4B3OB

Structures of hiv-1 rt and rna-dna complex reveal a unique rt conformation and substrate interface
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
425
structure length
410
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWVPEWEFVNTPPLVKLWYQLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexes of HIV-1 RT, Nnrti and RNA/DNA Hybrid Reveal a Structure Compatible with RNA Degradation
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/dna/rna
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 88
structure length 410
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4b3oB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oB03
2AGOA 3OLBA 2HMIA 3V81A 4RW4B 4Q43A 5HROA 1C0TA 4TYAA 4TYBA 1QE1B 2R2TA 3KLFB 3BREA 2IMWP 3KLFA 2AGPA 2BR0A 1SUQB 1DTTA 3I0RA 4WE1A 2YNIA 4MH8A 4RW4A 2HMIB 1SH0A 3CDUA 2HNDB 4WXWA 1JLBB 4RUAA 4ED7A 4R8UA 4IFYA 2FJVA 2UUWA 5D3GA 4H4OA 5C25A 3HVAA 2FLNA 3IG1A 1K1SA 1LWCA 3KLGA 2IC3A 1RT6B 4MIBA 4QWEA 3SI8A 2BE2A 3LANA 2HNYA 4XPCA 1HPZA 1S9GA 2XI3A 3GILA 3I5BA 4ZP8A 4DEZA 5J2NA 1S1WB 2RF2A 1N48A 4ECXA 4KV8B 5DQGA 1LW0A 4ID5A 1SH3A 4TN2A 1VRUA 3V81B 1IKXB 4ZP9A 2R8HA 1N5YB 3BSOA 2OPSB 3LP1B 1TKZB 5FDLB 1S9FA 2VG5A 5KFZA 3JYTB 4TQSA 2AGQA 4RNOA 3V4IA 4OL8A 4WFZA 4ECWA 2OPRB 3MEGB 3H5XA 1S1TB 4MK8A 3C6TB 3ISND 4WXOA 4IR1A 4RW8B 1IKYA 5KFFA 2O5DA 4ECSA 4WYWA 3CVKA 3QO9B 2XGPA 4J9RA 5KFPA 1EP4B 4K4WA 5F9LA 3BQ0A 4R5PA 4JV0A 4EBEA 3KMSA 5HBMB 4O3SA 3MR3A 5DG9A 3DMJA 4F50A 4IRDA 4YR0A 3GQCA 3PW0A 4DL2A 4B3OB 3KLEB 1R0AB 2V4RA 2ZD1B 5L1IA 3RBDA 3RB6A 2JEGA 2W9BB 1DTQB 3QIPA 2OPPA 4IDKB 1DLOB 2BRKA 3RAXA 1WNEA 2R2RA 2WCXA 3QIPB 4IDKA 3PW2A 4IQXA 4ZPDA 3GIKA 2W9BA 3M8PB 2J6SA 3GIMA 1T05A 1QAJA 2V0NA 1S1XA 3N6LA 4NLVA 4NLOA 3FQLA 3MEDA 2W9CA 3G6VA 3QYYA 2J6UA 1T94A 4M94A 3QO9A 4QWDA 2R8JA 2WRMA 4KFBB 5KFCA 3QGGA 4RNMA 1IKYB 3T1AA 4NZ0A 3CDEA 3MEEA 3I5AA 1LW2B 5KFSA 3MECA 1TL3B 1EETB 3MFIA 5J2QA 2OPPB 2JLEA 4JUZA 3LAKA 2I5JA 3VQSA 4IFVA 3H40A 3D28A 3E51A 5L1JA 4FS1A 3BQ1A 4K4YA 3RB0A 4PWDA 1T03A 3MFHA 3GV5B 2YNHB 4KO0B 1LW0B 4ID5B 1FKPB 1KLMB 3TQ1A 1S0MA 3V6DB 1TQLA 4QWAA 2C2DA 1CSJA 3KK2A 2YNFA 4IH6A 3UQSA 4EO6A 4NLRA 3LAMA 2C2EA 1RA6A 1JKHB 4ED8A 3DI6A 3DRSA 1IM4A 4ED0A 4O3RA 5F8NA 2EC0A 2R8GA 5HLFA 3DRPB 1YVFA 4NLWA 3MR2A 3DLEB 3KMQA 3IG1B 2XCAA 2B6AB 3C6UA 3KJVA 5KG2A 4URSA 5KT4A 5D3GB 1TKZA 3PVXA 4PUOB 2WB4A 5DG8A 4G1QB 2JEJA 1XR5A 1RTHB 2HWIA 4IR9A 2HNDA 3CDWA 2FLPA 4J9LA 1DTTB 3I0RB 4O4RA 1N56A 1S0OA 2QE5A 1RTDB 4U6PA 1S4FA 2W7PA 5HROB 2WHOA 3DM2A 4IG3B 2IM2A 1RT2A 1S1VB 4HKQA 1S97A 4PUOA 1LWFB 1RT4B 3DLKB 5CYQA 2HNYB 1HNIA 5KFLA 1HNVB 3DLEA 4Q8FA 3HVTA 1LWCB 3KLGB 2JEIA 5EWFA 1FKOB 4ZVGA 2FVSA 1IKVA 1HYSB 4H4OB 5C24B 3GYNA 1LWFA 3DLKA 3RBEA 3JSMA 2YNGA 3SFUA 1C2PA 2HAIA 3PJWA 2WONB 1SH2A 4IG3A 4NRTA 4TY8A 4ECUA 3KK3B 2OH2A 4MK9A 5DG7A 4H54A 4O44A 4KO0A 2FVQA 2YNHA 3FRZA 4NLUA 1ZETA 3PHEA 3IN5A 1TV6B 5KFUA 1C1BB 3KJVB 4DL3A 2AWZA 4KHMA 4YP3A 3BR9A 5KFVA 4LQ9A 4ICLB 3UR0A 3V6KA 1TL3A 1REVB 1RT5B 4NLYA 4NLPA 1RDRA 5JUMA 5KFJA 1LWEB 2ALZA 2VG7B 1JXLA 2J6TA 1TL1A 1RA7A 3KLIA 4MKAA 4ZVHA 3V6DA 3E01A 1FKPA 1JLQB 5KFKA 4RU9A 1HQUB 4DL4A 3OSPA 4QWCA 4K4UA 4XO0A 2HNZA 1GX5A 4X2BA 3H5SA 4J9KA 3M8PA 5C42B 4EBCA 3DDKA 5EWGA 1S6PB 1RTIB 3OL7A 1DLOA 2AU0A 4FBTA 3T5LA 3DOKB 5I42A 2RDJA 5F8JA 4Y34A 5KFQA 3FFIA 3ISNC 4ED1A 4B3OA 2W8LA 4TY9A 3BJYA 3IRXB 5DQHA 4I2PB 1HQUA 1S49A 2D7SA 2YKNA 1S6QA 1HMVB 4I2QB 1TKTA 5J2PB 3FSIA 4WYLA 4ECRA 4ZVFA 3KLIB 1TL1B 5HP1B 3PJXA 1LWEA 4I7FA 1GX6A 4NLTA 4FBUA 1S6PA 1KHVA 3DYAB 5DGBA 3QZ7A 2AX1A 3H98A 5KFXA 4NLDA 4ED6A 4RW6B 3KLEA 3EPIA 1RT1B 4NLGA 3KK1A 3DMJB 4MFBA 3N6NA 3SFGA 3ICLA 3CIZA 2ZKUA 3M8QA 2GIRA 1VRUB 1TKXA 2ZE2A 2W7OA 5DQIA 4DL5A 2BQUA 3E01B 2ILYA 5J2NB 5KT2A 3GIIA 2VA2A 1BQNA 1SV5A 4IG0A 4NLQA 2R8KA 3C6TA 5KT5A 1RT5A 2B43A 1S9EB 2JC0A 2ILZA 4RZRA 2OPRA 3MEGA 1RT6A 1JLFB 3TAMB 1QAIA 2IM1A 1HNVA 4NRUA 1C0UB 4LSNA 1N6QA 5DGAA 3NGDA 3HHKA 4IOBA 3I5CA 4ECVA 1N5YA 2WTFA 3PR5B 3EZUA 4IH5A 2YNIB 1ZTWA 4ED2A 2ASDA 1SUQA 5I3UA 2UVUA 4O44B 5KFIA 5KFMA 1RTDA 1TVRB 4LSLB 4DG1A 5I3UB 4KB7A 3V6HA 1S0NA 2WK4A 3CWJA 3KLHA 4EBDA 2DPIA 4M95A 4G1QA 3JSMB 4KE5A 1HPZB 1S9GB 4O4GB 1HYSA 2IM0A 2BE2B 4Y2AA 2B6AA 3C6UB 2FJWA 4EO8A 2W8KA 3PW4A 1S10A 5KFHA 5K14B 4KAIA 3BSAA 4O3NA 1RYRA 2IJNA 3G6XA 3ITHB 4URQU 3QZ8A 5C25B 5CYQB 2VG6B 4J9QA 1JLBA 4Y2CA 4IG0B 3HVWA 1BQNB 1SV5B 5CYMB 2BQ3A 1TVRA 3OHBA 4J9OA 4IRKA 3M9NB 1RYSA 1U09A 4ZP7A 5F8HA 3NAIA 5KFDA 3M9MB 3BQ2A 4URGA 3H5UA 4FS2A 3NBPA 3CJ2A 5F8GA 4IH7A 4PWDB 4MIAA 5J1EB 1N6QB 1J5OB 5KFYA 2FVPA 4YQWA 4IKAA 2XGQA 1JX4A 4IFVB 2B5JA 3DLGB 4KBIA 3Q8QB 3OLAA 1KHWA 5KFGA 3DYAA 2IA6A 2OPQB 1JKHA 1S9EA 2V9WA 1UWBA 2WOMB 1W25A 3PW5A 2VA3A 1JLAB 3IGNA 5HP1A 2UUTA 3LP2B 3KK2B 4KFBA 3TVKA 2FLLA 5J2MB 1MU2A 4ZHRA 3Q8RB 1D1UA 1JIHA 1IKWB 4ZP6A 4WFYA 1MMLA 2W9CB 3M8QB 5KG5A 1N4LA 1C1CA 3KK1B 5KG0A 1RT1A 1QUVA 2D3UA 3PW7A 5F8LA 2C22A 5JXSA 3D5MA 5I42B 3GV7B 1S48A 3CJ0A 4QWBA 3BGRA 5J2QB 3NAHA 1RTIA 3MECB 3IGVA 2V4QA 4I7FB 2XC9A 3MEEB 4NYZA 3MR5A 1VRTB 4WZMA 4R0EA 1HMVA 4I2QA 1S6QB 3QLHA 4KKOA 1TP7A 5L9XA 2HNZB 3EPGA 5HBMA 4I2PA 2XWYA 4RNNA 4TXSA 3MR6A 4U7CA 4Q45A 2FVCA 3QIDA 2UVWA 4KKOB 3QLHB 5J2MA 3DOLB 3MF5A 1T05B 1BQMA 5L1LA 4J9NA 2C28A 3LP2A 5KFRA 3Q8SB 3M9OB 4K50A 4NLXA 5KT3A 2UVRA 1JLGB 4H4MB 3BGRB 4TQRA 1HQEA 1JLEB 4KSEB 5DLFA 1T3NA 4XPEA 3LALA 5EDWA 3OSNA 2ZD1A 2ASJA 4ZPBA 4WFXA 5L1KA 1D0EA 3BSCA 1HARA 4MKBA 3NBPB 1IKXA 3DRRB 4RNHA 5KFAA 1IKWA 5KG7A 4IRCA 1OS5A 2RF2B 4JV2A 4DL6A 4YMEA 2YKMB 4MK7A 3UDLA 2HWHA 2VG6A 5KFNA 4F4WA 4TLRA 5T14A 3H4BA 2BRLA 5K14A 2VG5B 1C1BA 1HNIB 4ECTA 5F8MA 4ECZA 4R8UB 2OPSA 1RT2B 3KLHB 3OHAA 3DM2B 3KOAA 4LSLA 4DG1B 4KV8A 4GC7A 4EEYA 1ZTTA 4EYIB 5EWEA 1S1WA 3KK3A 1C0TB 3QGHA 5CYMA 3T5KA 4WZQA 4NCGB 2D3ZA 1RTHA 2YNGB 4K4VA 3LP0B 5KG4A 1K1QA 3KHGA 1IKVB 4GC6A 3ITHA 2I1RA 3KNAA 2IC3B 1JLFA 3TAMA 5HLFB 5KT6A 4JV1A 3DI6B 3DRSB 4O4GA 1RT4A 3LP0A 3G86A 2XCPA 2CKWA 2YKMA 4NCGA 5EUHA 4WE1B 1FK9B 4RW9A 2R2UA 2YNFB 3CO9A 2E9ZA 4DL7A 4Q44A 1QE1A 4ZPAA 3NMAA 2R8IA 4ED3A 2IAJB 3V6JA 1T03B 4MFBB 3KHHA 3MTKA 2QV6A 3IS9A 3PZPA 4K4TA 1C0UA 4LSNB 4RW6A 2C2RA 1JLCB 3T5HA 3DRPA 2I5JB 1I6JA 5KFBA 5KFEA 4PQUB 4J9PA 3NL0A 1S1UB 4Y3CA 3FQKA 4ECYA 1RAJA 2JC1A 4HYKA 2IM3A 1RTJB 4RW7B 3OL8A 1BQMB 1TKTB 4O3PA 3KHRA 1RT3A 4NLSA 1KLMA 3RAQA 2GIQA 4Q0BB 3I0SA 1Z4UA 2UVVA 1TKXB 2ZE2B 2FVRA 3DRRA 5KFOA 4YR2A 4F4XA 3T5JA 3IRXA 2GC8A 2ASLA 2CJQA 2RKIA 2BANB 4EYHB 3T19A 4J9SA 2AX0A 2JEFA 1RT7A 3CJ3A 1JLEA 1HQEB 4QW8A 3NKYA 1EETA 1JLGA 4H4MA 3H59A 4QW9A 1DTQA 1LW2A 3Q8PB 4K4SA 3H5YA 5C42A 1RT7B 3HKWA 2IBKA 4O3OA 5J2PA 3DOLA 2FJXA 2RKIB 2AQ4A 2YKNB 5F9NA 4KHRA 5KG3A 2IJFA 3MEDB 3BSNA 4R5PB 3I0SB 3GV8B 1S1XB 1MU2B 1RT3B 3H2LA 3FDSA 3G6YA 3QGIA 2E9TA 3FFIB 1VRTA 4RW7A 1RTJA 4RW8A 5KFWA 1JLAA 3DOKA 2RDIA 4QPXA 1NHUA 1UWBB 4J9MA 1S1UA 1S1TA 5DLGA 4Q8EA 4ICLA 1NHVA 1XR6A 4PQUA 4O3QA 2DPJA 2W9AA 3DLGA 3PR4A 1JLCA 3JYTA 2R2SA 1R0AA 2BANA 2BQRA 5KFTA 3UPFA 4YR3A 1C1CB 1TV6A 4ZVEA 4ECQA 2IAJA 4F4ZA 3H4DA 5KG1A 4LQ3A 4RUCA 4Q0BA 1JLQA 4K4XA 1EP4A 4ZHRB 2F8EX 2D41A 5KT7A 3OL9A 1XR7A 2ATLA 1FK9A 4RW9B 4ZPCA 4ZMMA 3KHLA 4K4ZA 2WONA 2VG7A 4TY8B 2WOMA 3OL6A 5KG6A 1REVA 5C24A 5F8IA 2E9RX 3CJ5A 2OPQA 1NNDA 1FKOA 3V4IB 5C5JA 3GIJA 2B5JB 3HVTB 3RB4A 4G3IA 2XI2A 4F4YA 3CJ4A 3RB3A 5FDLA 5J1EA 1J5OA 4RNFA 3IS9B 3LP1A 4IFYB 3N6MA 1S1VA 3KLVA
chains in the Genus database with same CATH superfamily
5GAGU 1RZMA 2AGOA 3AY0A 4Q43A 2PI5A 2XMUA 3PNIA 1C0TA 1Y3JA 3GJQB 4JI3F 4ERDA 2FDNA 4OZLA 3QT5A 3KLFB 2IMWP 1WORA 2XZWA 2NR0A 3KLFA 2WVBA 2H5EA 1Q8BA 3D0HE 3DLLQ 1YJRA 1DTTA 4RNOA 4ED7A 2HMIB 2GGPB 3R5CA 2HNDB 1P9YA 4CYUB 2EK6A 4KPYA 3R1HA 4R8UA 4ZPWR 3CTRA 2FJVA 2UUWA 2IIHA 3OR2B 2XS7A 2YWFA 3HVAA 3MUTP 2O66A 2FJAB 3MM5A 3WIUA 1FNOA 2IYIA 3LANA 3KWMA 4PG8A 1HPZA 2FHKA 1FDAA 5B0CA 3HHNB 1PBAA 1RADB 4I1TA 3OW2R 1VQ5S 2DHXA 4WFBQ 1EKSA 2M8DB 4E2FB 5I3PA 2VPWB 2DIUA 1RAEB 4KV8B 4CQ1A 2F8MA 3TNVA 1VQKS 5K9FA 1VRUA 4ZCMA 3V81B 1LXJA 4FF2A 5ETMA 2R8HA 4DQIA 4Z37A 1S5ZA 2P6TA 1GXTA 4KGKA 3TJ8A 5ITHA 3IR7B 2JVOA 3RRHA 2AGQA 1ZAVA 3PDNA 4F7VA 2HZAA 4FXVA 4TQSA 1JB0C 1R6VA 3I4HX 3NWRA 1VR6A 4OL8A 3H5XA 3C6TB 2M8HA 1IN0A 4IR1A 4CLYA 1IKYA 3PYGA 3SDEA 1T0TV 4WYWA 4PR6A 1R0CB 4I64A 4ECQA 3FJ2A 1D8ZA 4Y00A 3BQ0A 4R5PA 3AA8A 5CCMA 2M88A 3ZZOA 1X0PA 2R42A 2UP1A 2HQDA 5HBMB 4BDPA 3G82A 5DETA 5M2RA 3GQCA 1E6VB 4NWBA 3KLEB 5L1IA 4CM0A 1MNEA 4K2XA 2D9OA 3R3TA 5F41A 4IDKB 2G13A 1WG4A 1P1LA 1TZ0A 3KDOA 4IDKA 1AUDA 1KKHA 4X4RA 1BWVA 5EHHA 2FB0A 3M8PB 4LFAJ 5CYJA 2GJFA 1OYDA 3GIMA 2KZMA 2AZ1A 2V0NA 2P5VA 1S1XA 3N6LA 4AXIA 2KHCA 3DFEA 3FQLA 3TA2A 2BJ8A 2COLA 1CQNA 1LK5A 4CNYA 2NXCA 3GP9A 4ER8A 1U1NA 2JDJA 4DPTA 3QO9A 4QWDA 4X66F 2WRMA 2R8JA 2DJWA 4DV2J 4WBFA 1IKYB 3T1AA 2BKOA 2MKHA 3CDEA 3HCXA 3R5AA 5KOWA 1YJNS 2OJ3A 2RB7A 3MECA 2Z2ZA 1XNQF 1WI6A 3BZQA 3DHXA 1NKEA 4JUZA 2UXBJ 3MD1A 2HK2A 4P73A 3T1YF 2V8DA 1YHQS 1UVIA 1Y10A 4B3RF 5L1JA 3C8YA 2LLZA 1FT8A 3DCAA 2E7WA 4ES2A 1QAYA 4ZIVA 3W61A 4K4YA 3RB0A 1VHFA 3RRGA 4FF4A 2B56A 1LW0B 3CJRA 5A8RA 3WZ0A 7AT1B 2ZOFA 4DV4J 3V6DB 1NB2A 4V19J 2O3DA 2YNFA 1FE0A 4F4AA 1SQEA 3P5BP 1R89A 4M8LA 3FKBA 4UW2A 3TX8A 2MZ1A 4OZ5A 3DI6A 3DRSA 1IM4A 1T9UA 3ZZZA 4ES1A 4DV7J 2EC0A 2XMTA 1YVFA 4NLWA 2NXEA 5A0YA 3DLEB 4DZ6A 3IG1B 5HMYA 2XCAA 2B6AB 1UPPA 4DZDA 1N32J 4URSA 4B17A 4YY3J 2FZCB 3W2WB 2WB4A 3WX4A 1TL7A 5IS2A 2HWIA 1IWAA 2R4FA 1Y0HA 3I0RB 4ENOA 2V4JA 4ZK7M 1HWLA 2PN6A 1N56A 1HNZF 4LRFA 1U26A 3OPKA 4U6PA 4UOHA 2UXDF 2Y9HA 2XMJA 3UFCX 2WHOA 2LXFA 2RH3A 4JI7F 1YGYA 3M8YA 4PUOA 1LWFB 4B9NA 5CYQA 2PT0A 5HSPA 4DCJB 4Q8FA 3DNCA 2DNPA 4CWBA 2MHNA 3C46A 2OLWA 3QRQA 2FVSA 3NMRA 3AB4B 1HYSB 3GYNA 2DR8A 3DLKA 4QIEA 3G96A 2YNGA 2G4BA 2IDEA 2HAIA 3PJWA 2CG8A 4IG3A 5H9FK 2AW0A 3TRGA 4HHHA 5AE1A 5LT5A 1KTVA 5CCLA 2QGFB 3SV4A 1UMJA 2VB6A 3UD4P 3FRZA 4FNHA 4ZVPB 1K8AT 3MUVP 4RLEA 2E5JA 2EFNA 2AWZA 1F2HA 4OI1A 4X4VA 2LXUA 2AJ4A 2RIJA 3PO5A 1Y5LB 1HWIA 3V6KA 1REVB 1RT5B 2RQMA 2ZBIA 3JTNA 4NLPA 2BEFA 1LWEB 5JUMA 2J6TA 1FD8A 1GMUA 1KRPA 2O67A 1TL1A 1RA7A 5SUHA 4K0KF 1I51B 1WHWA 2ALYB 2GIFA 2UXBF 1R8BA 5A8WA 3RRKA 2MQ8A 1HR0F 1JLQB 3EGVA 3JSRA 1SC3B 4DV2F 4QWCA 4YUDA 2CJKA 3MAHA 2J76E 4MKYA 1WHYA 3FCWA 3KJNB 2OI2A 4P2SA 3JAMY 1TUVA 2YX4A 1V5VA 2V8HA 2MLYA 1RJJA 2CADA 3SSRA 3NNHA 3V2UC 2HW3A 3HULA 2QX0A 4PABA 1RTIB 1OY9A 1CJVA 2HQFA 1WC6A 3SQOP 3IM9A 4Y28C 5I42A 2QL7B 2I6WA 1P8GA 4Y34A 4N41A 2NXJA 2OMLA 3ISNC 2HRTA 4OYXA 4JI2J 3RR8A 2C2ZB 3HHLC 3JSBA 1WEZA 5DQHA 1V6HA 2W01A 4DPYA 3RJMB 2AYBA 3J81j 2EFQA 4DCPB 2ZH2A 3MPWA 5AXKA 2YKNA 4R0JA 3FSIA 1C4CA 2HKEA 3CE8A 4F3QA 4ECRA 3ENAA 4NX9A 1TL1B 3IBFB 3PJXA 4M1KA 2R7UA 4ANDA 1UZHA 3MCOA 3TO8A 4HTJA 1M5HA 1U8SA 2HYIB 5DGBA 3GFZA 2N7YA 3PHTA 1WSVA 2AX1A 3EVMA 4FYXB 4A46A 1TAQA 4DQPA 1IXKA 4RW6B 4X84A 1CBKA 2V2VA 1S76D 4MFBA 4GO7X 5B0DA 3G8QA 3CIZA 4LF4J 2ZKUA 2ZE2A 5A6WA 1A0OB 2VJUA 3T1YJ 4OYPA 5HVFA 4DL5A 4DR2J 3JXOA 2BQUA 4ELVA 1YRUA 3GTYX 2MGZB 1SIWB 3MM9B 4LFCJ 1RHQB 2DB1A 1H6KX 4C97A 2LU1A 2NPIA 5KT5A 1NKBA 4DPOA 2JC0A 2MSSA 3QWPA 3MEGA 5E3PA 2CQGA 1MW7A 1X4CA 2E1PA 5A2QU 2CNOB 3DDNA 1HNVA 1NXIA 4CO0A 4FVCA 3A3OB 1SKUB 1T9TA 2KI2A 4IOBA 5CZXA 5BYRA 2LMIA 3SSSA 4AUKA 5ADZA 4YFUA 4DF8A 4UOGA 2OKQA 2UVUA 3LUYA 5L9NA 1FA0A 2GZOA 3GFXA 4USHA 3TZXA 1TVRB 3MUMP 2CYYA 5A8KB 2OO4A 5I3UB 1RWUA 1GTHA 3J81Y 4KGZB 3V6HA 2FC9A 3KLHA 4DSJA 1KQFB 4NCAA 4DV3F 2MEWA 4CDIA 1S9GB 4O4GB 1ZAXA 2B6AA 2BXJA 2FJWA 1DURA 2Z58B 4PXCA 5K14B 2WAQD 2E5GA 4OJ1A 4USWA 3G6XA 2HHVA 2OEMA 4URQU 4MYUA 5C25B 2DNZA 2AYMA 3QAEA 3TA0A 4U7UK 1RAIB 3W65A 1Q4RA 3SV3A 4L76A 3THTA 1NZ8A 1HNZJ 4DU8A 3K89A 5CYMB 3MMAB 1CPZA 1R7IA 1D9FA 3MMBA 1SQGA 1UAWA 3M9NB 3TZWA 1U09A 2JLGA 5KFDA 5EX0A 3BQ2A 5HATA 1N32F 4DN0A 3HJFA 1U7LA 2PFDA 3D0GE 3DRXA 4ZPTR 1SL2A 3ZTQA 2BVZA 2ADCA 4Y6IA 4LR7A 3C16A 5J1EB 1N6QB 4FXDA 2KH9A 2U2FA 4IKAA 3DHWC 4IFVB 1Y4ZB 3DLGB 3OLAA 3DYAA 1QD1A 1WHXA 1S9EA 2WOMB 1J2VA 3G4SS 3PW5A 2QLFB 3PKYA 2QEXS 4KH1B 4P2MA 3LP2B 1TKDA 3KK2B 1HWKA 3TVKA 2FLLA 5J2MB 2FUG9 3D9BA 3J7Z5 4DS5A 1IKWB 1OY8A 4HI2A 5CA5A 3M8QB 1NPKA 2CG4A 3SEOA 2R7RA 4Z2XA 3GFYA 3T41A 2ZOGA 3ZZTA 2F3JA 2HFVA 2VH7A 4P7VA 4UF4A 4BHQA 5F8LA 2ACYA 2A2CA 3GV7B 4USMA 5LMUJ 3CJ0A 1FF2A 3L95X 1NK0A 4N7TA 2J0XA 1T3OA 1RTIA 2H5JB 3IGVA 2KXNB 2ZC3A 4UZBA 1HHTP 4CT8A 4WZMA 4R0EA 4I2QA 3GR1A 1S6QB 4FKYA 2AEFA 4KKOA 5IWAJ 4DSEA 3G82B 1NJXA 2NYHA 5HBMA 3FEYB 2JLFA 2XWYA 2ZBQA 3AD7C 4RNNA 3MR6A 1VC0A 4U7CA 3M2RB 3R6GB 1S7HA 1FTCA 3MM8B 1NDPA 2L9NA 2M70A 2VBZA 4RKUC 1SC4B 4USTA 3HX9A 5GMDA 1B70B 2RRBA 1KQKA 5L1LA 3MOJB 1REGX 1T02A 1V3SA 2MY7A 2HK3A 1QLNA 3J7AN 2C3OA 2UVRA 2RHQB 1JLGB 4A8SA 2E5LJ 2VQFF 4TQRA 1HQEA 1X31C 2CJBA 3W1YC 1H74A 1T3NA 4CO2A 4M5DB 3PYDA 4F2RA 3P5TL 2ASJA 1A6LA 1OPIA 3UD5A 1RHUB 4WFXA 5M2UA 5L1KA 3F0NA 3BSCA 1LK7A 3PX0A 1VCTA 2ZH3A 4C7QA 4LRCA 3CJQA 4RNHA 1D9DA 3BGOP 1PBUA 3DKDA 5LMUF 1RWKB 1XBWA 4IYQA 5ETPA 3MMAA 1JJHA 4YMEA 1RU2A 2EG2A 4MK7A 1NHKL 4JBCA 1EX8A 3AH6A 4OHZA 5KFNA 4J5OA 3HF5A 4WU2A 1VK3A 1BD6A 2MQLA 2C1EB 2BRLA 3EXYA 1SJ1A 3OR1B 3MHYA 1RLCL 2LKZA 3PEHA 3D6FB 1OSDA 2XTJP 4LBHA 1CULB 2XO6A 4ECTA 1XN9A 2DHAA 4OI3A 2ZVIA 3T9ZA 4EU0A 4H4KC 1RT2B 4WCEQ 4ED2A 2IY5B 8ATCB 4OZ3A 2YKPA 2XSJB 5GVQA 2PMWA 2OD6A 5A8KA 4GC7A 3VAKA 1RWMB 3BPSP 2H4YB 1ZTTA 2HGNA 4LF5J 1N88A 3DU6A 2Y1IA 2AYEA 3BYPA 4WZQA 3A1YG 5ETOA 1X9WA 1VC6A 3SZ2A 2XS2A 1T7PA 4QU6A 2ZNZA 3PY8A 5KG4A 1M1KT 1K1QA 2X1GA 4LF9F 4LFBF 1NMEB 5LMNF 2GMLA 5CQGA 5K8OA 5HLFB 2AMCB 2MJNA 4NZ6A 4DSIA 4JV1A 1HI8A 3G86A 1I94F 1UVMA 3FZBA 4CM2A 2CKWA 2KYXA 2YKMA 4NCGA 4DU7A 3ZXWA 1FK9B 1KONA 3CF5Q 1U1MA 2YWHA 2FPHX 1H3DA 2FGOA 2GA7A 4KHPJ 1Q1KA 3NMAA 2R7XA 5E33A 2IAJB 3VAGA 2RNEA 3V6JA 2UUBJ 1G2EA 2FC8A 4MFBB 1UVNA 3TEGA 1FE4A 2QV6A 1F5CA 4PYDA 3PZPA 2X1AA 1D9AA 1SC6A 3TP2A 4OIXA 3BN7A 1JLCB 3T5HA 1XC9A 1NLKL 1X9MA 2UXCF 2LQ5A 4M5NA 4AQYF 4PQUB 3FEZA 5HQ8A 4M5IA 2DGTA 1SI9A 1YITS 4BBYA 2QLJB 4Y3CA 3CCJS 1RAJA 1F3VA 4OX7A 1B64A 5T7LB 4JI5F 1V5IB 3M05A 3KHRA 3H20A 3RAQA 2W4CA 3M6WA 3R8YA 2CWXA 3D3CJ 4TNOA 2FVRA 1Q53A 2V8PA 3MPDA 2F5GA 1HA1A 3NY0A 1FRIA 4QQBA 3KKFA 3BEGB 5KFOA 4C8OA 3IRXA 4NMLA 1YJWS 2UUBF 2RKIA 3T19A 2AX0A 2ZH5A 3ETOA 3NS5A 1WTBA 1SJ4P 2KXHA 2ZVSA 1LWXA 4QJVA 1HQEB 4QW8A 2QRRA 3H59A 2DISA 2KG0A 2VOOA 1EKRA 1LW2A 3OBIA 3O1LA 1FDBA 1WC4A 4B3TJ 2KG1A 4USVA 5J2PA 1XERA 2GHVC 3DOLA 3QGPA 4A8FA 3P49B 4ES3A 4ZKAA 4C9DA 1WOOA 5F9NA 4L74A 2IJFA 2OAUA 2DRBA 2V63A 2HHPA 1VLYA 4A8QA 2IMOA 1FRKA 3G6ES 4AD6A 4J91A 1N52B 3SCKE 3QAUA 2KT2A 3H2LA 3QGIA 2CQPA 3FFIB 1VRTA 3NOGA 3F41A 4NCBA 2RDIA 1UWBB 1H7WA 2NXNA 2V8VA 5GAEU 3T3FA 1VQOS 2Q79A 2AD9A 2KVIA 2PEHA 4M5GA 4BS2A 2E1CA 4GKJF 2PA8D 4DX7A 3QFHA 2CAJA 4C3LA 4JI4J 2A1BA 2B4UA 3C16B 4N47A 2JFDA 3SSQA 5KFTA 5K20B 1B99A 4WK3A 1C1CB 4YR3A 1PIEA 1T8EA 2FY1A 4JI8F 2HS4A 3H4DA 3IXQA 3CNQP 4OJ3A 1K0VA 2MYFA 3GJSB 3VCDA 1MLAA 1CS4B 4PPDA 4USKA 2YWEA 4ID8A 4CO3A 3M8RA 1FK9A 2VG7A 1H2TZ 2BE7D 4P75A 4CO4A 3OL6A 2ZH8A 3H2VE 2IVMA 3TAPA 2ZBCA 2ZEJA 2NSCA 3L3CA 5C5JA 2NCKL 2YTCA 2LYVA 2OUGA 3SXLA 3KG0A 2BZ2A 1X5SA 2DRDA 5J1EA 3LP1A 3N6MA 3THPA 2HVZA 3R7BB 3GPAA 2VICA 1LFWA 3OLBA 3KNGA 2A2DA 4TYAA 1XWLA 3W2VB 3Q8UA 5DM6Q 3HT3A 2A6MA 2QJ3A 2R7QA 4I0WA 2W1BA 2RQCA 2F9JA 2IVYA 2QA4G 2BR0A 1SUQB 1APSA 3CDUA 4RBTA 4WE1A 2YNIA 4MH8A 2NS1B 4RUAA 2IHR1 1SQFA 1JLBB 2HS3A 5D0RA 5LMNJ 4IFYA 3M2VA 3W5ZA 3V5RA 3DLHA 1NPPA 5C25A 3KFWX 3IG1A 2OFGX 1LWCA 2EKYA 1RT6B 1YBTA 4MIBA 1NU4A 3SI8A 1RKJA 4XDCA 1RHMB 2B9WA 1UEKA 3HHLB 4WWSA 5CZVA 3Q2TC 3MCMA 7FDRA 1FXLA 1VQ7S 4ZP8A 2AF6A 4DQSA 2P9EA 4UQTA 1NK8A 5FD1A 2Q66A 1ROFA 4PKDB 3D6HB 7FD1A 1MWQA 3EGNA 4ID5A 1SH3A 4U95A 5DQGA 1PO6A 4I67A 5IT9Y 3D1HA 4WPAA 1N5YB 3OFGA 4GVLA 3BSOA 2XMMA 3LP1B 5E41A 4FYWB 1FDNA 3ZZRA 1S9FA 5KFZA 2RVJA 2Y1RI 2AJ1A 3EZOA 3RUBL 4LIWA 5GAHU 1KC8T 3TA1A 3EX7B 4C8MA 2B9XA 2OPRB 3VQTA 3W62A 4ECWA 1ZS6A 2ZHAA 2FZGB 3CCQS 4WXOA 1ZZNA 4N76A 2D9PA 4NOHA 3CPWR 2VOPA 1QSSA 4DR5J 4ECSA 3GR0A 3HM9A 3EGZA 5MAOA 4YY3F 2JSXA 2XGPA 1AT1B 2QA2A 4ZOSA 2WW8A 4EBEA 5ETVA 4BCAA 2RAQA 3KMSA 4LVOP 4DV7F 4O3SA 2NXUA 5GAHI 3MR3A 3DMJA 4ZN3A 4IRDA 2JOQA 1M0SA 4B3OB 2O1PA 4DBQA 5B09A 2IPOB 2DO4A 2KZZA 2DTJA 2W9BB 1U1LA 4WKYA 3G8TA 1TAUA 1U0HB 3H2UB 1DLOB 3PW2A 4G1PA 4FZVA 3A3NB 4C0OC 1HHSA 1HD1A 1Z1ZA 3D4JA 2E7XA 3GIKA 4DR6J 1T05A 2ZUGA 4XTTA 1QAJA 1E6VA 1VYAA 3D54A 2J9CA 4OI4A 3KUGA 1DQ9A 2QA4S 2VHGA 5FJ4A 2W9CA 1WKLA 3G6VA 2J6UA 1T94A 3UNYA 1Q7YT 1XNQJ 1ELOA 3EM1A 2LEBA 1V9OA 1MMNA 1WEYA 4KFBB 1XIQA 3BKFA 2MZSA 1CJTA 3I96A 1RHJB 2CQIA 2CPEA 3SDEB 5K8NA 1CQMA 5KFCA 1WEXA 1M5VC 3I5AA 1LW2B 2JRSA 3C15A 2LEPA 2GAGC 1E6YB 2QLBB 1TL3B 1GT8A 3O8WA 5KFSA 4RR5A 1X60A 4C11B 3AXMA 3M8SA 1SKRA 3LAKA 4WIQA 2I5JA 2VV5A 4IFVA 3H40A 4DV6J 1VQ4S 1HHQA 3GB0A 1A7GE 2HQ3A 2KFZA 4FS1A 1FD2A 2RRNA 1T03A 3MFHA 1RCOB 2YNHB 4PG4A 2ZHOA 4KO0B 2G2OA 4YHHF 5IT0A 3WIVA 4RUHA 4QWAA 1EIYB 4PEOA 1CSJA 3KK2A 5T7LA 3UQSA 4DL0C 2FGCA 3CMAS 2MY8A 2J0QD 4HT7A 3LAMA 4ETZA 5CABA 3EZ5A 3NGKA 1RSCA 3M30A 1RA6A 1JKHB 2IFXA 2QG9B 2CPZA 4ED0A 2CQDA 2UU9J 1FWLA 3PIPQ 4O3RA 5F8NA 5B08A 3HSJA 3C6UA 2OIHA 1KDNA 1T9WA 3UE2A 5AXNA 5D3GB 3CDAA 4AL5A 3R1LA 2EKNA 4QIVA 4G1QB 2JEJA 1XR5A 3IBCB 4LR8A 2GGPA 2CVEA 2FLPA 4J9LA 1A9NB 1ACMB 1Y5IB 1YWXA 1VQSA 2PGCA 4O4RA 1U1KA 3NXZA 3CCTA 1S0OA 2CPFA 2QSFA 2J5AA 3ADAC 4I68A 4WP8A 3VVUA 5IM0A 1C4AA 2W7PA 3CUNA 4P6QA 3OTOJ 5HROB 3CT9A 1NJWA 1EZZB 1J5EF 2H4WB 4HKQA 3W2WA 3DLKB 1N54B 3NG8A 3CDBA 2HNYB 1CULA 5DS7A 2K2PA 4FYVB 4KGMA 3BGLA 1HNVB 1KVJA 1KQGB 1PJ5A 2PO4A 1LWCB 1GMVA 1OSCA 3HZGA 1FKOB 3G87A 3QMQA 4Z7YA 5EX3A 1IKVA 3AD9C 3CULA 5C24B 2D3O1 1SXLA 1X4DA 3RBEA 2DGVA 3SFUA 3H42A 4ZN1A 3CC4S 4TY8A 5HI7A 1U2CA 4DLEA 3DRYA 2HIQA 4HACB 1IJFB 1H98A 3TVZA 2DR9A 3JQKA 3E3XA 2FVQA 1Q0NA 1AZSB 4YB7A 1VQPS 2QN6B 2OGUA 3PHEA 3AT1B 4CNZA 3CD6S 2G1DA 3TJ9A 3EXCX 1DJ0A 3N01A 5A76A 2DGUA 4QYRA 4ICLB 2EK1A 4I6WA 3UR0A 5KFJA 4NLYA 1FXDA 4XAKA 5F3TA 2M52A 2YWGA 5LJ5Y 2N82B 2VG7B 1X4AA 2NUUG 3IBWA 5HQMA 4GVBB 3KLIA 1UEUA 4MKAA 3DGVA 4ZVHA 2YH1A 5AXLA 2MLXA 1IBMJ 1AYEA 2VC1A 1Q8KA 4OV6A 5KFKA 1KLNA 4OZ0A 4RU9A 3RBXA 2CQ1A 4DL4A 2H51B 8AT1B 3BV8A 4ELTA 4XO0A 3PKMA 4X2BA 1RP5A 3ZFVA 3A8KA 3H5SA 1WSRA 2P8IA 5ETTA 5J1PA 2DKOB 4NI2A 3GWCA 4J9KA 3M8PA 2F8HA 5C42B 3BO3A 1X5PA 3IWNC 4EBCA 1G4CA 2ZNYA 5EWGA 1S6PB 3EWGA 1B0VA 1DLOA 1JXEA 2WB1D 2CDRB 2DNLA 5HK4A 3FCHA 2AU0A 4FBTA 3NNCA 2XO7A 1SKSA 1IQZA 4DV1J 1NDKA 3EDQB 3NRBA 4U67Q 5K8PA 1PC4A 3OFEA 4ED5A 4JI4F 6FD1A 3IRXB 1X4EA 2E1MC 2X7IA 4HI1A 4WIIA 2PC6A 2DRAA 1FERA 3HVRA 1AFIA 4A8WA 1RAOA 1ZBTA 4JI7J 2H65B 1I3OB 2CPJA 2BM0A 2XZDB 3DOMA 5E2QA 1LKZA 1HMVB 4WYLA 1TKTA 5GADU 5AJ3J 1DQAA 3IFEA 2CQ4A 1LWEA 4CTAB 4NLTA 4HL9A 2CNLB 2VBXA 4FBUA 4P52A 4OX8A 1S6PA 2HHHF 4JI2F 2NSBA 3OTCA 1FRJA 4ILLA 1AXQA 2WVFA 4KQZA 3KLEA 4OYBA 1R43A 3KK1A 1PILA 1Q16B 4CO5A 5HJYA 1HR0J 4AYBD 2ZH9A 1IBKF 2GIRA 4ZS6A 1ZPVA 3E01B 4FNIA 3MMBB 4OMFG 2QIFA 4IO1A 3CMES 3ZNJ1 4GVBA 1BQNA 1SV5A 4IG0A 1Q95G 1XQIA 2HS0A 1ZH5A 3VALA 3IRWP 1NM2A 5IV4A 3MPVA 2O01C 3IMQJ 4FXWA 3TWZA 4RZRA 1W2BR 5I4MA 1IBMF 2HSEB 3TAMB 1CVJA 1QAIA 2QMWA 2RUGA 2GO8A 3K2YA 4NRUA 2R7OA 2A6OA 2RS2A 2MQPA 3NGDA 1FVQA 1UA0A 2XHWA 4ECVA 2WTFA 1H0HB 3GJRB 1MROA 3I56S 2OMOA 2ASDA 2LQ9A 1SUQA 2E1AA 3KUEA 3UW1A 3MM6B 2B3TB 1GXUA 1GXLA 3FUYA 3MPYA 1FRMA 3RYLA 2LXIA 3OTBA 3UDVA 1FEEA 1S0NA 4OHVA 2DPIA 2DH8A 4JV5J 4KE5A 3C6UB 1IR0A 1KOOA 2Z30B 4ZVUB 1F0XA 2DBBA 5L39A 3I87A 2JWNA 4PCQA 3PO4A 2JZ5A 3OFFA 2WBMA 2AJ0A 4CIOA 1P9QC 3G2XA 3ULHA 5DLFA 1DARA 3I4PA 2FIUA 4J9QA 4Y2CA 5KOXA 3MURP 1WELA 2CPDA 2VDIA 1BQNB 1SV5B 3BBFA 3F56A 5CXTA 2PEBA 3IR5B 4IRKA 1RYSA 3PG9A 2VFVA 2A10A 2Z2LA 4NMXA 1H72C 4ZP7A 1RLDA 5DDRC 1P1TA 1Z2LA 2IDLA 3H5UA 3D7SB 3QRPA 1X4BA 3UDEA 2IRUA 4F25A 1J5EJ 4IH7A 1TL7B 3CD5A 5AJ3F 3US5A 1J5OB 1B0PA 1VFJA 1IM6A 2FVPA 4YQWA 3K5NA 1JX4A 3VGTA 4F0HA 2B5JA 2EFVA 4KBIA 2IA6A 5KFGA 1IUJA 1QTNB 2CJAA 1XTZA 1V3RA 2BJEA 2CPIA 1NUEA 3HD1A 4ZVQB 3SCIE 3OJSA 1UWBA 1JLAB 3IGNA 5HP1A 2Z2YB 3D3BJ 4BLGA 4DSFA 3LPEA 2HQIA 5B0AA 2PMZD 1MU2A 4ZHRA 1I5OB 2VC0A 5A8RB 1L3UA 5B0FA 1KOHA 2BYCA 2NQPA 4X62J 3BKUA 3IO1A 1N4LA 4DJBA 3KK1B 3O3LA 1RT1A 1QUVA 2Y1LB 3ZZUA 2DH7A 3AJDA 4RL1A 3DN9A 1S48A 1WI8A 4E8UA 3MM7A 1NJZA 3NAHA 4L3KA 1B7FA 3OVAA 4RJVA 4U96A 1MSWD 4P74A 2CIMA 2XC9A 3MR5A 2RE1A 4KJIA 3LW5C 2GVDB 1B4SA 2MB0B 1IWGA 3QT6A 2ADBA 2RDDA 3CSKA 1UJ5A 2VPYB 3PTWA 3QQCD 2DGQA 2X3DA 1F9FA 1OPZA 4IQMA 1NO8A 4TXSA 3SQGA 2E5LF 4ZDNA 4PXDA 2UVWA 3MF5A 1WWHA 4HTIA 1XMOJ 1JNRB 2RT3A 3LP2A 4P72A 2BX6A 2KT3A 3Q8SB 3KYLA 3T1HF 2C28A 3QSYB 1TFWA 4HDGA 4UT4A 4K50A 1Q79A 1HBOB 4ZA1A 4XPEA 3VHQA 5EDWA 3PRDA 1RAFB 3Q8YA 1X8DA 5LOQA 1XEZA 4C6AA 3FBFA 1OY6A 1X5OA 2EW9A 1RWWB 4UOFA 1D0EA 1R27B 4NA2A 4PG6A 3K5PA 1HARA 1ZA1B 3R9LA 3NBPB 4NEZA 4NE9C 3QT7A 3MZIA 3EDRB 4B9LA 3AHPA 1IKWA 2XULA 5RUBA 1KSPA 3W3SA 2RJZA 4WK1A 3VF0B 1RTZA 4F02A 3W9IA 1U1OA 1YJTA 2J7WA 1FFGB 3BS9A 3KDNA 2DVIA 3DLBA 4JV2A 4DX6A 3C66A 4NPOA 1B3TA 3EYZA 2VG6A 1WDTA 2GHPA 4X4QA 2XMAA 4F4WA 4TLRA 1XK8A 4K59A 5T14A 2B7CB 3W7BA 3KJFB 4NA1A 5K14A 1HW9A 3VZIA 2VD3A 3VVTA 4LVNP 1T9YA 4DR5F 1HNIB 2DCUB 3TX0A 1WOPA 3V4MA 3F73A 2OPSA 4MJKA 1VBZA 3KLHB 2FHJD 2VKZG 3DM2B 3OHAA 4DQQA 4Y2IA 4DS4A 3BDPA 3KOAA 4KV8A 2UUAJ 1WUUA 3PFOA 1YBUA 2ZBPA 4DFJA 1YDLA 3ISZA 1S1WA 4Y65A 1S99A 3KK3A 1C0TB 4KR0B 5EWEA 3GYGA 2DEJA 2D3ZA 4WJBA 2YNGB 1IKVB 4XIUA 3TAMA 2W4PA 2UZAA 4IO9Q 4UY85 3PCOB 1ITPA 2DXDA 2AHOB 3HXMA 3CW2C 3BM7A 5DRKA 4WE1B 4RW9A 1ZZFA 3AD8C 5B0EA 3M2UA 2E9ZA 3PYFA 5D77A 4E98A 1LFPA 1UA1A 1KNZA 5CH7B 2LVWA 3I82A 3MCNA 1T03B 4CLKA 1H38A 3KHHA 2B4PA 1EJ7L 1ZM2A 2POKA 4K4TA 1N34J 3FVYA 2HHTA 1YJUA 1C0UA 4LSNB 2RU3A 1ZA2B 3N9UC 1N34F 2MKYA 3DRPA 1UWAA 4NYOA 5CAAA 5KFBA 5KFEA 2HVHA 1ZM3A 3X3UA 3I32A 4J9PA 1YSJA 1VMBA 1FNMA 2G1HA 2XHCA 3C15B 2MJUA 2QC3A 4P10A 3T9NA 1T9XA 2JC1A 2N3OA 2IM3A 1RTJB 4RW7B 3OL8A 2Y1JA 1YQHA 4L73A 2XLJA 3HKZD 3AJ1A 4RWWA 2UUCF 3Q22A 4Q0BB 3I0SA 5DDPC 3RR7A 3T1HJ 1UVJA 2UVVA 2ZE2B 3GG1A 3GG0A 2E7VA 4F4XA 5G0RA 4C8ZA 2ALZA 2BANB 2RQKA 4CZCA 1FESA 4J9SA 4EGLA 4ZITA 3U1NA 5LSOA 3CJ3A 3HD2A 1TMJA 2G2YA 3HHDA 1RGVA 1X4HA 2EC2A 1EETA 1JLGA 3NKYA 4DI6A 1H2VZ 3M6UA 3SCJE 2CZ4A 2HRUA 3Q8PB 5HQLA 4DV5F 2VODA 1AW0A 4X64F 2IBKA 3TUIC 2FJXA 2RKIB 3K5LA 1WDDA 1D3WA 1FWPA 1NKCA 1M5OC 1IBLF 2W25A 3AJ2A 5KG3A 1K47A 3MEDB 2G0JA 5LSLA 3BSNA 3WC2A 1FCAA 4N56A 4ZVRB 3LF0A 4CT9A 5H9EJ 1S1XB 2MDAA 1RT3B 2E9TA 2E29A 2ZBRA 3FDSA 3J7YI 3M8ZA 1M90T 1RTJA 4F67A 4QPXA 1NHUA 2CPHA 5HAOA 1S1UA 2BOAA 2JVRA 1S1TA 2ROEA 3IWXA 3GMGA 4F0MA 5DLGA 2DPJA 1H2UX 1BMQB 1CJKA 4RBVA 4LF8J 1VRQC 1AUSL 3S7RA 2DNYA 3AA9A 3R27A 2CZVC 2DNQA 2YQ3A 3UPFA 3Q24A 2BQRA 1NK6A 3HFVA 1TV6A 1EARA 2DGXA 3TW0A 5FLXU 3CCRS 4LQ3A 1YK9A 5KG1A 2GX8A 2EBEA 4OHYA 1HBUA 2D41A 3WBZA 1UEVA 4A8MP 3OL9A 2YKAA 1LV5A 4RW9B 3TUJC 4DR3F 1VC5A 1AB8A 1TL5A 2G0IA 2C3PA 2MQMA 3ET6A 2XB2D 3RGIA 3CJ5A 2DNKA 4DUYJ 3HZEA 4G3IA 3GIJA 3HVTB 4WFNQ 5D4OA 1KN6A 3RB3A 5GMEA 1NH7A 5FDLA 1J5OA 4RNFA 5IQQA 1SJ3P 2BM1A 1S1VA 3KLVA 3P96A 2HMIA 3V81A 2MSTA 3EMTA 1U2RA 5HROA 4ZJLA 1HI1A 4CYUA 2UXCJ 2R2TA 3BREA 4LRDA 1ZOTA 4YB1P 3Q0AA 4DUYF 3BN4A 5E3CA 1Q8IA 2L9DA 2AGPA 4LJMA 3I0RA 3CEDA 2H54B 4RW4A 1SC1B 3KXDA 4MAKA 4DR3J 4WXWA 1XMBA 4ZJOA 1N8RT 2H48B 1U25A 5D3GA 1S6UA 4HDHA 1K1SA 3M7VA 4WTOB 2QFJA 3ZTSA 4QIWD 3W9HA 2BE2A 4XPCA 4ANEA 1S9GA 2B0GA 2XI3A 3GILA 3ENWA 1W2IA 1U24A 5ETLA 3B82A 2ROPA 1RB0A 3BH6B 2H5IB 3I5BA 4DEZA 1I94J 3BO2A 1S1WB 2RF2A 1TMMA 1FRHA 1T9VA 5IM0B 1N48A 1UJ6A 4ECXA 2A0FB 1PSDA 2CFXA 5IFMA 3FK4A 4ZP9A 2Q3PA 2AEJA 2QL9B 2CXEA 2DITA 4AXJA 1KQSR 3O2IA 2YWWA 4LF7J 2HLUA 4YEAA 4ZVSB 1S7IA 4P2XA 4CLLA 3V4IA 4WU3A 4DCOB 1K44A 3W5YA 4NXNJ 1RXOB 1TUGB 1G3OA 1X7VA 2B7BB 2QA1A 2DGOA 2VKRA 1BC6A 1BUXA 2LCWA 4I6AA 3B78A 3GE9A 1JJ4A 4RW8B 3QO9B 5KTQA 4ZPVR 4B3MF 3U1LA 2BKPA 1FVSA 1I1GA 3KG4A 5F9LA 4K4WA 1URNA 3G9CA 2YWKA 5AT1B 2W4DA 4F50A 1FEHA 4PQAA 5DG9A 4YR0A 2BDPA 3PW0A 4DL2A 2V4RA 1Y7PA 4LREA 2ZD1B 1Y11A 1NBEB 3BH7B 3RB6A 1RAGB 3JAMU 1XNRF 2OEKA 2BACA 1CJKB 1JQGA 3QIPA 2OPPA 2OP5A 2BRKA 3D1QA 2R2RA 1E6YA 3QIPB 3TOQA 4C11A 4CTAA 4IQXA 1WG1A 4ZPDA 1VQ9S 3OXLA 4B02A 2QL5B 2K06A 2KB2A 3KG1A 5F3ZA 1F3FA 3QWUA 4NLOA 2MZRA 5HN0A 4O0IA 3MEDA 4ZCLA 2JX2A 2BA9A 5JJBA 4OYOA 4M94A 2HBQB 2ZITA 2KXFA 3BGUA 1RWPB 3VGUA 2I8EA 3QGGA 3MDFA 4RNMA 3NGRA 2Y8WA 3OTEA 1HKAA 2GHWA 1LEOA 2L41A 2D1CA 1CJUA 1EETB 3MFIA 5J2QA 2OPPB 2JLEA 2EWHA 5BR8F 3MEKA 5DM7Q 2DR5A 4ZLJA 4LF6J 2KKHA 3VAFA 1NK4A 3D28A 3E51A 4Q5VA 4F8RA 3K58A 3OT9A 5H1SV 1G1XA 4MYTA 4CLZA 3BQ1A 1IBKJ 4PWDA 1QSLA 2ZZTA 5LM7E 2KN4A 3T6BA 3GV5B 2GO9A 2Z4PA 3AODA 4X4PA 4ID5B 2Q43A 1HI0P 1KLMB 3E8OA 3TQ1A 4LFBJ 3NGSA 1TQLA 5A8WB 4TU9A 5FLXY 3UN2A 2Z0GA 2C2DA 1U47A 1RABB 1Y5NB 4EO6A 4B9UA 2GMHA 3JTOA 1N5QA 2F40A 2RILA 4RX6A 1DQ8A 2F1FA 3QFWA 3TEHB 4CLTA 1NK5A 2R8GA 5HLFA 2CQHA 1YX2A 3THVA 3MR2A 3KMQA 8RUCA 4C3KA 2ATCB 5KG2A 3KJVA 1ZYQA 3LO3A 1ICEB 4ZCIA 3PVXA 1TKZA 2JEIA 1O5JA 4DUTA 3MAQA 2DGWA 2B4OA 2GS8A 1RTHB 2RMLA 1Z2ZA 2HNDA 2MKJA 2V94A 2W24A 3CDWA 4EWTA 2LU2A 4N77A 3C2PA 1DTTB 5D4NA 4OJGA 1BQXA 2NYIA 2LP4A 2HQGA 2MQNA 2QE5A 5DZ6A 2KJVA 1S4FA 4L3NA 1HBMB 4MTPA 2V4JB 1U49A 1HQ2A 3GSDA 3LTOA 4QBUA 2F63A 4DN9A 4IOAQ 1RT2A 3GFHA 2HFOA 4X4NA 3HHEA 2QT7A 1RT4B 3MMJA 2DD8S 2CWKA 1HNIA 2LQ8A 3PJ9A 4I4BA 3IAM9 4FDFA 5KFLA 4X4OA 1NCLA 3HVTA 3JQMA 5DO2A 5EWFA 4H4OB 2DT9A 3WQPA 2J0WA 3UD3P 2KFYA 3JSMA 2BUNA 2JNJA 2QTWA 1C2PA 4AT1B 2HLTA 2DK2A 6AT1B 4K4SA 1F6TA 1BGXT 3S8SA 3KK3B 2EXUA 4MMOA 4CRJA 4KGXB 4MK9A 1WG5A 2I38A 1M1HA 2JJ4D 4H54A 2EFOA 3FBEA 5DG7A 1RK8A 2V8GA 4CH0S 4O44A 4M63A 2RUSA 4KO0A 2XBPA 5CHCB 5MLCV 3C3LA 4LMZA 4DV3J 2D3OR 3JS9A 1YBAA 5HL7Q 1ZETA 1YIJS 4YOEA 3PYEA 1TV6B 3LA0A 2WSEC 5KFUA 1UVKA 3C14B 2DNNA 2OFHX 5IC4B 2I9SA 2KJWA 4KHMA 5D8HB 3HMJG 1SVDA 2VUGA 4YP3A 4X4TA 5IXUA 5KFVA 2HFUA 3K7RA 3DDIA 4HH0A 1TL3A 1KTQA 4RPFA 3QATA 2LA6A 1RDRA 4PG7A 4PAAA 3UO0A 1JXLA 1WKKA 3ZTOA 2K3IA 5BJRA 4QR0A 2ABYA 2DNRA 4IUFA 3V6DA 1FXRA 1KWMA 2LEAA 4LFAF 4DR7J 1FKPA 3RZAA 1N33F 5A2QY 1HQUB 2XZTB 4DXLA 3CCVS 2EG1A 1N5SA 4K4UA 3FMBA 3QJLA 1JJCB 2HNZA 1GX5A 2BABA 3CJKB 2XY6A 2M0GB 1N0UA 2RRAA 1VS3A 2QMXA 3O44A 1D8YA 4C8LA 2ZFHA 3Q23A 1FJEB 1UKUA 4DR2F 4JI1F 2AJ2A 4X62F 4ILRA 3DDKA 4DR4F 5GADI 4USUA 3OUYB 2WVCA 3OTOF 4CLSA 4AE5A 1CG2A 3OUYA 4S0MA 3MXHP 2HGMA 3T5LA 2RDJA 5F8JA 2DCLA 5KFQA 4B3OA 1DZ5A 1S79A 4TY9A 5D0GA 5G0RB 1R8AA 1Y00A 2PE8A 4RUBA 1F9HA 2ROGA 4I2PB 4JI6F 2W7AA 3S6EA 2V2ZA 1HQUA 2CQ2A 1S49A 2DIVA 4W4MA 2HVIA 2NLWA 2KL8A 2D7SA 3UCUP 2W2NP 4OZ1A 4I2QB 3N79A 2V50A 3KLIB 5HP1B 4B3MJ 5D4LA 1GX6A 1RISA 1QVGR 1TK5A 1KHVA 3B4MA 2JFKA 1PGZA 3LGHA 3H98A 4YHHJ 2J9DA 2DEIA 3IP0A 2HZCA 4BWJA 3BF4A 1RT1B 5HMZA 1QVFR 3DMJB 1UCNA 1CC8A 3UDCA 3SFGA 3ICLA 5HMXA 2VFRA 4K7QA 4QR1A 1TKXA 2W7OA 3JQJA 5DQIA 1RUSA 4YS2A 4TU8A 2KO1A 2L08A 2UV8A 4A8KA 1OQ3A 1YJ7A 1HBNB 1M5SA 2NUHA 5KT2A 4L6V3 1YG0A 2V68A 1S12A 2Z56B 3B4DA 3P45B 3C6TA 4FN5A 4DMZA 1RT5A 1S9EB 3CGIA 2ILZA 4M5JA 2OPRA 3KUHA 2CQBA 1UW4A 1WJ9A 1U1RA 1RT6A 1JLFB 2XMKA 2KVQE 4GKKJ 1RACB 2ZWPA 1C0UB 4LSNA 2PDAA 2KDOA 2DXEA 2GVZA 2V67A 2WZ1A 3HHKA 2HFSA 3EUNA 3EZUA 1YZ6A 3PR5B 1VQLS 1ZTWA 4EI2A 1HLWA 5I3UA 1HBMA 4O44B 1Q8LA 1RCXB 2AP6A 3JSYA 2Z8QA 5KFIA 4HACA 1V3ZA 2AJQA 3M2UB 4LSLB 4A8XA 4KB7A 4OI6A 3TANA 2KT5A 1YZ7A 1NSKL 3MOZA 3IAS9 2K1RB 4M5MA 4M95A 2VBYA 1WF2A 3ONQA 3FSYA 4G1QA 2VDHA 3FZ2A 2OSRA 3K8WA 1HPZB 4ANCA 3H25A 1HYSA 3A8EA 2BE2B 3A8JA 2L9WA 4Y2AA 2W8KA 3HPOA 3PW4A 3QNWB 1W26A 2YVSA 3TARA 2ZZMA 3BSAA 2IJNA 1SL1A 2M2BA 2AV5A 2JHEA 2VU5A 4BWMA 1QM9A 3DXBA 3NCQA 3OXGA 4G65A 3EE3A 1JLBA 4I56A 1JJ2R 4IG0B 3MGJA 4DSKA 2QYCA 3M32A 3OHBA 4LSZB 3MAAA 4WP9A 4LF2A 2PIIA 2NPFA 2J8SA 1YI2S 4V19X 3CD0A 1UVLA 3M9MB 2N4CA 3FMWA 1RAHB 4WTYA 2QO3A 3CJ2A 5F8GA 4G1IA 2HZVA 2F9DA 4PWDB 4ZLPA 3JB9k 4C4WA 1U02A 1NDLA 3A13A 4PXBA 2C3UA 1NZAA 3A3PB 4TKTA 3DGPB 4A8OA 2MQOA 4HH1A 4DR1J 2QZ8A 1NH8A 5H9EK 3CJSA 1EQMA 3ZZYA 4CO1A 2OPQB 1P6TA 2V9WA 1W25A 2PMHA 3CB4A 4DV1F 1U6FA 1VQMS 4C8KA 2H3EB 3MM8A 2KHDA 5AE2A 1SCJB 1IJEB 4B3TF 1JIHA 1FDDA 1N36F 4ZP6A 1IVZA 4WFYA 2DGSA 2W9CB 2XG8A 5E5NA 3RAMA 2Q6CA 1F5BA 2LDYA 3M6VA 4C2MA 4LF6F 3O6QA 2CQCA 3J7A1 2D3UA 1O0PA 2FJEB 3AOCA 3PW7A 2C22A 1HIYA 5C7PA 2R7TA 2G0CA 4M5DA 5BXIA 3QRRA 2HRYA 5I42B 1FI4A 5DDOC 4B9VA 3BGRA 1YJVA 4I7FB 2OHDA 1O51A 4LBIA 3WDOA 3MEEB 4B3RJ 1KFSA 2CDQA 4YDDB 2MTLA 2W2MP 5DDQC 5IQ6A 4K0KJ 4LRAA 2V2QA 2J7KA 1TP7A 1WHVA 2FTRA 3EPGA 2HNZB 4D3GA 1VQ6S 2DNMA 4I2PA 4ZVOB 5CD4H 3AQPA 3MWBA 2Y3YA 1KBRA 3QIDA 3QLHB 5J2MA 3NGTA 2OTLS 1HNWJ 2XYHB 3FBBA 1T05B 4O0NA 2BJ7A 1GTEA 4U9RA 5K5MA 5KFRA 3WX8A 2B8QA 4QPTA 2XQCA 3OV7A 3P8BB 4NLXA 5KT3A 1U4BA 2UUCJ 2Z57B 4H4MB 5EN1A 4N8NA 3BGRB 4JI5J 3GSIA 1JLEB 3D6MB 5HMWA 1OMSA 1X4FA 2V2KA 3CCES 2IA0A 4UUWA 3NLCA 1S0VA 3KTQA 4U8VA 1U6BA 4JB8B 3G71S 1VIXA 3I31A 3O5TB 3R2DJ 1L3KA 4M5LA 4MKBA 1IKXA 3DRRB 3GIRA 2E5IA 4HLBA 5L8RC 4CLPA 1DHMA 2HHXA 1OWXA 3NEKA 4FPIA 2J9DE 1YJ9S 5KG7A 3W60A 2X3GA 4IRCA 2B9EA 1RI7A 1OS5A 2P6SA 2WVEA 2RF2B 3OXFA 5BYQA 4C98A 2MKKA 3H8YA 1X9SA 1NSPA 3S01A 2CQ3A 3D6TB 1GFWB 3UDLA 4ETXA 3AOAA 2DHHA 1FRXA 3HHLA 4PG5A 2EPIA 5D78A 2XS5A 3U1MA 2ZJPQ 3VGSA 1VI7A 1N36J 2CPXA 2LECA 3C14A 4C8YA 1F2GA 5F8MA 1HD0A 4R8UB 3UI3A 2ZWOA 3BB5A 3CMQA 4HEA9 1VGYA 4KIAA 4LSLA 3FC9A 4ZIWA 2YXLA 4YDXA 2V69A 3J81U 1RE1B 1UP1A 4LR9A 1P27B 3ELHA 4A48A 4EYIB 2XY5A 3J7YU 4DR1F 3D68A 1L3VA 1SPBP 2C3YA 1OO0B 4FVMA 3QJPA 1Q81T 3CCWA 2UUAF 1WKJA 3K0JA 4DV4F 1N0VC 2DO0A 1SBRA 2QLXA 2I1RA 4NZ7A 2GCFA 2IC3B 2YY3A 1JLFA 4DLGA 3KNAA 1IBCB 3GJTB 1X4GA 3DI6B 3DRSB 3BR8A 4Z7CA 3LP0A 1WF1A 2F4FA 3GU0A 3ILOA 4CLWA 2XCPA 4DV5J 4C8NA 2NZ4A 5I3QA 1GNKA 1S6OA 1WTFA 4F26A 4DL7A 4J7CA 1QE1A 2YH0A 5GAGI 1Q78A 3CO0P 1R6YA 2Z2MA 2W2OP 2VQFJ 1TU0B 2XWXA 4DX8H 1Y3KA 3VAIA 4F0KA 1AFJA 2EI5A 3IR6B 1IR2A 3MTKA 4RW6A 2C2RA 2R7WA 1SL0A 2I5JB 2BKNA 1HW8A 3N5FA 3ZZ0A 5E3AA 4B3SF 3NL0A 3VTIA 1S1UB 2EBGA 3ET6B 3R5JB 1YLXA 4ECYA 2HVDA 2HFZA 3BKTA 1WACA 4DR6F 2WBRA 4DUZF 2PA3A 4PZVA 5CD4A 1CS4A 2MKSA 4NLSA 3UVJA 1F9EB 2XM3A 2GIQA 3JTPA 4GKKF 1Z4UA 3ENVA 2FJDB 3W8GA 2M9KA 4YR2A 1KD1T 4K5SA 2GC8A 2ASLA 2CJQA 4JP8A 1XMQF 4HT5A 2YBVA 4F36A 5K8MA 4EYHB 1O6XA 1RKIA 1QDUB 2ZDOA 3SCLE 2B4VA 1SB6A 2PSZA 4ITSA 5LSRA 3CC7S 2HHWA 1JLEA 1U8WA 5LXRA 3FCVA 2VF3A 1DTQA 2EFGA 3CD7A 2FJBB 2QMUB 4DX5A 5C42A 1RT7B 1O8BA 2AJFE 2G2ZA 2QLWA 1VOMA 4OLPA 1KP6A 3ETMA 2DR6A 2HBZB 2YKNB 4KH0B 3M2RA 1M5PC 4MT1A 4KHRA 1SJFA 2MHEA 4MKVA 1SJQA 4Q7AA 4X64J 2X1BA 4TVAB 4FF3A 2V6AA 1FNXH 4E0DA 1ZM9A 4JYAF 2GQ2A 2XYGB 4RW7A 4EZ6A 5KFWA 4RW8A 1JLAA 1UTAA 2F65A 2F7VA 4J9MA 1VBYA 4DPWA 1TFYA 1MN9A 4Q8EA 1WF0A 1XR6A 3HHLD 3DXSX 3HT0A 4KT0C 4O3QA 3CCSS 3TZZA 4EZ9A 2W9AA 3DLGA 2KRBA 3F44A 1JLCA 4PWWA 5C2CA 4JI6J 4NI2B 2WSCC 2R2SA 1R0AA 1KVIA 2BANA 2BE9B 4P7TA 5G4DA 1K9MT 4DF4A 1XJWB 1VDHA 2WSFC 3N28A 3PACA 4L75A 4ZVEA 2IAJA 1NDCA 4F4ZA 1J27A 2B8PA 2WW4A 5D6GA 3KJQB 4RUCA 2VONA 2JH3A 4Q0BA 1JLQA 4K4XA 1Q86T 2F8EX 2ZKTA 4GO5X 1VJWA 4DR4J 3TUPA 3CJ8A 2DNHA 4JI1J 2FHOB 3SBMA 1T11A 4ZPCA 3ZC4A 4ZMMA 2WONA 2M4MA 3TQEA 1VQYA 2B9YA 2Y0SD 2CNNB 5KG6A 5C24A 3DLJA 1XMOF 1NNDA 1FKOA 3V4IB 2B5JB 3M6XA 2BV3A 2LA4A 2LFVA 3BBCA 3W66A 4F4YA 1U1QA 4W90B 5BYSA 1WD6A 3IS9B 3OVSA 1R31A 2CA9A 3AXKA 3CCZA 1MWYA 1PJ6A 4W98A 3Q8VA 9ATCB 4RW4B 3HSZA 4KTQA 4A4JA 4TYBA 2Y0BB 4J9VA 4Y2MA 1QE1B 3W63A 3LQVA 2ZM6F 3QSIA 2C2NA 3LPYA 3VAHA 3W2VA 1SH0A 4NEYA 3R6LB 3PV8A 1VQNS 1Q5VA 2DYAA 2BJ3A 2RD5C 5F0UA 2GV1A 4H4OA 1BXNA 5D0EA 2FLNA 3HFKA 4QCLA 4LFCF 3KLGA 3HSGA 3QPIA 2IC3A 5A0YB 4QWEA 2VQEF 1X0FA 3VZHA 4CLFA 5C2GA 1QAXA 1S72S 2HNYA 1F60B 2AIRB 3UN3A 2MKCA 5A6PA 2KM8B 3BGFA 4J37A 4R25A 4PYAA 2FHJA 2VFSA 4NA3A 5J2NA 4OZ2A 3RG6A 3HK2A 3K59A 1IR1A 2HWTA 3EGWB 4DQRA 2SXLA 1LW0A 4TN2A 2FLOA 3D67A 2C42A 3NS6A 4AL6A 2XSJA 1IKXB 2F4VF 4QOTA 1FX2A 2OPSB 2FQQB 3FRYA 2BOPA 1TKZB 2ASYA 3MR7A 1S4EA 5AXMA 5FDLB 2VG5A 3CC2S 3JYTB 4LUBA 1CC7A 5D15A 2A3JA 2DH9A 3Q86A 4WFZA 2C2KB 3AOBA 3MEGB 4ELUA 4F4KA 1S1TB 1VISA 3M30B 4MK8A 1VBKA 2VASA 1W7WA 2J0SD 3ISND 2APOA 2U1AA 2XMWA 3NCRA 4HHUA 5KFFA 2O5DA 3ILLA 5LXYA 3CVKA 3OVBA 4J9RA 5KFPA 1EP4B 1WC0A 3LWMA 3HFZB 4JV0A 2KRRA 2ZH6A 3LGNA 1ZPWX 2GQQA 2MLZA 2PI4A 3K57A 2YX7A 2PD1A 4GMKA 2R9LA 2UV8G 3OTDA 1BWEA 1R0AB 3Q83A 3RBDA 1EQ0A 1KEKA 3K5MA 2CZ9A 2CJ9A 1VQ8S 3PXGa 3FSXA 4QZVB 1DTQB 5ETQA 4DHVA 2BJ9A 3RBZA 3RAXA 4QU7A 1WNEA 4ZVTB 2WCXA 2IBOA 3HO1A 5GAEI 2W9BA 2J6SA 4F3OA 4X4SA 3U02A 4FKXA 2HBRB 2EFPA 1M1GA 3L7PA 3Q89A 4RWXA 1LQ9A 4NLVA 3U7JA 2R7VA 1YKWA 5IV3A 1U1PA 3QYYA 4J90A 4AFFA 3D2WA 4X4UA 1NSQA 3I55S 2QYGA 3D66A 1HNWF 4NZ0A 2HAFA 3MEEA 3MMCA 1UL3A 1GH8A 4KHPF 1CJVB 2XSFA 5IT4A 2BMBA 5IT9U 4K5RA 4WKRA 1VJQA 3VQSA 5KAKA 4ZCKA 4P2FA 3QBCA 3ZTPA 1UZDA 2CNKB 1UFWA 2HURA 1KFDA 4YN3B 4V1Ak 4HVZA 2HPUA 2X1FA 3N5BA 5THWA 2KFNA 1TUWA 1AZSA 4F04B 2H1YA 4FF1A 3ZTRA 1FKPB 1S0MA 1JXVA 3A12A 3CXCR 5E3RA 4U7UD 4IH6A 1RHRB 2FY8A 1VBXA 3P3DA 4NLRA 3D0IE 5HO4A 5JMNA 2C2EA 1RWVB 2A18A 4ED8A 1NB7A 3PIOQ 3ILIA 3DRPB 2WVDA 2GQCA 3NS7B 3CCLS 2K3KA 3MTJA 4OYZA 5KT4A 4PUOB 4PWUA 3B54A 5ETNA 5DG8A 4B9SA 2HHHJ 4IR9A 3SYZA 3N4WA 5D0HA 1RWNB 3ZNUA 1RTDB 3LWLA 4QIGA 2XNRA 2DXFA 3DM2A 2YX1A 4IG3B 1TELA 3R7NB 3ZZPA 1PKUA 2IM2A 4CI0B 2QFIA 4LF7F 1S1VB 5LJ3Y 1S97A 2I2YA 4USIA 2HGLA 2VPXB 5ETSA 3UR3C 2F4VJ 3DLEA 3M1VB 3KLGB 2ZOMA 4ZVGA 1R8HA 2V5HG 2OSQA 3OR2A 1RWXB 1LWFA 2J7UA 2MKIA 4NASA 1GMWA 4NRTA 2WONB 1S59A 1SH2A 1UW9A 4HHJA 4ECUA 2OH2A 2YPZA 3I9ZA 4B08A 2KM8C 4OJHA 1PCAA 5IC6B 1DRZA 2HBYB 2LDIA 2H9ZA 3AFGA 5T41A 5HVHA 4OX9J 4OZJA 2IRYA 2YNHA 3GCXP 1QJHA 4NLUA 3OQ2A 5F0WA 3P4UB 2B51A 3IN5A 3QJJA 4XDDA 4FP9A 4WFAQ 2N4DA 2YQ1A 1C1BB 3KJVB 4OYWA 4OQJA 4DL3A 3IWLA 3E2EA 2C3MA 2M7SA 2W2PP 1NAQA 2NZCA 3ILJA 4EUVA 1NJIT 1SKWA 1LNQA 3BR9A 3W9JA 3SIPB 2XLIA 4LQ9A 1RQ0A 1FJ7A 4KC5A 3H7HB 1Q82T 3OJUA 1B7YB 3BDEA 4KRWA 1FTRA 4UY8T 1G7CB 1NEEA 1S10A 1Q7LB 2IVFB 4RO0A 3E01A 1NJYA 3IC1A 4A8YA 2HHQA 4JOUA 1R8CA 3SQGB 4Q2LA 5ETKA 1T95A 2ZH1A 3OSPA 2J9EA 2P9GA 3DC2A 2V9KA 4M5HA 2RU9A 2C2MB 2E66A 3AQOA 3OL7A 1CJUB 9RUBA 3TZYA 5JVGQ 2GJIA 3MCSA 3DOKB 1U2FA 1HL6A 1EAYC 4LRBA 3FFIA 4ED1A 1ZAWA 2BW7A 3DOMB 2W8LA 2ZH4A 2MZQA 3BJYA 1BE4A 1G6BA 2AEMA 4FYDA 1OYEA 1MMDA 4K2JA 1S6QA 5J2PB 2DY9A 4I6YA 1FX4A 2CRLA 2E1RA 4ZVFA 5L46A 1DY3A 3K17A 1TK0A 2UU9F 4B9MA 4JYAJ 4OFZA 3NP5A 3RW6A 1PJ7A 1KR4A 4I7FA 3M4XA 4YB5A 3SMZA 4DV0F 4DSLA 1FJCA 1U0HA 4DOZA 3DYAB 3QZ7A 1S57A 3RU0A 4ED6A 2RS8A 4NLDA 5KFXA 3AB2B 3H90A 2K7JA 1IBLJ 3CJTA 3EPIA 3Q2SC 4NLGA 3N6NA 4DR7F 3CJKA 5HANA 1K73T 3M8QA 2CJXB 1VRUB 1S77D 3U27A 1RAAB 2HHUA 2YPYA 2XNQA 3UVJB 4OV1A 2ILYA 3GLJA 2VQEJ 4B9TA 2XLKA 2XMVA 5J2NB 2MPUA 3GIIA 2NREA 2VA2A 4K4ZA 4NLQA 4OZNA 2XYPB 1YRTA 2R8KA 1XMQJ 5B0GA 2B43A 4QYZJ 3R5DA 2P2CB 2AKWB 1HWUA 1UPMB 2G9OA 3P6YC 2IM1A 3MM5B 3NCPA 1FFWB 1QUPA 1N6QA 3FEXB 3HI9A 5DGAA 4RU2A 4OYIA 1U48A 3L9ZA 3I5CA 1N5YA 3B8HA 3ENQA 4IH5A 2YNIB 1RWOB 2FHMA 3C19A 2DNGA 3CIMA 1DAXA 2IYGA 4CP5A 1RBAA 1FO1A 3LH2S 3CCMS 4QIFA 4CH1A 1LXNA 2GMJA 1RTDA 4DDFA 3M32B 5KFMA 4DG1A 4OI0A 4LF5F 3VGVA 4ED4A 2WK4A 3CWJA 4KGVB 1TR0A 4LF1A 1UFKA 4EBDA 3JSMB 2L48A 1BY9A 4USJC 2FZKB 2IM0A 4OX9F 3UCGA 4BC9A 4EO8A 2JEGA 2KTQA 2MZTA 5KFHA 4KAIA 2M3DA 2EEYA 3M1VA 3L7UA 5ETRA 4O3NA 1RYRA 3ITHB 3QZ8A 3BBBA 3I9V9 5CYQB 4LF4F 2JL9A 3BYRA 2VG6B 3T6JA 1FWKA 5E3QA 1FFSB 3HVWA 1JMTA 4P71A 5L38A 1HBNA 4Q45A 2Q6BA 2VIHA 1MWZA 2BQ3A 1TVRA 4DPUA 2ZDPA 4J9OA 1QSYA 4CH7A 1GEHA 5F8HA 3NAIA 4DV0J 2DHGA 4QR2A 4URGA 4FS2A 1MROB 3VV2B 3NBPA 3PRBA 3UCZP 2GVZB 2W2QP 1AA1B 4MIAA 1NK9A 4H4KA 4OHXA 5KFYA 3BPDA 3OR1A 1X5TA 2XGQA 3N0VA 2LQJA 4A47A 1KHWA 3Q8QB 2VL1A 1JKHA 1FRLA 5B7WA 2VA3A 4I69A 3MMCB 4EMDA 2PFFB 2UUTA 4MIWA 3FBCA 1VHIA 4KFBA 4OLOA 4OX6A 4N5SA 2MGZA 2BBEA 2R3VA 1HBUB 3L4BC 1D1UA 1F1BB 3Q8RB 3VAMA 1BLUA 1WC3A 1MMLA 2M5YA 4DV6F 5KG5A 1L3TA 3MPUB 5J1NA 1C1CA 5KG0A 3UN5A 1K0TA 3QT8A 4DWIA 2CVIA 3H0PA 3WC0A 2OD4A 5JXSA 3D5MA 2N3LA 2OEJA 4C48A 4EK2A 3OD2A 2ZJRQ 1HBOA 4L72B 4QWBA 5H9FJ 5J2QB 1PYTA 2GJ2A 3MI7X 4Q2MA 3MECB 2VBWA 2V4QA 1TL4A 4NYZA 4DFMA 1CLFA 1HFEL 1VRTB 3HSDA 1IQTA 4C0HA 2VFUA 1HMVA 1YRXA 2R7SA 3QLHA 4DUZJ 5L9XA 3NNAA 5BR8J 3WHIA 1RHKB 3GONA 2AYGA 4B3SJ 3HJVA 3R7SB 2FVCA 3LOUA 3OFHA 3UWTA 3VR1A 5GMKa 4KKOB 1MG7A 3A8IA 3DOLB 2FD2A 3TVYA 1R3NA 5DZ7A 4ILMA 1BQMA 4J9NA 1HNXJ 3LGMA 3TYTA 3AAWB 3M9OB 4OHWA 1FJGF 2ZC4A 5FIIA 2HG4A 1VK8A 4KSEB 3RW7A 2VZ9A 1PAUB 1JK9B 4Y2KA 3W64A 3LALA 2GNKA 1VLOA 2K8GA 4OYMA 5HJXA 2ZD1A 3DU5A 3OSNA 1WC1A 2GFFA 4ZPBA 1NK7A 2BJDA 3X1LB 4JI8J 2ERRA 3HLUA 1UJ4A 1WC5A 5IOLA 4OI2A 4NXMJ 4G6VB 1PAEX 4UUXA 5KFAA 5B0BA 2FYXA 3A4TA 5AE3A 4X65J 2ZH7A 4GKJJ 1AROP 1UFLA 1GK8A 4P9SA 2AT1B 4DL6A 1MN7A 1EHWA 2YKMB 4ZLNA 3NWGA 1PG5B 2HWHA 3PX6A 4UOCA 1WOSA 3IA0A 4TU7A 3HDSA 2UXDJ 3S1TA 3H4BA 2XY7A 4GRSA 2HIYA 3DGPA 4W92B 1SIZA 4JI3J 2HVEA 2VG5B 4FPRA 4YB6A 1C1BA 2D69A 4JI0F 2N7CA 4ECZA 4CCHA 3TJAA 4WP3A 4LF8F 3R2CJ 4WF9Q 1D09B 3HP6A 3IM8A 2DHSA 4DG1B 4NXNF 1SJRA 2LQBA 3POTA 4EEYA 3MAAB 1FHTA 3EICA 2XEXA 3T5KA 3PFEA 5CYMA 3QGHA 5U47A 4NCGB 5JVHQ 3TUZC 4QYZK 1DFDA 3R5BA 1RTHA 1PC5A 1U0SA 2D74B 2YKQA 3PEJA 3PRVA 3LP0B 4RBUA 4DFPA 4K4VA 2MXYA 3KHGA 4KYZA 2K7KA 4GC6A 3ITHA 3TI0A 4BC7A 1KS2A 3EVOA 5KT6A 2ACMA 4X65F 2HHSA 4O4GA 4JI0J 1RT4A 2IRXA 1BHNA 1EB0A 2KU7A 1R0BG 1NRKA 4OYAA 1QTMA 3VWSA 2K1RA 2RQ4A 5EUHA 2ZJQQ 2R2UA 3CO9A 1R8PA 2YNFB 2KYZA 3MM9A 4TLQA 2QSWA 3TAQA 5IZHA 4Q44A 3POTB 4ALZA 3MM6A 4UZCA 3FNNA 4ZPAA 4FYYB 2R8IA 4ED3A 1L3SA 1JNZB 4AQYJ 4KPCA 5E0OA 1QY7A 4JV5F 3IS9A 4X66J 3RTVA 1VIOA 2DY1A 2DR7A 4AL7A 1I6JA 2ZM6J 1RBOB 3BO4A 4U8YA 1N5TA 4NYPA 2YKOA 3FQKA 2C2OB 5HVGA 4HYKA 4Y0FA 1BQMB 1TKTB 4O3PA 4NL5A 2HQCA 2OTJS 1RT3A 4HR2A 4DPXA 1KLMA 3NOCA 3B6BA 4K8RA 1H7XA 1FJGJ 1TK8A 4ZLLA 3VAJA 1TTHB 1TKXB 1HNXF 2Y8YA 3DRRA 3I6PA 3J80Y 1GMWD 3T5JA 4M5KA 3GCWP 5D4PA 3R97A 4UQGA 2VJVA 2VFTA 5M2PA 1NSAA 1CEZA 3L09A 2JEFA 2GVDA 3FGVA 4LF9J 1M5KC 4UTGA 1RT7A 1H73A 1U6ZA 2HEKA 2E5HA 3L7OA 5IWAF 1Y9OA 1YTYA 3PX4A 4H4MA 1PYOB 4QW9A 1F5AA 5DJBA 1OJ4A 1OQ6A 2P9CA 4C3MA 1NPRA 4O23A 4PPZA 4ZJQA 3HKWA 3H5YA 1CJTB 1ULRA 3NGUA 4O3OA 1OIAA 2ZUAA 2AQ4A 5EGYA 4CLUA 1GQEA 1GAOA 2CUYA 4PRFA 2CPYA 4PXEA 3G8SA 2GAHC 2EVZA 4R5PB 2AZ3A 3I0SB 2MMYA 4EFAC 3GV8B 3W8PA 1RU1A 1MU2B 2RHSB 3M8WA 3EVWA 2HFNA 3G6YA 2GW8A 4KY3A 3J80U 3R5GA 3D1OA 3DOKA 2E44A 3GZ7A 4DFKA 1ZM4A 4ICLA 1NHVA 4ATNA 4PQUA 1DBDA 1LOUA 2BJ1A 3MM7B 5LL6d 3UNGC 4F2SA 4C0BA 3PR4A 3PM9A 2ZHBA 4IOCQ 3JYTA 2X51A 3ZO7A 4NXMF 1JWWA 1N5VA 3W5XA 1HWJA 5SZTA 1PYSB 1B0TA 2DNOA 2ZZNA 1FKAF 1RBLA 4J9UE 1EP4A 4ZHRB 5KT7A 1XR7A 2BW2A 3MD3A 4N8OA 6FDRA 4LBPA 2ATLA 1L5UA 2J8AA 1U45A 5E7OB 3KHLA 1Q5YA 2OELA 4LIRA 2V34A 3K8VA 2WOMA 2CQ0A 4TY8B 3TR5A 4XK8C 3J7ZT 1REVA 2RSQA 4D3HA 2YQ0A 2IJRA 5F8IA 1XNRJ 2E9RX 2OPQA 4LT6A 3CCUS 3RB4A 4F3MA 2VPZB 2MQQA 3K5OA 2XI2A 1N33J 3CJ4A 2I0XA 2Q1LA 1UETA 4IFYB 1URRA 2MZJA 3M2VB 2CJYB 2L3MA 1KVKA 3EJMA 3GYXB
chains in the Genus database with same CATH topology
5GAGU 2AGOA 2PI5A 3AY0A 4Q43A 4ERDA 2XMUA 3PNIA 1C0TA 1Y3JA 1DFDA 4JI3F 2FDNA 4OZLA 3KLFB 2IMWP 2XZWA 2NR0A 3KLFA 2H5EA 1Q8BA 3D0HE 3DLLQ 1YJRA 1DTTA 4RNOA 4ED7A 2HMIB 2GGPB 3R5CA 2HNDB 2EK6A 4KPYA 3R1HA 4R8UA 4ZPWR 3CTRA 2FJVA 2UUWA 2XS7A 3OR2B 2YWFA 3HVAA 3MUTP 2O66A 2FJAB 3MM5A 1FNOA 2IYIA 3LANA 3KWMA 4PG8A 1HPZA 2FHKA 1FDAA 5B0CA 3HHNB 3OW2R 4I1TA 1VQ5S 2DHXA 4WFBQ 2M8DB 5I3PA 2VPWB 2DIUA 4KV8B 4CQ1A 2F8MA 3TNVA 1VQKS 5K9FA 1VRUA 4ZCMA 3V81B 1LXJA 4FF2A 2R8HA 4DQIA 4Z37A 2P6TA 1GXTA 4KGKA 5ITHA 3IR7B 2JVOA 3RRHA 2AGQA 1ZAVA 3PDNA 4TQSA 4FXVA 1JB0C 3I4HX 4OL8A 3H5XA 3C6TB 2M8HA 1IN0A 4IR1A 1IKYA 3SDEA 4WYWA 4PR6A 4I64A 3FJ2A 1D8ZA 4Y00A 3BQ0A 4R5PA 3AA8A 5CCMA 2M88A 3ZZOA 1X0PA 2UP1A 4BDPA 5HBMB 5DETA 5M2RA 3GQCA 1E6VB 4NWBA 3KLEB 5L1IA 1MNEA 4K2XA 2D9OA 3R3TA 5F41A 4IDKB 2G13A 1WG4A 1P1LA 1TZ0A 4IDKA 1AUDA 4X4RA 5EHHA 2FB0A 3M8PB 5CYJA 3GIMA 2KZMA 2V0NA 2P5VA 1S1XA 3N6LA 4AXIA 2KHCA 3DFEA 3FQLA 3TA2A 2COLA 1CQNA 1LK5A 4CNYA 1U1NA 2JDJA 3QO9A 4QWDA 4X66F 2WRMA 2R8JA 2DJWA 1IKYB 3T1AA 2MKHA 3CDEA 5KOWA 3R5AA 1YJNS 2OJ3A 2RB7A 3MECA 1XNQF 1WI6A 3BZQA 3DHXA 1NKEA 4JUZA 3MD1A 3T1YF 2V8DA 1YHQS 1UVIA 4B3RF 5L1JA 3C8YA 2LLZA 1FT8A 3DCAA 2E7WA 4ES2A 1QAYA 4K4YA 3RB0A 3RRGA 1VHFA 4FF4A 2B56A 1LW0B 5A8RA 3WZ0A 2ZOFA 3V6DB 2O3DA 2YNFA 1FE0A 1SQEA 1R89A 4M8LA 4UW2A 3TX8A 2MZ1A 4OZ5A 3DI6A 3DRSA 1IM4A 3ZZZA 4ES1A 2EC0A 2XMTA 1YVFA 4NLWA 5A0YA 3DLEB 5HMYA 3IG1B 2XCAA 2B6AB 4URSA 4B17A 3W2WB 2WB4A 3WX4A 5IS2A 2HWIA 2R4FA 1Y0HA 3I0RB 2V4JA 4ZK7M 1HWLA 2PN6A 1N56A 1HNZF 1U26A 3OPKA 4U6PA 2UXDF 2XMJA 3UFCX 2WHOA 2LXFA 2RH3A 4JI7F 1YGYA 4B9NA 4PUOA 1LWFB 5CYQA 2PT0A 4Q8FA 3DNCA 2DNPA 2MHNA 3C46A 2OLWA 2FVSA 3NMRA 3AB4B 1HYSB 3GYNA 2DR8A 3DLKA 4QIEA 3G96A 2YNGA 2G4BA 2HAIA 3PJWA 4IG3A 2AW0A 3TRGA 5LT5A 5AE1A 3SV4A 1KTVA 5CCLA 1UMJA 2VB6A 3UD4P 3FRZA 4FNHA 1K8AT