4BBSF

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
87
Chain Sequence
LKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 25
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.940.10 Alpha Beta Alpha-Beta Complex Eukaryotic RPB6 RNA polymerase subunit Eukaryotic RPB6 RNA polymerase subunit 4bbsF00
3S1RF 1I6HF 2E2HF 2O5IE 4Q5SE 1I6VE 4BBSF 2JA8F 4A93F 3FKIF 4XSXE 2A68E 3M4OF 4C3HF 2A6EE 3RZOF 3HOXF 4A3GF 3S16F 3H0GF 3HOZF 1Y1VF 3HOYF 4LK0E 4KN4E 3CQZF 4BY1F 4OIOE 1IW7E 5IYBF 5TMCE 5C4JF 4A3LF 3S14F 4C3IF 1TWAF 4A3IF 2PMZK 5M5WF 5M5XF 3S1QF 3GTGF 5C44F 2NVXF 2R7ZF 4LK1E 4JK1E 4BBRF 4LLGE 2A6HE 2JA7F 4A3KF 4C3JF 3S1MF 3S2HF 1TWHF 2R93F 4A3FF 4XSZE 1YNJK 2YU9F 3GTQF 4G7ZE 5D4EE 4YFKE 2NVTF 1R9TF 4MEYE 4MEXE 4XLPE 1I50F 3WODE 3S17F 4YFNE 4OINE 3GTMF 5IP7F 4A3DF 1Y1WF 1TWGF 5M3MF 1TWFF 3GTJF 4AYBK 3GTPF 5FLMF 1SMYE 4OIQE 4KN7E 2Y0SI 5FJ8F 3H3VG 4LJZE 3HKZK 3PO2F 1TWCF 3HOUF 5C3EF 3S2DF 5C4XF 3GTOF 3RZDF 4ZH4E 3S15F 2CW0E 5BYHE 4Y52F 4G7HE 3PO3F 1HQME 4A3BF 2PPBE 3GTKF 2BE5E 4A3JF 4A3EF 3EQLE 5E18E 4BXXF 5IPLE 3I4NF 4KMUE 2O5JE 5M3FF 3K7AF 1QKLA 5M5YF 2E2IF 1WCMF 2E2JF 4G7OE 3GTLF 1I3QF 4OIPE 3HOVF 4BY7F 3DXJE 2WB1I 3HOWF 4C2MF 3S1NF 1K83F 3I4MF 2JA6F 2VUMF 4GZYE 4MQ9E 4Q4ZE 2NVQF 2NVYF 5D4DE 1YNNK 5TMFE 5IYCF 5IP9F 5IYDF 4A3MF 2JA5F 1ZYRE 5E17E 4XLNE 2WAQK 1SFOF 2R92F 2A69E 4YFXE 4YG2E 3M3YF 5D4CE 2B63F 4A3CF 4X6AF 4OIRE 4Y7NF
chains in the Genus database with same CATH superfamily
4BBRE 3S1RF 4A3JE 2E2HF 1I6HF 4BXXE 4A3EE 2O5IE 4Q5SE 1I6VE 5FLME 4BBSF 2JA8F 3RZOE 4A93F 1DZFA 3FKIF 4XSXE 2A68E 3M4OF 4C3HF 2A6EE 3RZOF 3HOXF 5IYDE 3K7AE 2E2JE 3M4OE 5M3FE 4A3GF 5C3EE 3S16F 3H0GF 3HOZF 1Y1VF 3HOYF 4A3GE 4LK0E 4KN4E 3CQZF 4BY1F 4OIOE 1I3QE 1IW7E 1Y1VE 3HOVE 5IYBF 5TMCE 3HOYE 3CQZE 5C4JF 3S17E 4A3LF 3S14F 4C3IF 5M5XE 1TWAF 4C2ME 2PMZH 2JA6E 3PO3E 4A3IF 2PMZK 2WB1H 3S1NE 5M5WF 5M5XF 3S1QF 3GTGF 5C44F 2NVXF 2R7ZF 2NVYE 5M5WE 3GTJE 4LK1E 2JA7E 4JK1E 4BBRF 3S1RE 4LLGE 2A6HE 2JA7F 5IP9E 4A3KF 4C3JF 3S1MF 3S2HF 1TWHF 2R93F 4A3FF 1WCME 2E2IE 4XSZE 2YU9F 3GTQF 3HOZE 3S15E 4G7ZE 5D4EE 2R92E 4YFKE 2NVTF 1R9TF 4MEYE 5IP7E 4Y52E 4MEXE 5IYBE 1I50F 4XLPE 3HOWE 3WODE 3S17F 4YFNE 4OINE 3GTMF 5IP7F 4A3DF 1Y1WF 2B63E 2NVQE 1TWGF 4QIWK 5M3MF 3S1QE 3GTPE 1TWFF 2R7ZE 1EIKA 4AYBH 3GTJF 4AYBK 3GTPF 4BBSE 5FLMF 1SMYE 4OIQE 4KN7E 2Y0SI 5FJ8F 4A3FE 3H3VG 3S2DE 4LJZE 3HKZK 3GTLE 5FJ8E 3PO2F 3S16E 1TWCF 3HOUF 5C3EF 3S2DF 5C4XF 4BY7E 2Y0SH 3GTOF 3RZDF 4ZH4E 3S15F 2CW0E 5BYHE 5C4JE 4Y52F 1R9TE 4G7HE 4A3LE 1I50E 3PO3F 1HQME 3GTME 4A3BF 2PPBE 2KRXA 4A3IE 3GTKF 2BE5E 4Y7NE 1I6HE 4A3JF 2E2HE 4A3BE 5M3ME 4A3EF 3EQLE 5E18E 4BXXF 5IPLE 3I4NF 4KMUE 2O5JE 3FKIE 2JA8E 4A93E 1TWHE 2R93E 3HOXE 4C3JE 3S1ME 3S2HE 5M3FF 3K7AF 1QKLA 5M5YF 2E2IF 1WCMF 2E2JF 3H3VF 4G7OE 3GTLF 1SFOE 3PO2E 5M5YE 1TWCE 3HOUE 1I3QF 4OIPE 2WAQH 4BY1E 4BY7F 3DXJE 3HOVF 5C4XE 4Y7NF 2WB1I 3GTOE 3HKZH 3HOWF 1TWAE 4C2MF 3M3YE 4C3IE 3S1NF 1K83F 3I4MF 4X6AE 2JA6F 2VUMF 4GZYE 4MQ9E 4Q4ZE 2NVQF 5C44E 2NVXE 4A3DE 3GTGE 1TWGE 5IYCE 3GTKE 2NVYF 5D4DE 1YNNK 5TMFE 5IYCF 1TWFE 3I4NE 4A3ME 5IP9F 4A3KE 4C3HE 2JA5E 5IYDF 4A3MF 2JA5F 1ZYRE 3H0GE 2YU9E 5E17E 3GTQE 4XLNE 2WAQK 1SFOF 2R92F 2NVTE 3RZDE 3S14E 2A69E 4A3CE 4YFXE 4QIWH 4YG2E 3M3YF 5D4CE 1Y1WE 2B63F 4A3CF 1K83E 3I4ME 4X6AF 4OIRE 2VUME 1YNJK
chains in the Genus database with same CATH topology
3S1RF 1I6HF 2E2HF 2O5IE 4Q5SE 1I6VE 4BBSF 2JA8F 4A93F 3FKIF 4XSXE 2A68E 3M4OF 4C3HF 2A6EE 3RZOF 3HOXF 4A3GF 3S16F 3H0GF 3HOZF 1Y1VF 3HOYF 4LK0E 4KN4E 3CQZF 4BY1F 4OIOE 1IW7E 5IYBF 5TMCE 5C4JF 4A3LF 3S14F 4C3IF 1TWAF 4A3IF 2PMZK 5M5WF 5M5XF 3S1QF 3GTGF 5C44F 2NVXF 2R7ZF 4LK1E 4JK1E 4BBRF 4LLGE 2A6HE 2JA7F 4A3KF 4C3JF 3S1MF 3S2HF 1TWHF 2R93F 4A3FF 4XSZE 1YNJK 2YU9F 3GTQF 4G7ZE 5D4EE 4YFKE 2NVTF 1R9TF 4MEYE 4MEXE 4XLPE 1I50F 3WODE 3S17F 4YFNE 4OINE 3GTMF 5IP7F 4A3DF 1Y1WF 1TWGF 4QIWK 5M3MF 1TWFF 3GTJF 4AYBK 3GTPF 5FLMF 1SMYE 4OIQE 4KN7E 2Y0SI 5FJ8F 3H3VG 4LJZE 3HKZK 3PO2F 1TWCF 3HOUF 5C3EF 3S2DF 5C4XF 3GTOF 3RZDF 4ZH4E 3S15F 2CW0E 5BYHE 4Y52F 4G7HE 3PO3F 1HQME 4A3BF 2PPBE 2KRXA 3GTKF 2BE5E 4A3JF 4A3EF 3EQLE 5E18E 4BXXF 5IPLE 3I4NF 4KMUE 2O5JE 5M3FF 3K7AF 1QKLA 5M5YF 2E2IF 1WCMF 2E2JF 4G7OE 3GTLF 1I3QF 4OIPE 3HOVF 4BY7F 3DXJE 2WB1I 3HOWF 4C2MF 3S1NF 1K83F 3I4MF 2JA6F 2VUMF 4GZYE 4MQ9E 4Q4ZE 2NVQF 2NVYF 5D4DE 1YNNK 5TMFE 5IYCF 5IP9F 5IYDF 4A3MF 2JA5F 1ZYRE 5E17E 4XLNE 2WAQK 1SFOF 2R92F 2A69E 4YFXE 4YG2E 3M3YF 5D4CE 2B63F 4A3CF 4X6AF 4OIRE 4Y7NF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1R F;  1I6H F;  2E2H F;  2O5I E;  4Q5S E;  1I6V E;  4BBS F;  2JA8 F;  4A93 F;  3FKI F;  4XSX E;  2A68 E;  3M4O F;  4C3H F;  2A6E E;  3RZO F;  3HOX F;  4A3G F;  3S16 F;  3H0G F;  3HOZ F;  1Y1V F;  3HOY F;  4LK0 E;  4KN4 E;  3CQZ F;  4BY1 F;  4OIO E;  1IW7 E;  5IYB F;  5TMC E;  5C4J F;  4A3L F;  3S14 F;  4C3I F;  1TWA F;  4A3I F;  2PMZ K;  5M5W F;  5M5X F;  3S1Q F;  3GTG F;  5C44 F;  2NVX F;  2R7Z F;  4LK1 E;  4JK1 E;  4BBR F;  4LLG E;  2A6H E;  2JA7 F;  4A3K F;  4C3J F;  3S1M F;  3S2H F;  1TWH F;  2R93 F;  4A3F F;  4XSZ E;  1YNJ K;  2YU9 F;  3GTQ F;  4G7Z E;  5D4E E;  4YFK E;  2NVT F;  1R9T F;  4MEY E;  4MEX E;  4XLP E;  1I50 F;  3WOD E;  3S17 F;  4YFN E;  4OIN E;  3GTM F;  5IP7 F;  4A3D F;  1Y1W F;  1TWG F;  5M3M F;  1TWF F;  3GTJ F;  4AYB K;  3GTP F;  5FLM F;  1SMY E;  4OIQ E;  4KN7 E;  2Y0S I;  5FJ8 F;  3H3V G;  4LJZ E;  3HKZ K;  3PO2 F;  1TWC F;  3HOU F;  5C3E F;  3S2D F;  5C4X F;  3GTO F;  3RZD F;  4ZH4 E;  3S15 F;  2CW0 E;  5BYH E;  4Y52 F;  4G7H E;  3PO3 F;  1HQM E;  4A3B F;  2PPB E;  3GTK F;  2BE5 E;  4A3J F;  4A3E F;  3EQL E;  5E18 E;  4BXX F;  5IPL E;  3I4N F;  4KMU E;  2O5J E;  5M3F F;  3K7A F;  1QKL A;  5M5Y F;  2E2I F;  1WCM F;  2E2J F;  4G7O E;  3GTL F;  1I3Q F;  4OIP E;  3HOV F;  4BY7 F;  3DXJ E;  2WB1 I;  3HOW F;  4C2M F;  3S1N F;  1K83 F;  3I4M F;  2JA6 F;  2VUM F;  4GZY E;  4MQ9 E;  4Q4Z E;  2NVQ F;  2NVY F;  5D4D E;  1YNN K;  5TMF E;  5IYC F;  5IP9 F;  5IYD F;  4A3M F;  2JA5 F;  1ZYR E;  5E17 E;  4XLN E;  2WAQ K;  1SFO F;  2R92 F;  2A69 E;  4YFX E;  4YG2 E;  3M3Y F;  5D4C E;  2B63 F;  4A3C F;  4X6A F;  4OIR E;  4Y7N F; 
#chains in the Genus database with same CATH topology
 4BBR E;  3S1R F;  4A3J E;  2E2H F;  1I6H F;  4BXX E;  4A3E E;  2O5I E;  4Q5S E;  1I6V E;  5FLM E;  4BBS F;  2JA8 F;  3RZO E;  4A93 F;  1DZF A;  3FKI F;  4XSX E;  2A68 E;  3M4O F;  4C3H F;  2A6E E;  3RZO F;  3HOX F;  5IYD E;  3K7A E;  2E2J E;  3M4O E;  5M3F E;  4A3G F;  5C3E E;  3S16 F;  3H0G F;  3HOZ F;  1Y1V F;  3HOY F;  4A3G E;  4LK0 E;  4KN4 E;  3CQZ F;  4BY1 F;  4OIO E;  1I3Q E;  1IW7 E;  1Y1V E;  3HOV E;  5IYB F;  5TMC E;  3HOY E;  3CQZ E;  5C4J F;  3S17 E;  4A3L F;  3S14 F;  4C3I F;  5M5X E;  1TWA F;  4C2M E;  2PMZ H;  2JA6 E;  3PO3 E;  4A3I F;  2PMZ K;  2WB1 H;  3S1N E;  5M5W F;  5M5X F;  3S1Q F;  3GTG F;  5C44 F;  2NVX F;  2R7Z F;  2NVY E;  5M5W E;  3GTJ E;  4LK1 E;  2JA7 E;  4JK1 E;  4BBR F;  3S1R E;  4LLG E;  2A6H E;  2JA7 F;  5IP9 E;  4A3K F;  4C3J F;  3S1M F;  3S2H F;  1TWH F;  2R93 F;  4A3F F;  1WCM E;  2E2I E;  4XSZ E;  2YU9 F;  3GTQ F;  3HOZ E;  3S15 E;  4G7Z E;  5D4E E;  2R92 E;  4YFK E;  2NVT F;  1R9T F;  4MEY E;  5IP7 E;  4Y52 E;  4MEX E;  5IYB E;  1I50 F;  4XLP E;  3HOW E;  3WOD E;  3S17 F;  4YFN E;  4OIN E;  3GTM F;  5IP7 F;  4A3D F;  1Y1W F;  2B63 E;  2NVQ E;  1TWG F;  4QIW K;  5M3M F;  3S1Q E;  3GTP E;  1TWF F;  2R7Z E;  1EIK A;  4AYB H;  3GTJ F;  4AYB K;  3GTP F;  4BBS E;  5FLM F;  1SMY E;  4OIQ E;  4KN7 E;  2Y0S I;  5FJ8 F;  4A3F E;  3H3V G;  3S2D E;  4LJZ E;  3HKZ K;  3GTL E;  5FJ8 E;  3PO2 F;  3S16 E;  1TWC F;  3HOU F;  5C3E F;  3S2D F;  5C4X F;  4BY7 E;  2Y0S H;  3GTO F;  3RZD F;  4ZH4 E;  3S15 F;  2CW0 E;  5BYH E;  5C4J E;  4Y52 F;  1R9T E;  4G7H E;  4A3L E;  1I50 E;  3PO3 F;  1HQM E;  3GTM E;  4A3B F;  2PPB E;  2KRX A;  4A3I E;  3GTK F;  2BE5 E;  4Y7N E;  1I6H E;  4A3J F;  2E2H E;  4A3B E;  5M3M E;  4A3E F;  3EQL E;  5E18 E;  4BXX F;  5IPL E;  3I4N F;  4KMU E;  2O5J E;  3FKI E;  2JA8 E;  4A93 E;  1TWH E;  2R93 E;  3HOX E;  4C3J E;  3S1M E;  3S2H E;  5M3F F;  3K7A F;  1QKL A;  5M5Y F;  2E2I F;  1WCM F;  2E2J F;  3H3V F;  4G7O E;  3GTL F;  1SFO E;  3PO2 E;  5M5Y E;  1TWC E;  3HOU E;  1I3Q F;  4OIP E;  2WAQ H;  4BY1 E;  4BY7 F;  3DXJ E;  3HOV F;  5C4X E;  4Y7N F;  2WB1 I;  3GTO E;  3HKZ H;  3HOW F;  1TWA E;  4C2M F;  3M3Y E;  4C3I E;  3S1N F;  1K83 F;  3I4M F;  4X6A E;  2JA6 F;  2VUM F;  4GZY E;  4MQ9 E;  4Q4Z E;  2NVQ F;  5C44 E;  2NVX E;  4A3D E;  3GTG E;  1TWG E;  5IYC E;  3GTK E;  2NVY F;  5D4D E;  1YNN K;  5TMF E;  5IYC F;  1TWF E;  3I4N E;  4A3M E;  5IP9 F;  4A3K E;  4C3H E;  2JA5 E;  5IYD F;  4A3M F;  2JA5 F;  1ZYR E;  3H0G E;  2YU9 E;  5E17 E;  3GTQ E;  4XLN E;  2WAQ K;  1SFO F;  2R92 F;  2NVT E;  3RZD E;  3S14 E;  2A69 E;  4A3C E;  4YFX E;  4QIW H;  4YG2 E;  3M3Y F;  5D4C E;  1Y1W E;  2B63 F;  4A3C F;  1K83 E;  3I4M E;  4X6A F;  4OIR E;  2VUM E;  1YNJ K; 
#chains in the Genus database with same CATH homology
 3S1R F;  1I6H F;  2E2H F;  2O5I E;  4Q5S E;  1I6V E;  4BBS F;  2JA8 F;  4A93 F;  3FKI F;  4XSX E;  2A68 E;  3M4O F;  4C3H F;  2A6E E;  3RZO F;  3HOX F;  4A3G F;  3S16 F;  3H0G F;  3HOZ F;  1Y1V F;  3HOY F;  4LK0 E;  4KN4 E;  3CQZ F;  4BY1 F;  4OIO E;  1IW7 E;  5IYB F;  5TMC E;  5C4J F;  4A3L F;  3S14 F;  4C3I F;  1TWA F;  4A3I F;  2PMZ K;  5M5W F;  5M5X F;  3S1Q F;  3GTG F;  5C44 F;  2NVX F;  2R7Z F;  4LK1 E;  4JK1 E;  4BBR F;  4LLG E;  2A6H E;  2JA7 F;  4A3K F;  4C3J F;  3S1M F;  3S2H F;  1TWH F;  2R93 F;  4A3F F;  4XSZ E;  1YNJ K;  2YU9 F;  3GTQ F;  4G7Z E;  5D4E E;  4YFK E;  2NVT F;  1R9T F;  4MEY E;  4MEX E;  4XLP E;  1I50 F;  3WOD E;  3S17 F;  4YFN E;  4OIN E;  3GTM F;  5IP7 F;  4A3D F;  1Y1W F;  1TWG F;  4QIW K;  5M3M F;  1TWF F;  3GTJ F;  4AYB K;  3GTP F;  5FLM F;  1SMY E;  4OIQ E;  4KN7 E;  2Y0S I;  5FJ8 F;  3H3V G;  4LJZ E;  3HKZ K;  3PO2 F;  1TWC F;  3HOU F;  5C3E F;  3S2D F;  5C4X F;  3GTO F;  3RZD F;  4ZH4 E;  3S15 F;  2CW0 E;  5BYH E;  4Y52 F;  4G7H E;  3PO3 F;  1HQM E;  4A3B F;  2PPB E;  2KRX A;  3GTK F;  2BE5 E;  4A3J F;  4A3E F;  3EQL E;  5E18 E;  4BXX F;  5IPL E;  3I4N F;  4KMU E;  2O5J E;  5M3F F;  3K7A F;  1QKL A;  5M5Y F;  2E2I F;  1WCM F;  2E2J F;  4G7O E;  3GTL F;  1I3Q F;  4OIP E;  3HOV F;  4BY7 F;  3DXJ E;  2WB1 I;  3HOW F;  4C2M F;  3S1N F;  1K83 F;  3I4M F;  2JA6 F;  2VUM F;  4GZY E;  4MQ9 E;  4Q4Z E;  2NVQ F;  2NVY F;  5D4D E;  1YNN K;  5TMF E;  5IYC F;  5IP9 F;  5IYD F;  4A3M F;  2JA5 F;  1ZYR E;  5E17 E;  4XLN E;  2WAQ K;  1SFO F;  2R92 F;  2A69 E;  4YFX E;  4YG2 E;  3M3Y F;  5D4C E;  2B63 F;  4A3C F;  4X6A F;  4OIR E;  4Y7N F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...