RT6A 1DWIM 1L9WA 1O95A 2F7PA 4E3TA 1L6GA 5I3KA 2ONEA 2UV8G 3VIFA 3SUSA 3WLNA 1FWCC 3O8AA 1GPWA 1P0DA 4MB3A 1I2QA 1G9HA 3DERA 2DQWA 1B5TA 2JKAA 1VIWA 4I7UA 2EX3B 1OY0A 2Y8KA 6REQB 1PBGA 3PZUA 2UZ9A 4B9YA 4Q8TA 4EACA 1X6LA 4GZEA 4CD6A 3DG7A 3K4AA 1ZS2A 3NXLA 3EJQA 2SFPA 1PXGA 5I07A 4EZYA 1PL9A 4D8JA 1EOMA 3THCA 4LWWA 4R5KA 1EA9C 3EEGA 4GX8A 3S5ZA 1XLIA 1KR0A 4DBWA 2NXIA 4KERA 4NUWA 1LQ0A 2C71A 4XAPA 1NF0A 1VGAA 3WX7A 2YDQA 1M7PA 2GL5A 2J9XA 1LL4A 3E5BA 3WH5A 1J0YA 3P6LA 3NZGA 3FA5A 2QCDB 1GVQA 3MYPA 1WXZA 3CHDA 3UR8A 3ZT7A 1MSSA 2ZX6A 1CTNA 1Q6RA 1Q6DA 4IQDA 3VXGA 2AMGA 4EZRA 3LEPA 3B8SA 1KM0A 4NILA 3K5XA 1OIMA 1YKWA 1OF8A 3L2IA 3H70A 4WVXA 3E0LA 4IX0A 2GPTA 3IS4A 4YCPA 3DC0A 1OG0A 2TRSA 5FIPA 4NJKA 2XM1A 1OFEA 1A3HA 1PUDA 6REQA 4F0SA 3W70A 3R10A 1KR1A 1MNSA 3KBMA 1VPQA 3WH6A 4B2DA 1G69A 3I3BA 5LIYX 3PTDA 5M17A 3AS1A 2B0MA 4U33A 4LW7A 3RG6A 4Q8UA 3T0DA 4WPEA 4GGHA 3EWYA 1BVWA 3OODA 3C56A 4S3EA 1E4IA 1BFNA 3H8AA 1RCOB 2ZQ0A 2Y2WA 2QPSA 2PS2A 2FICA 2YDSA 2Y70A 3T05A 1VYPX 4B3LA 4IIGA 5FA5A 2YL8A 1E72M 4H9YA 2XYLA 1E0UA 3EXTA 3ARUA 2EBNA 2WYHA 1I2OA 1P1MA 3QQ1A 3BVJA 1SZGA 2OOFA 4BQ5A 4EF8A 3GIQA 1Y5VA 4RXGA 2A3BA 3N73A 4O57A 5HR6A 3M3WA 3OHIA 3TTEA 2O56A 4CVWA 4HNVA 1OK6A 3W7OA 3E6EA 4XTDA 4DZ5A 3TFCA 3VOJA 3W24A 1G7UA 3ARSA 3N19B 1OVDA 4GIYA 1ZUAX 1RP8A 2OB3A 4O1FA 2IUZA 1OT2A 2V67A 3EX6A 5LIUX 1Q4WA 5EL1A 1Q65A 3F2BA 3UY7A 4IM3A 3BLPX 2YDRA 3RILA 4NPHA 4MZ8A 3M16A 3K46A 3T4WA 2J8TA 4E5TA 2YFNA 1JDAA 4WSKA 3N2MA 5CZKA 2DT1A 4IG2B 3K8LA 3R8HA 2Z0VA 4AC7C 4WD0A 4JKLA 1A4MA 4M29A 5EYWA 3AYVA 1BXBA 4JDYA 3LM3A 4XQ6A 4AHPA 4QX4A 3MYOA 4MKSA 1VIZA 3BLIA 1DJNA 5F2LA 3CO4A 2XWEA 1ISXA 2DUZA 2VP8A 5FAGA 1TJ1A 2CLMA 3KTXA 2F8QA 1UZDA 4BFAA 3AZRA 1F3XA 1YE6A 2CXEA 4LV4A 4IIBA 2W4XA 5IDIA 3ARZA 5A8MA 1JZ4A 2PB1A 1D3HA 1HKIA 1H61A 3K2GA 4HSOA 2UBPC 3NGFA 4QXIA 4AWEA 3L4WA 4Q3MA 4NHVA 3A3HA 4IISA 4O14A 3WQEA 4DNMA 3E2VA 1S3HA 5TQLA 1YWMA 4L64A 1XUUA 4FR6A 3TOYA 1GNXA 2PWUA 3OEXA 5CPQA 5CAKA 1J0ZA 3W73A 1XPYA 5FJTA 3OG3A 3NOYA 1BWLA 1A53A 4D9PA 1NU5A 4RE4A 3CLMA 2HVNA 2VRJA 5I3JA 4UQ9A 4DPPA 1E56A 1L8NA 1LLZA 2ZOXA 1Q8AA 3T48A 4DRSA 1A5MC 2NLYA 2OT0A 3MUXA 2X05A 3WD2A 4TOQA 4JTAA 1ISVA 3DDMA 1OT1A 4JY9A 4AHOA 3I01A 1OFAA 3AHVA 1RVKA 2CWXA 2V3FA 3VNKA 5F1UA 1GVEA 3MS8A 2UY5A 3VAVA 1RZMA 3M43A 2GQ3A 3KZSA 1SFJA 3WQFA 1DWJM 3I10A 5CZJA 4MFEA 5CAHA 4MNLA 1FXPA 2GZXA 1TIWA 4TV5A 1OX5A 1XD0A 3P8IA 2EQDA 3WLMA 2W92A 3VIHA 4QBXA 2J7EA 4AWUA 2JIWA 2V5DA 3BQ6A 1TCDA 4BWLA 3MKCA 2PDBA 4PMUA 2ESCA 1ITQA 3CKDA 1XDJA 4FLSA 2GUBA 3SN1A 3HBLA 3GAKA 3NQ7A 4ZL1A 2WLZA 4HY9A 3TQ0A 3SY1A 3W53A 4UFMA 4EVZA 3ME3A 2BY3A 5LNWA 4UZSA 1T41A 4HZ8A 1XH2A 3MU7A 1ITXA 1AODA 1Q63A 4QDPA 1VFHA 1GEQA 3OO2A 4PYSA 1XH0A 1JEZA 3LXCA 4UTFA 3FDGA 4JPGA 5CH9A 3QMRA 5I6SA 1QPNA 3CAZA 1FDYA 1GVIA 3AWOA 4OU1A 4K8GA 4DM2A 1Z8AA 1EGZA 1S5WA 4NP7A 3HU7A 4RZ6A 3SGZA 3TTSA 1YDOA 1PZ1A 3TTOA 1HL8A 1XV8A 1JDDA 4JTSA 1Q66A 1PS9A 4L61A 4O28A 4Y9NA 1KFBA 5L6UA 3UESA 4YCOA 1Z32X 4X61A 5ABFB 1QHPA 1YBQB 3MP5A 1HKWA 4WJXA 4DHGA 3KRSA 3M9YA 3G6MA 3FN9A 2DZVA 3W26A 1IT7A 5LKYA 2ISSA 3TYCA 1KWKA 5C9WA 1C9DA 1GT8A 3P5YA 3HQNA 4JICA 3NQMA 5HJYA 2PF8A 4NX0A 4OBSA 2X09A 4DI9A 1K9FA 3H7VA 4J35A 2KX9A 5AC5A 4TR9A 1KQZA 3PJUA 2J77A 3UJSA 5LIWX 3U4FA 1TPVA 2DH3A 1ODZA 4BF7A 1YBQA 2CW6A 5C5YA 1EFZA 5ABGA 2MI7A 4XWUA 4Y9OA 1NWSA 2DIKA 1ONXA 4ZOEA 4GLEA 1ZAJA 4ZB0A 3E74A 2QXWA 4R27A 3ICJA 4E4UA 4CCDA 4MG4A 1ZCCA 4QISA 4E3VA 3C3UA 4A22A 3B3DA 2EPKX 1KV5A 4GCAA 5XINA 4M56A 3T2PA 1LOSA 1EJXC 1XSKA 2ICSA 2OO6A 3AISA 4OQVA 3BCDA 4Q8OA 3GZAA 4MLRA 4NAEA 2LLEA 4QROA 3ABXA 4IL0A 2VEKA 2YCIX 2ACSA 1OJXA 1K9TA 6XIAA 1GQIA 5GNXA 5DCEA 1QWUA 2D2OA 3CC1A 3P80A 2YBTA 5TIMA 2WKGA 4EKJA 2BGNE 3VVGA 4GK8A 2FMOA 3QPZA 3OQ8A 2YA2A 5HNRA 2HNHA 1JFHA 3BAYA 3C2RA 2J9ZA 3NFUA 1E3ZA 3LY0A 3WFAA 1THFD 4ES4A 4IICA 4EIVA 3E38A 2HTMA 1TV7A 2ND0A 4WSHA 2X3WA 4PTXA 2XG9A 2Y24A 3SCTA 4V15A 1KGWA 3SM0A 1XJBA 4V1XA 3KOFA 1JF6A 3HMCA 4RDYA 2ZX7A 5E1QA 4HCHA 3QW4B 3N14A 1CGYA 3ZQ9A 4HU4A 3OWGA 3SURA 4X3ZA 4PB5A 4HN8A 1B3ZA 3F4WA 4LUSB 2C3ZA 3N4EA 1XIEA 3BJSA 3PB0A 1W1IE 4AD5A 5AHIA 5HQEA 1A3WA 2CWNA 4Z2IA 3B4YA 4RW3A 4RNJA 3OBEA 3U5UA 3CNYA 1MEHA 3RYSA 3UG8A 5AVHA 3OTRA 1ZQ5A 5FKYA 3KDOA 4LOCA 1EXBA 3R43A 1HN1A 3R12A 4XUYA 2INFA 1FDZA 4IJBA 1DKZA 4LUJA 3UZXA 3W22A 5D9NA 4O16A 2DSKA 5HR7A 1JQVA 4XZLX 1W8GA 3U5YA 1AQFA 5LXEA 5FF7A 3NA8A 1ISZA 3CAWA 3TWAA 3S2MA 5BYWA 1IWAA 1ZY9A 3N3TA 3USBA 1S5VA 2BHZA 3P14A 4FNRA 4A3HA 3W2NA 2VFEA 1I4DA 4R7JA 3VO0A 2D69A 3WLSA 1XF0A 1JZ7A 1DQWA 2PUZA 4FNSA 3CAVA 4GYJA 3ITVA 4XZNX 3E9AA 3B04A 1SZNA 2WWDA 1BTCA 2XHYA 4JQ4A 1I6NA 3P62A 4H3DA 4ZOAA 4I9AA 4B5WA 2VHLA 1HQTA 4I5UA 1OSEA 3UR2A 2FZ9A 4DBSA 2WVUA 2WMHA 2B81A 3CB8A 3VC6A 3AROA 5B80A 3GHRA 3M44A 2Y7GA 1OX4B 3W28A 1XI3A 1EX1A 1F8MA 2PGEA 4TVDA 2VC7A 5CPSA 3O15A 1H49A 1FWSA 3TYZA 4HMDA 3GDLA 4KS0A 4BEUA 1CXIA 3VKJA 1SGJA 1VRXA 3WBAA 2UY3A 4LU0A 3WK3A 3QR0A 1FXQA 2O0I1 5C2GA 2Z26A 3NURA 1TPH1 1JQKA 1HT6A 2X0HA 2F18A 3MANA 5F4WA 1DTUA 5BOOA 4GKTA 4Q7NA 3U2OA 3H2CA 5HPCA 4TUFA 1JD7A 3W1AA 2PDKA 3WMSA 1EJVC 1J96A 3SQSA 1IT8A 4K38A 2ZTKA 3HPFA 1UKPA 3WQWA 3QE6A 3EX1A 3VGHA 4PB3A 3BAKA 2CLKA 2W91A 5AHMA 5HMDA 4GUFA 3JZUA 4HMEA 5EMKA 3P3BA 1V6WA 3AMLA 3NL5A 2D3NA 2IW0A 4L1XA 2YL6A 1CB7B 4W89A 1NTHA 1E9ZB 2H90A 2PDYA 4A2SA 2OO0A 4M0MA 3W7EA 3SUUA 3BLBA 2NXHA 4AZ6A 3FKKA 7PTDA 1XIIA 4IJCA 5EFFA 1Q2RA 2P76A 3MSYA 3VYLA 2JKEA 2VO5A 3CL7A 3LV6A 4KETA 3SIMA 3ERCC 1UBPC 1UWQA 3B51X 1E1CA 2EXOA 3NTYA 1UASA 4HHPA 4PMQA 2GVEA 2YBVA 4O11A 3QNIA 4ZE4A 3ECQA 4QTGA 3EXRA 3SRDA 2Q13A 4LAMA 1EDGA 4RE3A 1FWAC 1KBIA 3G2GA 2EG8A 1L0PA 1YX1A 3K8MA 4REQB 3VMOA 3U7BA 3UNTA 2UY4A 3H7RA 2NT0A 4J1OA 4GXWA 1HNYA 3BCJA 4JNYA 1YTKA 3R7MA 1B90A 2EPHA 2DVTA 1CT5A 1CXKA 1YDNA 4A05A 3BQ5A 3KRZA 3DGRA 2DGAA 1UR2A 4P2VA 2WZHA 4CD8A 1N2VA 5CJMA 3R0DA 4IMEA 1WBJA 2OXNA 3CAQA 1I2RA 1C7TA 3WH9A 1X7IA 4ACZB 1UKSA 1XRFA 3GI7A 2TSYA 3AJXA 2PBGA 1EBHA 3W7IA 4PEEA 4FHAA 3UWEA 1M7JA 3ITCA 4ZZ9A 4BI6A 3FNDA 3MV11 3E49A 3CASA 4Y9AA 4A8IA 1QW9A 5JH1A 4YVPA 2H8ZA 3P8JA 2OZ0A 1J5TA 3L3OM 4ZXLA 1PO9A 3PK7A 2QR6A 3L4TA 5FF4A 4UFKA 1JXKA 5D2XA 2ZFAA 2CBUA 5CGQA 1UD3A 3T0AA 1SJDA 4JL9A 3QHOA 3VCRA 2WMFA 3LLFA 2X2GA 1D3GA 1JGMA 1WX0A 1JYNA 1LT8A 3VEBA 1NF7A 3MJMA 4GZJA 2A7NA 1W91A 1YNYA 4B5SA 1K9DA 3B0UX 4PCFA 3SCQA 1FHVA 3LENA 1B54A 3DECA 3A12A 1GN9A 3ZVIA 3IJ6A 3UU0A 4CQDA 4UMAA 4GFIA 2YCEA 1W3NA 3VGBA 1MUMA 4U5IA 4NSBA 3KE0A 1H11A 4CD5A 1H0IA 3N29A 3BLOA 4GIRA 3SCUA 1H7NA 3S42A 2A7PA 1JF5A 3A47A 2BG5A 3DXIA 2A85A 1MDLA 2EWFA 3BOXA 4HOXA 3LU2A 1P6WA 2WSRA 4W7UA 2GGGA 1A5NC 2EPLX 3V1HA 1JZ5A 1UJQA 5I03A 3PPGA 3UWUA 2YL9A 4XD4A 2VD8A 2DIJA 4LEFA 3QYSA 1P1XA 2ZXDA 3VD4A 4I7WA 1DE6A 2E8ZA 2QJHA 5AZ1A 2X5CA 1IEXA 2V5CA 3KDNA 4CGTA 1LUCA 3EMZA 3HMJG 4KWWA 3LBCA 1T5AA 1EHAA 4R85A 1K8ZA 3KOWA 5F7UA 3MHFA 2JKPA 3ZT6A 3MMTA 1PIFA 1L6FA 1JCLA 2V6AA 5REQA 1EUAA 2FYVA 3PZGA 3EGJA 4HZ6A 3TJXA 4O1DA 1BLIA 2VWSA 4LGXA 5K9DA 1NJJA 1X1OA 3IJ9A 3HV9A 5MKGA 2V0TA 3FKRA 3WQOA 1Z41A 1EEPA 1SSGA 3UVIA 4J3ZA 1O66A 3KOYA 4BJHA 4EZQA 2WC4A 1WV2A 4MB1A 4WDWA 2Z28A 2QDGA 2YSWA 3GU2A 5D02A 5I5RA 4JHMA 2WSYA 4Z17A 4AX6A 1JZ8A 1FWBC 3C0LA 1KLZA 1XLGA 4GI9A 5A2BA 2HPMA 2DDXA 4QR6A 2YIVX 4G2DA 1EYWA 4KBXA 4PUUA 2NSXA 1X04A 2OT1A 2QVHA 4LVAA 2CZDA 2YZRA 1V79A 1CBGA 1NVMA 4HCDA 1WDRA 1VCVA 2WC7A 2VELA 1XLJA 2P1FA 1CLKA 1C90A 3WENA 2WCGA 3W2JA 3VABA 3B03A 3WSUA 3F1QA 1HIZA 5LGZA 5I3DA 1OA0A 1O7DB 1YNQA 4H6QA 1ZNNA 3BO9A 2DSWA 1X6NA 4MDOA 2ZUSA 4MADA 1Q6QA 1A80A 3A22A 2FIQA 1UA3A 3UXAA 1Q2SA 1V6VA 3RMEA 1JDEA 2OEJA 3IIXA 3IIPA 4ZOCA 4AY7A 4ZTYA 1WZAA 1IZCA 2PLMA 1S5NA 3TUUA 1KCLA 1UG6A 3CS2A 3O3MB 1I0DA 4F66A 3B9DA 4RE2A 1XLFA 4LYKA 3C7NA 1UR9A 1UWUA 2WXDM 1XLHA 4WR3A 5H1WA 2BOGX 4JCLA 4S3JA 2ISFA 4XO6A 4IWPA 5JBDA 1FWIC 5FJIA 5E0KA 2WKLA 2E1DA 3ZJKA 3Q94A 3BLEA 1Q5MA 1UR3M 2ACUA 1QW8A 3P5ZA 3W38A 3OBAA 4E4FA 3UCQA 2VFGA 1LBMA 5BOFA 2VZOA 1SW0A 4HJFA 1F61A 1ZAHA 4FNQA 3AQUA 4PN2A 4E2DA 2OCZA 4GMEA 1KCZA 4G5DA 1OWQA 4XUGA 1GQNA 1FWDC 1M3UA 4X9YA 2EPMX 5GJNA 3GR7A 4KH2A 3NZ1A 4E3CA 2NWSA 4XO7A 2Q12A 4FZPA 3LBMA 5C7VA 4ICNA 1IHIA 5I3IA 1R2RA 3WELA 3T78A 1EKOA 3VZZA 5AN7A 2WJEA 3PZVA 3BZGA 2NVAA 3BH4A 2EG7A 5EPDA 1K6AA 3AIQA 1XC6A 2FVLA 4HU8A 4LX4A 5H91A 4AMCA 2G3IA 1MJGA 4OE7A 1SMAA 3KL5A 4JIIX 3I2WA 1KBJA 3BK0A 4ZB5A 3R8RA 1UZ4A 3ER8C 5KZEA 1KTCA 1U83A 3KBNA 1W1VA 3EPMA 4C6LA 3D47A 1R3TA 2YDAA 3BOFA 1VKFA 4V2XA 1EJRC 4OUEA 3EJUA 1XIGA 2CLPA 3OP2A 4PCPA 1BF6A 4MY9A 4GVIA 3IEBA 5CBJA 4IM2A 2NX3A 3GTHA 4RNFA 2PP1A 4GA8A 4CN1A 3TV8A 4PMYA 1TE6A 3DHDA 3TAOA 3UWVA 3MHGA 4GO8A 3ZLFA 5LIXX 1WNOA 1J01A 2CXGA 3QJAA 1Q6LA 4ORIA 3WZ0E 1OIFA 3GDKA 3I6RA 1HTYA 1SUXA 3PWAA 4Q6JA 4PZVA 4CCEA 5EFDA 1GOWA 1P7TB 2DUAA 1XGZA 4N9CA 3WKZA 4HK5A 2ZWYA 3NQEA 1P43A 5D33A 4R7OA 1QI2A 1LWIA 1EUNA 3G18A 4MWAB 3SCRA 4UWMA 5CBIA 4US6A 3ID7A 3GO2A 1VPYA 1AFSA 2I56A 2PRMA 1XCWA 4PTMA 1XYCA 5DQPA 3P82A 5CG7A 3THQA 3C2FA 3M4HA 3BW2A 4AVFA 1ELSA 1H63A 5CXPA 4NQIA 2YZ5A 1I4NA 2V38A 1XCFA 3WY1A 4NX5A 5FEZA 3STGA 4IGHA 3ZS4A 4ZGYA 3WNPA 2VURA 1GHSA 4UOQA 2D22A 4C6MA 5FAJA 4DXXA 1SW3A 1MNZA 5FLEX 4ZSUA 1VBGA 3O6DA 5HQMA 3AAMA 3WQ8A 4J3WA 4DO7A 2HXTA 2YYUA 3G0UA 2OZNB 3W2LA 3OB8A 3IJIA 4C7DA 1JI1A 4FLOA 1RJPA 3ZO9A 5BXSA 2J13A 2QPUA 4ZO6A 1SO4A 4DJFC 1ZJHA 2YOCA 2YB4A 5A6BD 3B9NA 1YXYA 3QYQA 2XIOA 3RF9A 2QV4A 2IQDA 2CU0A 4XZHA 3UNDA 3NM1A 2HVOA 4UC5A 3VIKA 2VR5A 4O54A 1HJWA 2YCKX 1VBHA 3TE9A 5A6MA 3CWNA 2C19A 3HGOA 2NV2A 1BWKA 5JH2A 3NG3A 4U28A 3QTPA 3NL2A 1TUFA 4HPNA 1N7KA 4PUEA 4NI3A 1M03A 4UCFA 1OM0A 1YEYA 3E5PA 3LI1A 4J28A 3TH6A 2J7BA 2R8WA 4M24A 3OHXM 3GH7A 4ZQNA 1R6WA 2FJUB 1TV3A 4UQDA 3TC3A 3NVTA 4FOUA 2E25A 3SCSA 4OJYA 5CJ5A 4ERIA 4WCJA 4KESA 5EMYA 1IEQA 2PRLA 4Q8MA 2A0NA 5EBUA 1K9EA 3C8FA 4DELA 1GZ1A 3UCDA 4JX6A 3HPAA 3TYAA 1KFWA 4KWVA 1NSJA 2P50A 2QUNA 2YCLB 3RJXA 3SGUA 1Y5XA 5C0QA 1WOBA 2QGYA 3NL6A 1XRSA 3N6QA 5J5RA 3EEZA 3B8WA 1AL8A 2OX1A 2Y7EA 4CCZA 1FBAA 4HYVA 4HPGA 4P61A 2CERA 5F4SA 1VEMA 3UVAA 1KA9F 3EWWA 4D2JA 4X0VA 5MKGB 3SJ3A 1G01A 1ZENA 2I9EA 1Z89A 3II1A 1HGYA 3S1UA 4C91A 3CPRA 3FEQA 1J0HA 5IBXC 4KMQA 3GFXA 7REQB 1SMDA 2O9TA 1B3YA 3GXDA 3FHAA 4N42A 4L4PA 3TONA 1Y65A 1XBVA 4B5VA 1GJPA 4D8AA 1X8CA 1BYDA 3L0NA 3N25A 2VDIA 4BF5A 3Q84A 3VU2A 1EB3A 4AVMA 4CU7A 3UPMA 4GOAA 4FSAA 3ISIX 3BAWA 2E1WA 2OZ3A 3H12A 4QS5A 1V03A 1QOXA 2FZNA 3LYEA 2WINM 5LA0A 2NVCA 1W2PA 2XINA 4WDUA 4IHCA 4W85A 5HWJA 4M3PA 4AUBA 2QKFA 5AYXA 4GE8A 1A47A 3CBWA 1EZ2A 1M1BA 4S3GA 3SY5A 3S5YA 1TPFA 3BZJA 3WH8A 2Z24A 4TU1A 3NGJA 3KLLA 3PG9A 3Q67A 4GI8A 2QJIA 1H1NA 2H6RA 3PNUA 2Z0IA 5C55A 3EKGA 3W1RA 2BODX 2D2JA 4HTBA 3LLLA 3SOGA 3HF3A 5IM51 3TA6A 1D8WA 1E1EA 4AIOA 2WK2A 2ABAA 3CL6A 2DZWA 1URUA 3G0SA 1K03A 1KKOA 3DI0A 3UR5A 4NZ4A 4CQAA 2E9LA 5C9RA 4H83A 3RHGA 2WPGA 3T4AG 3TJIA 4CEUC 4K7YA 1CGWA 2RHGA 5HNUA 3CUIA 1ADOA 2A21A 2PE4A 1Z69A 3QY6A 3H55A 3GYCA 1JRBA 4KRUA 5BXPA 4NJGA 1C8VA 4AFYA 1V0LA 1NAL1 3N2CA 1VJSA 1GHRA 2KAUC 2ZZ5A 2A79A 4E8CA 2CESA 5I0DA 4F3HA 4XZMX 2GF4A 1GJUA 3UJ2A 2I16A 1EZWA 3BDKA 3O0FA 4AWTA 3MA8A 1OB0A 4GI6A 3B40A 4KQNA 5DMNA 4M8UA 2G4FA 4Y9MA 3SSZA 4KCTA 3FA4A 3WG6A 4LNCA 2B7OA 1WKYA 3CUFA 4ACZA 5AHLA 1R8LA 4F0KA 1GOQA 3GDBA 4GYPA 4HSNA 3F03K 2WHKA 4Z2KA 2ZADA 2W66A 4ERAA 1EEXA 1DE5A 3PFRA 3MMDA 4UTKA 2VR4A 3L0KA 4EWJA 3E0WA 3VPLA 2FYMA 4JL1A 1KW1A 3TU9A 1VEPA 1E0WA 1P4CA 3AZTA 4ZFMA 4RKAA 2GLKA 3WEMA 4XAZA 1DIKA 3G1AA 5G4WA 4GVGA 3V3WA 7ODCA 4Q8WA 2C0AA 3NM3A 4YTRA 1JPMA 3NAVA 4WLCA 3D50A 5LNSA 1J9YA 3OGRA 2ZUNA 1YLVA 1IEIA 3VIGA 1S2WA 1S1PA 5I7GA 3VNYA 3S9ZA 1A49A 3Q0KA 3FSUA 3DX3A 3HGSA 1NDYA 3C8NA 4XX6A 1BQCA 3WLJA 1F73A 1JCXA 2ZUMA 3TSDA 4UFIA 3QC3A 3A24A 2I14A 1QO5A 3S9YA 1JZ6A 2WW5A 4S3DA 1TG7A 3WL1A 4J2PA 3UXIA 5HWNA 3EWBX 1ZGDA 4YHEA 4PUMA 1V02E 3A9IA 5DCBA 5FJJA 1GTHA 1ZAIA 5AYBA 4HYWA 3LXAA 5I78A 4PH6A 4B2DD 1XBXA 2VCBA 2J62A 4DB7A 1EBGA 3BJFA 3QXBA 1HG3A 1MXDA 3KCOA 2W63A 2QUVA 4GD0A 1PKMA 4JCMA 3VM5A 4LRTA 3C4UA 3S46A 4E2BA 4BNEA 3KBJA 4C6NA 4RW5A 1TR1A 3WH7A 2AKMA 2DFAA 2WBGA 3CZKA 3RM4A 1H1YA 3LZ5A 2OU4A 2G97A 2ALRA 1UW9A 1W31A 1FP8A 3HG5A 3TLQA 5FF2A 2REQB 2ISVA 4M6VA 4QSHA 4A29A 4S2BA 4XB3A 4N9BA 2P3EA 5GNZA 2PY6A 3WQ6A 4FXSA 2GJXA 1SZFA 4L1GA 1R9ZA 3LGEA 4IUGA 4Z2LA 3U8GA 4PRRA 3WN6A 2GSEA 4ZTXA 4HBKA 4F01A 3QLLA 4H6EA 1Q7QA 3NZQA 4MJ4A 3WDQA 4D1IA 5HOSA 3S8HA 1ZYLA 4JFVA 5BNKA 5C2CA 1EPXA 5FL1A 1XFBA 1WAWA 4WDXA 3PF3A 3BUDA 2G96A 4JZ5A 4ILSA 3RR4A 1T96A 2QUMA 4HNCA 2QAFA 2GUUA 4F4RA 4UQBA 1D2KA 2XFYA 1E9VA 4HNTA 3MO4A 3IK2A 2WMGA 4MJMA 2BNJA 2UY2A 3DAQA 4B5XA 4RUBA 1PS3A 1OCBA 2F7RA 5MHBA 1M5WA 2Q8LA 1FWTA 4JAWA 1MQQA 1ZFJA 4UIOA 1I2NA 4KIKB 2R94A 3E2RA 3GE7A 2RFGA 3WK1A 1VRDA 1WZMA 4UMBA 3BICA 4L9YA 2E6FA 2R9RA 4JOMA 1IF2A 2VT0A 3UW6A 1F76A 3OVGA 3BC9A 3T44A 2Z2AA 3LCWA 2DEPA 4D6FA 1CYGA 5BOEA 3OVRA 1TIMA 4F79A 2E7FA 1XBYA 4Y96A 3PM6A 3R0UA 1J11A 1TQUA 2CITA 4QDMA 1H60A 1UQYA 3C52A 3FXYA 1MEIA 3BG3A 4WK9A 3VE9A 1GCYA 1P0NA 3RPTA 2B7NA 1RJQA 4LS2A 1OAOA 1XLKA 1FWJC 4EOUA 4JR5A 1UD5A 4MF4A 4JBRA 4JIHA 3CYVA 1JXJA 3HG2A 3W84A 4LYPA 3VX0A 3KW3A 5IHSA 3MV01 3GRIA 3STEA 3WJWA 1UPMB 4U3AA 5JBFA 1HW6A 1DWAM 3FYPA 3H2OA 3ARQA 2XN2A 5A6KA 4M1RA 1EWEA 3ONBA 4MNJA 4Y7EA 2RAIA 2ZUUA 1KC7A 2EO7A 4IPPA 4HT3A 2BMBA 1M53A 4AD4A 1PZ0A 2P8CA 2HBXA 4BQ2A 3HV8A 2FLIA 4CCCA 5A94A 4I90A 1EDQA 4MPQA 1R47A 4F0LA 2GGEA 3RLHA 4AEFA 2PGFA 4RX0A 1WKFA 3QRHA 3XIMA 1M01A 3U7VA 3BV4A 3M5ZA 5E9AA 3W3OA 1WXJA 3AMDA 3AS3A 1N8IA 4NZ5A 1WDQA 3HAIA 1EOKA 2GUYA 1UA7A 1L2QA 3VC5A 4YYCA 2XN0A 4K6AA 4UCGA 3I7QA 4DX3A 1YPXA 1PKYA 1LUCB 3VKCA 4H7CA 3BUBA 4HNOA 5EBAA 3TR9A 5C6MA 1TWWA 2RJHA 3SEPA 3CO8A 4WKAA 2Y0FA 3QWEA 4OGZA 3NOEA 3NYZA 3PZIA 3LSBA 2QDDA 4WXZA 1R3RA 1F6PA 4IJRA 2A3CA 3GLCA 3DCPA 3BTNA 3IUIA 1MQPA 1I8JA 1O5RA 1ADDA 2WB5A 3I4EA 4OFCA 4WY0A 3UQNA 1QASA 1Z48A 4B90A 3TC6A 2A6NA 2XSBA 7ENLA 4KWUA 4EANA 1CW2A 4PO2A 4JN6A 4MYAA 3O05A 4EXAA 4J3UA 4L80A 3LCLA 2FTYA 4Z1BA 2YKKA 5A8NA 1X1ZA 3W01A 5AYZA 1H51A 1UZ1A 3WBYA 5EMMA 3RLGA 1ITCA 1W3HA 1XXXA 3OZPA 4XZWA 4ZO8A 1TPUA 4MYXA 1OHLA 2GGJA 1JDFA 1ZJAA 3RPMA 5E9XA 1JAEA 1FP9A 2CCRA 3NO3A 1BGGA 3EWUA 3V75A 4DYKA 5BWAA 3IGHX 3QFEA 3W2KA 3N1AA 4HR1A 2R1MA 2E5CA 2VZTA 1G4SA 2HPIA 3UBPC 1TWSA 3XISA 2NUXA 2EG6A 2Y5EA 1DL3A 1KM3A 3ARTA 3W1QA 4ZR8A 4OWGA 1AW1A 2F7FA 1SJAA 1VLIA 4GXMA 4Q8NA 1RXOB 5E6YA 2QW5A 1VFSA 4O19A 2X7WA 1FOBA 4RZ5A 2PTXA 1HXJA 5AC4A 3LA4A 3C6CA 3RO6A 3M64A 4AYGA 3MDWA 3L7RA 2V2HA 3WNLA 3TQPA 3TSBA 2IXVA 1GJWA 1Y8BA 3G3DA 4YYFA 3CQIA 1JCJA 1QMLA 5FEXA 3WCZA 3HJEA 1XLBA 3PBYA 3FLUA 1VEOA 4JTHA 1J8VA 1PKLA 2DJLA 4NJIA 3CIWA 4DJEC 2VEPA 1TWDA 1QW7A 3RV1A 1VJZA 2OQYA 4OV9A 3EWCA 3GBDA 3FV9A 1KFKA 3D2FA 1WZLA 5HMEA 1HJUA 5CPNA 1J0JA 1DWFM 1E6ZA 1PB0A 1MEWA 4KIKA 1WYIA 4JTCA 3ABHA 4LANA 3LGGA 3VEAA 2GFTA 2P88A 4PCSA 1M04A 4DO4A 4H8UA 1D7FA 1WZKA 1JI2A 3SI9A 3UYIA 3DU0A 3LPOA 1V3KA 2RJGA 3KWXA 4UTLA 3KL3A 4PRWA 3H7UA 3KAVA 1ICSA 1J5SA 2X1SA 3O7UA 5IFPA 2RAGA 1GQJA 4GQBA 3UWQA 3EDJA 1F7BA 2C15A 1Q3NA 1K4HA 5CG0A 1Q85A 3F4VA 4D8LA 2XSAA 1HJXA 4XSMA 4QM1A 4IW0A 2E67A 1H5VA 3B05A 3GH5A 3LMFA 4CNOA 2PDXA 3REQA 1G1YA 2GJXB 2V69A 5A8QA 2F6KA 1ISYA 2G0WA 3TZNA 2PTZA 1CB2A 3CIXA 3CIVA 3HIJA 3GG8A 3VGEA 3I3EA 3T8LA 2OW7A 3ZYZA 3SYVA 1FRBA 3KCJA 2Y6ZA 5ABTA 4WY0B 2VCAA 1CDGA 1YHTA 1GVYA 2Y1HA 2GDQA 1FWWA 1F6YA 2BY2A 3FGCB 4LBSA 1XIJA 3ZR4A 4HP5A 3RX3A 1RPKA 1S1RA 5D8WA 2XU2A 3BAJA 1DQXA 3THUA 3W7NA 3DX4A 2DVUA 3VFCA 3SFKA 4IIFA 7TAAA 4UB9A 3ZXWA 3W7RA 1KTNA 1JUEA 7TIMA 3CZJA 3AYRA 2EJAA 2E6AA 3CJPA 2GWGA 4P5UA 4QITA 4DXVA 3WQ4A 4ICCX 1MW0A 1N55A 1EJUC 4PULA 2YIAA 2F9RA 2DZPA 2OWWA 3N34A 4MVAA 1MYRA 4TVUA 4DF2A 3W0KA 1W5OA 3RU8X 3S1WA 1FWFC 3BVTA 4Q4RA 4ATMA 4MHBA 3O3NB 2ZX9A 5I3FA 4UFHA 2PD5A 4IZGA 2E5DA 3VD3A 1I4LA 1GNLA 1HGWA 3ACOA 1JYXA 3KVLA 1BYAA 4N0RA 2VZUA 3G1SA 5E84A 1SO6A 1V6UA 2VEGA 3WEZA 3EJPA 3FSTA 1A5UA 1NY1A 2OYMA 4B3ZA 3CL8A 4GI4A 2VRKA 3BOLA 2Z4GA 5E09A 2J9YA 2FH6A 2H9AA 3KUMA 3ZM8A 2DPEA 3ITLA 2BTMA 3O3RA 3WL0A 4Q4MA 7A3HA 5DXXA 3TOPA 3KP0A 1Y0EA 4I1QA 5K4XA 4LUTA 3DBPA 3W7HA 2E8YA 3VCNA 3EXSA 3VOCA 2Z0NA 5CPTA 3L65A 3V18A 3MUIA 1TPDA 3B0VC 5F2GA 5KZ6A 2NT1A 3AMGA 2PC8A 5FACA 3QLDA 5KBPA 2WCAA 1XIDA 2RGLA 4B9ZA 3GKFA 4E0CA 2QS8A 5FI8A 5J8LA 3VKHA 3C0JA 1RBOB 5JUVA 3W25A 2VENA 1SU8A 3UD6A 3P60A 5REQB 1B30A 1EXPA 3AHYA 3TKFA 2FJKA 1QI3A 5K9CA 3DX1A 4RPQA 2WAGA 1T0OA 4U31A 1KFCA 2X0YA 4HVXA 2WNZA 3OLIA 5IRPA 3G8RA 3NPUA 3BUPA 1E6RA 1MXGA 5D03A 4N6FA 2WSQA 5HA7A 2HMCA 5LHFA 1V3HA 2DY3A 1OX4A 5I09A 1PYMA 1W17A 4PSPA 1I49A 1BG4A 2VDGA 1C91A 3JUGA 3E1F1 1LG2A 3EBVA 3W1TA 1TA3A 5GPRA 2PD9A 1SFSA 3RO8A 7XIMA 4YMZA 4Q4PA 4F0MA 1DOSA 3CMJA 2BY1A 1FH9A 1UWAA 2ZE0A 4US5D 3UZJA 4A3YA 4KW2A 1EO7A 1KBKA 1S3TC 3HTWA 1XSIA 3WQGA 3CB3A 4I8DA 3ZZ1A 4JYFA 1OINA 4Q8QA 1LDCA 1AH3A 4XBSA 3CWOX 1HTIA 4O8AA 5GJMA 2PDWA 4E38A 5D09A 1Q4NX 4PUDA 3AYTA 2CBVA 4YJ5A 4NZ1A 1J12A 2YKTA 1AD4A 2CLEA 4C6EA 3O6AA 5MF5A 4W4QA 3HN3A 2V81A 4H9MA 4BQ3A 2DZAA 3UWWA 3IJ7A 3T7VA 3SCWA 1G0CA 1CIUA 3OA3A 3EKLA 2OKOA 3ABZA 1S2TA 1JIBA 5T91A 3TN6A 1AD1A 2JQXA 4D6HA 4JTUA 1WBHA 1QNRA 3V7PA 1E1FA 3WD4A 2W79A 4Q32A 3OJGA 3EB2A 4HSHA 2J8FA 2GAFD 2NQ5A 3T09A 5C9ZA 3SUWA 4B15A 1XS2A 4XZIA 1NELA 4HOZA 3S2LA 1ZBCA 3W71A 4W7VA 1MO0A 7REQA 1D8CA 2AQOA 3SIZA 2QFFA 1KRAC 1LBFA 4I6KA 5FOOA 3UCCA 3PUDA 3CK5A 2ZRUA 2ACRA 4C6OA 1WKEA 4UNKA 2BGQA 2Y7DA 4IWWA 1AUSL 1LZOA 2IPGA 4OUIA 1V4YA 1YTDA 1B3OA 2Q3RA 2OGYA 3GUGA 3PBVA 2QF8A 1VPXA 2CC0A 4EZWA 4ROQA 2X16A 3POHA 1W9XA 2GJLA 4Z2GA 3NSXA 3AICA 3INPA 2ALDA 2XVGA 3YPIA 4GO9A 2Z27A 2QHAA 3IJLA 1M6JA 4HMCA 4CU8A 4AEEA 4FZSA 3GWQA 3AYSA 2GVYA 1EGVA 3WF0A 3W1LA 2CETA 1FHLA 4AIBA 4UR8A 2OODA 3PAOA 1OYBA 4JQ2A 4CUCA 1BEUA 3C3NA 5T9BG 3SGGA 1EP3A 1TO3A 2WANA 4FPSA 4CN4A 3GDTA 5A6AA 2NVDA 3DHFA 1RCQA 3SSJA 3T47A 4OT7A 2OGJA 5U7SA 3H2AA 3W4RA 3TP4A 5AYIA 1KCXA 3ZT5A 3E0IA 4AWSA 3A64A 1AZ2A 2AMXA 3TW9A 2XM2A 4AHQA 4QCEA 3GC5A 2XH7A 5D2TA 1V93A 3I39X 2QCCA 3K4WA 3MJYA 3SDOA 1JDCA 3S4TA 3NXFA 2OPJA 5K3VA 4L6HA 2BXZA 1NWTA 4DM1A 3GVGA 5DT5A 5T9CE 3PB2A 4JL2A 5FEPA 3FVMA 3CQKA 4O12A 4KCVA 1W5PA 3SJNA 3FXGA 2FZDA 3IGSA 1OA1A 3WDHA 3FJNA 1RQEA 4NQ1A 4XIAA 4ZA0A 4QP0A 4J27A 1FWHC 2MANA 4KPLA 4FXFA 2HZGA 1HJVA 3OBKA 3F2CA 3MBDA 3T2QA 3HM7A 3ARWA 1UZHA 3V1PA 1W1TA 3ITTA 4HR1B 3MUAA 2Q02A 3RX2A 3LVTA 4UFJA 1O1ZA 4O13A 4F00A 1SSDA 3NSMA 1TMLA 3FAWA 4QQ3A 3CYJA 2D24A 1NM9A 2F38A 1QXLA 5G5IA 2CLLA 4R34A 2FB2A 2GGIA 1CNVA 3UA3A 3E3HA 3JR2A 3ITGA 3T0CA 2EAWA 4TVCA 3RNDA 2ZZ3A 2BY0A 4XAFA 1UUMA 4AF0B 3TX9A 1REQA 4GKLA 4YTSA 1R2SA 3VILA 1U2YA 5HPOA 3RITA 4F0HA 3V0UA 1TR9A 2GDVA 1AA1B 5ABFA 4DAIA 3DESA 3WMLA 4OVXA 2VFHA 1D3CA 3F5JA 1UMYA 3XINA 3L4XA 2C1GA 3S2CA 3URNA 2A3AA 3N17A 4MB4A 3WLPA 4CVUA 4IWOA 1TPWA 5C7HA 3LS9A 2VGBA 3AIEA 3GS6A 4AX7A 1MUCA 3B8DA 5G1YA 2RDWA 3W82A 4EZNA 3TMLA 1SR0A 4MB5A 4LQ1A 1RPXA 3WLIA 5IDZA 2R24A 2NWRA 4UTTC 3AOFA 1C8YA 5D04C 2AGKA 1DKXA 3RN6A 4GPNA 3CQ0A 3D52A 5EB8A 3T40A 3AMKA 1S2UA 4GIEA 1OCNA 3QSTA 4UOZA 1NP0A 2PSNA 3RIKA 1Q6OA 3GD6A 4LTSA 4J3TA 3DFSA 1QNOA 2VOMA 3WJXA 3N13A 3UZZA 3K8KA 1EO5A 4NXSA 1RJRA 1X98A 5IHRA 1GZGA 4XTIA 2AQVA 3GM8A 4ECLA 3PTMA 3R79A 3R5EA 2HVMA 1DJQA 2DQXA 4HK6A 1F3TA 1V8EA 5M3WA 1GYLA 3TZFA 2FGZA 2J75A 2O55A 3CQHA 1BHGA 5HQLA 1GORA 4XV0A 1REQB 1I75A 3NR0A 3GTIA 1CZ1A 3JU2A 1TJ0A 2VQTA 4GH3A 2VD9A 4IMDA 1ONEA 2B31A 2BSLA 4IXHA 3DI1A 1WAUA 3TIMA 1EPVA 3V5OA 2UWFA 1LWHA 5AHEA 3OW1A 3DHUA 3FFSA 3AIUA 3W7PA 4NIRA 1WB0A 3W76A 1ZRQA 2A2IA 1ALDA 5K4ZA 3LRMA 4I3GA 3L21A 3NCOA 2XIQA 3M1ZA 4DCNC 3QZAA 4NZFA 3RUBL 1DJHA 2HV5A 1XINA 3BLLA 1OGSA 1JULA 4IMFA 1CGXA 4TX6A 1DJIA 3HPZA 4PUJA 4GNKB 1AH4A 4MJZA 4GQ0A 3GHSA 3KHJA 3H24A 3D6NA 3OZOA 4MFDA 2X40A 1C9WA 4B9QA 1JZ3A 4R5JA 4MLJA 4JWEA 1O4UA 1EC8A 3CV7A 3VOHA 3BLFA 3TN5A 1KTBA 2YA1A 2WZIA 1MWOA 3SECA 3VX1A 2VNCA 5BWFA 3EB4A 5IBXA 1NWRA 4KCWA 4NYUA 2O4QA 4DJFD 1X96A 1UWRA 2QZRA 3RAOA 1UIPA 5H2ZA 2C14A 1PHQA 2R14A 4OECA 3GXNA 2GJRA 2PLCA 3Q65A 3QQWA 4XG1A 4GY1A 3TAKA 4D72A 1QNQA 3N2TA 1KM1A 1XGEA 5TD4A 2FZMA 1OFDA 5JQ9A 3IK4A 3UY8A 4IUOA 2X8RA 5TAOA 4RJEA 2DV0A 1A5OC 5F4XA 3DN5A 3U3HA 1MW2A 4ALDA 2CBIA 3ALFA 3NPXA 4DZHA 5AKQA 1B3XA 4PODA 3ZLGA 3W85A 5E5CA 2XIMA 3LHWA 4G1NA 3DFOA 4URIA 4FNUA 2XVKA 4EXQA 3ITXA 2PFHA 5CBBA 1QHZA 1VFFA 2DSZA 1YPIA 4N9EA 3NPWA 4ZODA 4LPCA 3DKJA 1OFOA 3BSMA 1T7LA 1ZSXA 1Z44A 2PDJA 3W7KA 5LA2A 2VR2A 2PAJA 2BOEX 1WKDA 1KXQA 2QMKA 2A3HA 2QNEA 3CHCA 3GVWA 4M1BA 3PG8A 1K7FA 4H41A 1TMHA 3WF2A 4JFTA 4Q6XA 3G1FA 4R33A 2GK1B 1GOKA 1KM4A 5D2YA 4G7EB 1WCGA 3HFYA 3KM8A 4LF2A 4IQJA 4AW7A 1TVPA 4JFUA 1EX5A 2PTWA 2VFDA 5BMWA 3BVUA 1IR2A 3A13A 2R1LA 2ZX5A 1XG4A 2ZXAA 4JWIA 2CPUA 3O16A 2QLYA 3NQ6A 4HYRA 4D8ZA 3DPQA 4WPCA 2I5QA 3IAQA 2RAJA 3D2EA 3PSWA 2DUXA 3N6HA 3KLKA 4GG9A 5G4EA 1DBTA 3SZ8A 3OLGA 1Y7VA 4IMCA 3PS7A 3CXOA 3BW3A 5PTDA 1PX3A 3LG3A 2VQUA 4ZENA 1DQUA 1UH4A 3CMFA 2HSAA 4LC8A 4PTNA 1F6KA 3TROA 2PA6A 3S5OA 3NQ2A 4REQA 1WDSA 3GNXA 3NQVA 3OLEA 3IJQA 1M41A 1GG0A 1M7OA 2J24A 2P53A 2AKZA 5KINA 3QSRA 1L6WA 2Y61A 4LNYA 4EZVA 4XISA 4PGLA 3H23A 5BRBA 1UJPA 4UTWA 3PVFA 4WHBA 2NCZA 2DZUA 3Q37A 1S2VA 4AZHA 1YXDA 4WY0F 4XKYB 3UJEA 4MIMA 3OVPA 4C1NB 4NNAA 1HWWA 5DO8A 4KRZA 1XQLA 4WUIA 1GKRA 3CQJA 3U57A 4GUGA 4EZTA 2CKRA 2XIBA 2Z2BA 3H22A 2VX5A 1ENUA 1HX0A 2PP0A 2DJXA 4Z0JA 3URAA 1K8CA 4TXEA 4I9MA 1I1XA 3S2JA 1IXQA 2I5GA 1UCWA 3HG3A 4W5UA 3NSNA 2X1RA 1LBLA 3QA8A 3WK2A 3TQKA 3UA4A 3T1GA 1KXHA 1W5QA 2PDUA 1H41A 3EOSA 2WYSA 2EF9A 4L56A 3CZLA 5FEWA 1TELA 3GU9A 3IVTA 3VZXA 3OYXA 2G3FA 5T26A 4GQRA 2YLLA 1YE4A 4ZO9A 2NV9A 3BCFA 3QNJA 1R3SA 4AAJA 2YL5A 4DBUA 3NPVA 3OK8A 2BFGA 2FPTA 2I9UA 2FVKA 2YLAA 2IXUA 3LHYA 5JVLA 4DWSA 1WUFA 2HK0A 3A5FA 4YWSA 3ARYA 1NIUA 1TQXA 1AZ1A 1WO2A 4YVVA 2GSJA 4W8BA 3DC8A 5TNVA 1OC7A 2IKIA 5DT7A 4ZE5A 1PTGA 4FEZA 4W5ZA 2PODA 2FPVA 3G9GA 3WJYA 4IIDA 2GK1A 1P48A 4MWAA 4EPKA 4LXFA 3B06A 4JNZA 4W84A 1X8FA 1XCXA 4AIUA 4Z1CA 4TMBA 2PDCA 4NRSA 1QJWA 3DIPA 2DT0A 3G8EA 3SQMA 4EAYA 2GDUA 1XYBA 4JIRA 2V63A 4IGMA 3BARA 4HU3A 1R0MA 1UC4A 4L4LA 1EJWC 3MMWA 1PTAA 2RUSA 5JIPA 1JR1A 2ABBA 3THDA 2V9DA 2DW7A 3DFYA 1TTPA 4CN6A 2YW3A 1DIDA 3W83A 1F3EA 3B0PA 4GINA 4JX5A 1UD8A 2PURA 4O17A 3TN3A 1OEPA 1XGDA 3G1DA 4H00A 4JTKA 4AYSA 3DEQA 1YIXA 4AZCA 1QAPA 1J2BA 4IGNA 3ER9B 5CPOA 1QU4A 2YX0A 1S5TA 1L2UA 5E6ZA 3D51A 5G1MA 4AC1X 2Z0OA 4EZSA 4PMDA 1G4EA 2D73A 4IFRA 5G4HC 1W37A 3GVRA 4GYKA 3AU6A 4BZYA 3HZ3A 4S3KA 1VF8A 4C6JA 3O6YX 1H7PA 2WBKA 3KS6A 4Z2HA 1JJKA 2BGSA 1YNPA 2PU1A 1W3KA 4QCFA 1MMFA 2N3KA 3GG0A 3NO5A 4R5EA 1DXIA 2Z1WA 3DG3A 2YJQA 5I00A 1LRNA 4FNTA 1KBBA 4NAFA 3UZ5A 1FCQA 1XLAA 2E6YA 1EQCA 1W56A 2VUYA 2A4AA 2NUYA 1VH7A 3B0XA 3O9NA 4HD5A 1R46A 1ZCOA 1GW1A 3OZYA 3VDGA 3AIRA 5J04A 1E70M 3EWZA 3RCNA 3A21A 1NOWA 1HJQA 3MUY1 4NZCA 3LM7A 3CZ8A 3MPGA 3TNBA 1PV8A 3ZLHA 4OBTA 8TIMA 4GZIA 4ZMGA 3GFZA 3V5CA 3L5MA 3V5FA 1NH6A 4WSJA 1DKWA 1Z6KA 4HOWA 4H7VA 3N2OA 3NIYA 4D1JA 2NQJA 2WSPA 4YL2A 2FTPA 1W9MA 1W54A 3B8IA 2VC9A 1SPQA 1T8QA 1HVQA 1RD5A 2VZVA 3LCHA 1U1UA 1FWRA 3P0XA 4IG2A 4LB4A 5LHEA 3H26A 4GUJA 1VBUA 2WJDA 5DFAA 4GFSA 2NZLA 3N2XA 2JF7A 1SJBA 4UFLA 1V08A 1BXNA 3AJ7A 5CGMA 3IJ8A 1TJRA 3FJ6A 1U22A 4QRNA 1Z42A 1WPCA 4GYFA 3B9AA 3FGCA 4TX9A 3A4XA 2J79A 2FHBA 3TK7A 4C6KA 1QUMA 4RK8A 1Q6GA 1F5ZA 1H62A 1TVNA 1AJ0A 2YI9A 3DFQA 1P6BA 5D9MA 2PU0A 1CXFA 2C08A 2I1OA 3GUWA 4ATDA 2E6DA 3VNZA 5AC6A 3APGA 4MSSA 1XYFA 3EDFA 4MOZA 3S83A 5BRQA 2YW4A 1H7WA 3UZWA 1P0BA 3WYZA 4DUVA 2ZRXA 4MWAE 4RDZA 8A3HA 4DBEA 4GH1A 3VA8A 3EA3A 4GABA 2X2YA 3MVIA 4S3BA 5CGTA 2OLSA 4D6CA 3I7SA 4F0RA 2XZ7A 4H2CA 2DH2A 5DELA 5B7ZA 4L5ZA 3N2BA 5A6TC 1QHOA 1XRTA 3ARPA 1OZMA 2C8NA 5CQ1A 3T0TA 3D5HA 3L5LA 4LYRA 4HU0A 1PVNA 1VAHA 3RR1A 3BURA 1NOFA 5A8OA 2V5KA 3MWCA 4GRSA 4UXDA 3IV3A 3V0TA 1W6TA 1XQKA 2ZUVA 2WC3A 4JIEA 4M19A 5G2WA 3AIBA 1RAKA 3FYOA 3GVQA 1FQ0A 1TWIA 3SCOA 3O3OB 3RJYA 2VWTA 4IOTA 1WQ5A 3EMQA 3CU2A 4CKQA 2JIEA 3NEHA 2E3ZA 1IQ8A