4BJLA

Locw, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in distilled water
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
216
structure length
216
Chain Sequence
ESVLTQPPSASGTPGQRVTISCSGSSSNIGENSVTWYQHLSGTAPKLLIYEDNSRASGVSDRFSASKSGTSASLAISGLQPEDETDYYCAAWDDSLDVAVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three quaternary structures for a single protein.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords LOC - LAMBDA 1 TYPE LIGHT-CHAIN DIMER
total genus 45
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bjlA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bjlA01
3DJ9A 2E7CA 4XC1H 4FQ2L 2QJDA 4N1CA 3MV01 3ZKQD 3K0WA 3BZFA 5DEGB 4PV8B 3MRNA 3T0XA 4ZS7L 4LASL 3VFMA 5IHBA 1QLFB 4WU7B 3VXQB 1INEH 3P77B 1E28A 1N0LA 2EIZA 5FGCE 1YJDL 1UT9A 1XCTA 1I7RB 4NRYA 4RIRA 4RMVA 5GGUA 5DVOA 3ARDB 1A9EA 5A1AA 5FECA 5C7XH 2MWCA 1AXTH 4JDTL 1IQWL 1MQKH 4PGDB 4M5YH 5EUOB 5AD0B 3GMPA 5IQ9B 1H3VA 4JQVC 2IANE 5GSVB 3JXAA 3UAJC 3O11A 1XGPA 3ALPA 3WIHH 1A9EB 5FECB 3FB8A 3BP5A 4LMQI 2EDJA 1H9VA 1M05A 3VFOB 5H35B 4OFIA 3Q5YA 2O26U 3WFDL 3AAZB 3ZTNL 3IVKB 4LSDA 4MSWA 1E4KC 5DI8B 2AJ3A 5DSCB 2J8UB 1QFOA 3QUZB 2BSSA 3RPIB 1OWRM 3QXDB 3VWKB 5D71L 3RWJA 3MUZ1 2DI8A 3BWUC 4KUZH 1U8KB 2DRUA 4IIQC 2R2BA 4L4TE 2OP4H 4QTIH 2VH5L 3UTSD 2P45B 3D25A 3FAWA 4OCRH 5FEBA 5K9OA 2HJKB 1ZGLM 4MWFB 4CNIA 3U36B 4K7FB 2I27N 3GSVB 5BW7C 3P0YL 5F6HI 5I8KL 1U6AL 3ROOA 4BQCA 5B38G 3QUXA 3Q2CA 3DX8B 2VUYA 3EO1B 5CP3H 2O5YH 4LRIC 2AJSL 2XXMB 2YD8A 4RFEB 2NZ9D 5L0QB 3WFEL 4LCYB 1ZSDB 5IEKA 4HPYL 4RWYH 5ETUB 4M7JH 1BF2A 2XKSA 2C9AA 2PKDA 1U8QA 4ZNCD 1GPOL 2ICCA 5BV7H 1YMMB 4R4BA 1RZKH 4D0DB 1XR8A 1YJDC 1HHKB 5JOEA 5SX4I 1MHHB 4TOYL 2C5DC 3G5VB 5TQ2H 1YNLL 3VFRA 3QH3B 1J0IA 4O4YL 1U8LB 3HE6C 5FGCB 1P5VA 3ARED 3SDXE 3QIUC 3NPZB 1EHXA 3RWDB 1IL1B 5FXCH 1NH6A 2A77H 4DKDC 3WD5L 5TPWH 4K7PY 3QDAA 1E27A 4C4KO 5JOPE 3U6RB 4Z7OF 3BPOC 2PYED 4LVOB 3E6HA 1RJLB 4OT1H 4F8TA 2HLFD 3IFNL 4M62L 1DBJL 1BM3H 4JM4H 3VWJC 2IF7A 1F45A 3BDBA 1UXSB 5GRJH 2V7NA 3VE0B 3V52H 3SJVB 5HGDA 2VLKA 1H3GA 5CMAB 4FS0A 3FRPA 4XNQA 5CIPB 1ED3A 3BW9B 3LKSB 4CMMB 1CT8A 5H94B 1SM3L 3PV7A 3UBXB 5JW5B 2C3XA 4OJFL 5HYSG 4EXPX 4BH7B 4PTUB 1PG7X 5KSUB 4K2UH 4J2XA 2DQHL 5CEZH 3QWOB 2IFFL 1YA5A 1U95B 4WWKC 2J8UA 3QUZA 3BJ91 1WSST 2YEZA 3RZCD 2PXYD 3BVNA 4K3DH 5HHMD 1N64L 4ZFGL 3L7FA 3GSUB 1FL3A 3UAJD 1Z9LA 5DFTA 4QNPE 1JWSB 1AXSA 3HKFA 1SJVA 3T0ED 1KC5H 1L0XA 4ELMA 4HH9B 4X7FC 3MLXH 5FHAH 3TLRA 3FB7B 4JKPH 4LQ1A 1UEYA 5DUBB 5EOCL 1S9XB 3BKMH 4OZ4A 4LSPL 4MD5A 4UT9H 2GJ6A 2VR4A 4HKZB 5HI3C 2YBRB 4X9HA 2UZXB 5E2VL 1MI5D 2A6IA 4M5YL 4PJAE 4JAMA 2YXFA 1QFUH 1CE1H 3HI1B 3WE6B 1O5DT 2B0SH 2DDQH 5EBWA 5K9JL 3GM0A 4U2YA 4WI2A 4QRTA 4GT7A 4D0DA 1J1PL 4QXWA 2VLJD 4ZOEA 3TN0A 2IPTH 1H8SA 1ZSDA 1PBYA 1ZGLP 3GI8H 1WISA 3ULUH 1NLBL 4PJ7E 3P11L 5DQ9A 5D2NC 3IDMA 4OGYH 2HT4C 5DLMH 1A2YA 4IRJA 2J6EH 1YEHH 2OM5A 1OTUC 2J5LB 5JR1L 8FABB 3QDGA 3MROB 5BJTB 1ZVYA 4JREC 4U6XB 3U1SH 3P4MB 2IALB 4OZFH 5D7IF 5GGQL 3JTSB 3PF2A 1L9MA 5CFHA 3D3VD 4UB0L 4NZUL 5CWSA 2PNDA 3U2SA 4MJ5B 2ZNXA 1BZ9B 4EQ2A 5E1AA 3QWQB 2EZ0C 3ULUC 1UQSB 4PG9B 3SN6N 1WT5A 2UZIL 1MI5E 2JE8A 3PQYB 5IFHH 3EYUL 3I50H 3FFDA 5I2IA 2HKFH 1QPXA 1S7TB 4NSKA 3IU4H 4JO1L 4BZ1H 1S9WA 3L6FB 4XBPA 2QSQA 1CDCA 5KG9B 1LEIA 1KCSH 1X6NA 5C07B 2YKLH 5TDNA 4NQDB 2IH3A 1BAFL 2FSEB 5DRXB 4PJ7A 1SHMA 1OCWH 4AIOA 1UWGH 5FYJL 2VDQL 4JAMB 4QXUH 3BMWA 5AEAA 4LPTA 1M7XA 4X6EA 5D7KD 4JZJA 3KPOA 5AZ2L 5IMLA 3K80A 4JN2B 4JY4B 3RWGA 1UZ8B 1QHPA 1F42A 4NO5B 1QBMH 2J4WH 5I1IL 5D9SB 2Y1VA 2Y7QA 3HLAB 3WHE1 2R0LL 3LRSA 4C56A 3ZZ1A 4MAYB 2ED9A 1I7RA 5GGUB 3PG2A 5D5MF 1U8OA 1FLRH 1GGTA 3F7VB 3PABB 3PNWA 3V5DA 1A14L 5KSBB 2ZJSL 3EOTH 3LDBB 2OMBA 1B9ZA 5IW1B 5C0BB 4MAUH 4A2MA 3O8XC 4QRUB 1F6AB 2B2XL 1W0WB 2XWBB 3TJEL 4WUUE 3ULSB 4P46C 2H6PA 1A4JB 5HYSB 3BPCB 4K71C 3VI4E 4YHYB 1F4WH 5FYLL 1OM3H 1XIWC 4FQLH 4OB5H 2NY2C 3BH8A 4ZNEA 3P9MA 1NCBL 5DA4A 1MCRA 4OZIB 3DMMB 3EJYC 2K3TA 1RZ7L 4XNMA 1RIVH 4Z9KB 2C1OA 4NKIL 3GSXA 4GBXA 3BH9A 4UTBL 4Z0XB 1DQLL 2DKMA 2F54B 2APWA 3N9GH 3RWFB 1YNTB 3FT4A 2CQVA 4Z95H 4QTIL 5KOMC 4JZJC 1HIML 1VEMA 3SGDH 1MCQA 2BNRD 5C8JB 4RISL 3AREC 3FN3A 5T1MA 1K2DB 4PRPB 4N1HB 3TF7C 3GMRB 1ZGLA 3U83A 1UA6H 5DRWB 3MJ7A 3ZE1F 4TVSa 3QEQA 5CAYB 5SWQB 3H9YA 1QSEE 3I6LE 5MI0C 1X6LA 1H5BB 3VD5A 4JJHA 3RWIB 3O0RL 3WDHA 5TE6H 1V3KA 3FZUD 2ARJA 1J8KA 5BV7C 4HS6B 3DARA 1HKLH 5E6IC 1E6JH 4XGZA 2JJSA 3SDXA 3ECBA 3EOAB 5C70A 2OI9C 3H9HB 4KTDH 2ORBL 1KEGL 2DLTA 4MXQD 4M6NH 1EO8H 1HYSD 4ELKA 5I8OH 3SJVE 2FH6A 3V0VB 3GHBL 2UYLA 3GIVB 4IMLB 4V1DA 3IU3A 4X7DC 1WK0A 2B39A 2P1YA 2OJEB 3VXPB 4OQTL 1QFUL 2IMNA 4YNYA 2CR3A 5DUML 2NNAA 2VABA 3RZCA 4I3SH 4MJ4A 1FZKA 1AY1H 1MWAL 3EZ8A 4NO2A 4RSVA 1YPZA 1ZLSH 4JFPB 5GZND 3C09B 3F65A 3QDHA 2IBBA 3TN0C 5FUZL 1TZIA 4DOHE 3O4LE 2MCPH 5D8JH 3QUMH 2ITCB 2B4CC 1F4XH 4R7DA 3FOMA 5K9OB 3JV5A 4Z8FH 4PJBE 2CDEB 2XPGA 3P9LA 1MFAL 4G7VL 3TFKD 5GGRY 4HGWA 4KRPB 2IPKB 2YWZA 1YYML 2IQ9L 4ZSOE 3MV7E 2ICWJ 2NXYC 3HI6L 5GS0D 1R3HB 2X4QA 2CR6A 4AIZA 4MAYC 2E7HA 3L3KB 5JLZB 5FFLA 3BP6A 5JXEA 4GRWH 3RA7H 3TEUA 1UXSA 1I3VA 2AJ3B 4F7PB 3AY4C 4MDJB 3GGWA 3CDCA 2Y06H 1EHNA 5J6GB 2FO1A 2C3HA 4QY8B 5TF0A 1G7LB 43C9B 4POZC 2F58L 3BGMB 4UINH 1HI6B 5MHSD 2WLYA 4ZFGH 1KCRL 3ARFA 5IESL 5EC2A 4JRYD 1OP5K 3O6FA 3QWRA 1CD0A 4WWKA 4ONHB 3GSQA 2B20A 4M7ZC 4PREB 4JG0H 5FHAL 3PWPD 3VH8G 1F11B 1A6ZA 3BRGC 5BRZB 4ZAKD 3A6BH 3SKNA 2JELH 3KDMB 1IGTB 4XPGH 5F97E 2D2OA 5JW4N 3MRKB 4YDLC 3T1FA 4LSSL 3QFDA 5B39G 3U9UA 1MCFA 3T65A 3LRHA 3WIFA 4LF3A 5INDB 1P6FA 2E7LC 1TETL 2DWDA 4Y88A 5IJVB 1BBDH 1NCCH 1VFMA 2P8PA 1EXUB 1QRNB 4G6KH 4ESKA 1PLGH 1AQKL 4PG2A 4TNWF 2V5TA 4PV8A 1ROWA 2R4SL 5KS9F 5ISZB 3CXHK 3HCVB 3GBMH 4KY1L 1WJ3A 4LNRB 1MCWW 2G60H 4PRNA 4X5WB 1YNLH 1UWXH 4NOBA 4EDWL 2G5BB 4S11A 1J8HE 3IRPX 3QQ4B 3B9KB 4D2NA 5FO8A 1VDGA 4PJEE 4TRPH 1U8PA 3TYFA 3TYGH 2V9RA 5D5MB 1NFIB 5K59E 4F33A 3U36A 2QADC 1HINH 3VXUB 1U42A 4F15C 4XXCA 1GIGL 4HPOL 4KZEL 3D25B 2EC9U 1C5CH 2BVPA 1T0MA 4GQ9H 4V2CB 3EOBB 2EICA 4KROB 2VLMD 2KZ1B 2AP2A 2H1PH 1T04A 1QBLL 2VLJE 5C2BL 3S35L 2EDOA 4C58B 4F3FA 1G6RL 3MODL 4XMKL 5ANME 3HI5H 5FOBB 2X70A 2XFXA 3QXDA 2D3VA 5DD6A 5DTFA 2XRAH 4J23A 3I50L 2AEPH 4Q9QL 1EFXB 1V3JA 4U1MA 3TZVA 3G6JE 1QFWH 5LVEA 2AK4D 4DKFH 2MTPA 2YN3A 3MCKA 5C09A 4QNPF 1QYGH 4CGTA 1DANT 2DWDB 4JZNB 4JQVA 1U8JA 2FGWH 1P9MC 1QP1A 1G0XA 1GGBL 2B4CH 2IAMC 5FYKU 4K8RL 1T0PB 3TESA 4LGSB 4M61A 4FQIH 5E9DA 1WBZA 4LLWB 5CUSH 5HI4C 1FGNH 3D85A 4P5KB 3A67L 4JEGB 3MBXL 1T2JA 3HMWH 1BWMA 2HJLA 4XHJC 2C3WA 5TGBA 1FG2B 3TBWB 4YHML 1IRAY 5MEOB 3BKJH 4XP1L 1E4KA 3SDAC 4GKSA 3X3GL 2VLRA 4LPWA 2VDPH 5DT1H 2AJSH 1UB5B 2MFNA 2ARJQ 1S7QA 2IJ0C 3TM6A 3RIAF 1IM3A 3ARDC 3DX7A 5EORL 4D0BB 5E2VH 3VH8B 1EIBA 4M03A 4WDIB 5D7KE 5JHDE 4M7LH 3WKMH 3F6IA 4FQHA 4GKZA 5I1KH 2DQDH 3ZDZF 1RULL 3O2VH 2L4OA 4OZGE 3V5HB 1FVCA 3QNYB 3ARUA 4KKBD 4X4YA 5CIPA 1A6AB 1F2XK 4FG6C 3X3FL 3M17B 1KGCE 4ZSOA 3P11H 3NTCL 3CSGA 5I8CA 4ZQKA 4FMKA 3KPSD 4R96B 2BK8A 2LTQC 1MVUA 1IILE 2X89D 1RIHL 4HXBL 4UILL 5J12B 3IDNB 8FABA 5DQDH 5SWSE 3J7HA 3S96B 2Y23A 4DK3A 1NBVH 3MV9A 4X6DB 1T0NA 3RFZC 4NQCE 1R5VB 3BO8B 3HRPA 2WUBL 5IUSA 3OKYA 2B4CL 3KR3L 4R0LC 3PXHA 4KAQL 1KCRH 1NBYA 3MLUH 2BC4B 4Z5RB 4PJDB 4NN5B 5D6CB 5GRJL 4J6RL 5TDOA 3RVUD 1FYTA 3BUTA 5BOZG 1UENA 4X5LA 5IF0A 3HMWL 3MXVH 2OX5A 1CICA 5JW3H 3BPLC 1F3JA 3KPRD 1DANU 5IIEB 1DEDA 4ZPTB 4NC1E 4N0UE 1ZVSB 3ULUE 4YHLL 2DTML 1CS6A 3WIIH 1ETZB 3STLA 4P3CL 1SMAA 3O2DA 4KVNL 1G7IB 3SEPA 4ORZC 2YZ8A 2XT1B 1Y18A 3PL6B 1DVFA 5AZ2H 4CMHB 2A9NH 4LLVB 4Y16D 1MCHA 5KZCB 4XPFH 4GAJH 2BVQA 1J1XH 1QBML 1NMCB 3MZGB 2CIKB 3VMPA 1S7XA 3ZKXC 3L3IB 4FMFA 5FK9B 5F7YC 3NZ8B 5DMGC 1KIUA 4B0MM 4DVRH 4J3TA 2V6HA 4S0SD 5DJZA 1BGXH 4YDIL 1CQYA 1NGYB 1K4CB 1GGYA 3NTCH 3U0TB 1PVHA 1ODAA 2WV3A 2O61B 4GSDL 2BDNL 3JTTB 4JM2A 3VFNB 1QLEH 3O3DA 2V7HB 4XVJH 3BP7A 5ACZB 3BW9A 4MQSB 1FC1A 4P5MB 3VXUD 3GMNA 3QAZC 3D39E 3ZDXF 2YA1A 4G6FB 2QHRL 3OG4B 4WFFD 3QNXA 1RJZA 1T6VN 1YEJH 5BQ7A 1OP9A 2DLHA 2D7TH 2GFBA 3FQTA 4JKMA 5AG8A 5I75C 1G9NC 5BS0B 1RIVL 3VGAC 4YBQC 4YAQA 3DSFH 5ID1A 1TVBA 1F3RB 1MCJA 1INDL 1JRHH 2Q6WA 4M6OL 4MHHG 1WZKA 5I66A 1VGEH 3HRZB 4IMLA 4V1DB 3K4DA 2WBJC 4OF7A 3G5ZA 1TVHA 4OAWB 2NY5L 3UBXI 4NO5A 3P3YA 4X6BA 4ZAKB 3MRFA 3HNVL 4NKQB 1MRFL 2NY0C 5DWUH 5D7SL 4RDQF 1ZHKB 1ZA3A 2DB8A 3O2WL 1FVDA 3C9NA 4P3CH 1KJVB 2AGJL 1DLHA 2WIIA 4JN1H 3RU8L 2FO4A 5IR1A 3QUYD 3BEVB 1DCLA 1W72B 4IMKC 1JZ4A 2P8LA 1G9NL 2XTLA 5I71C 1R5WB 4L3AA 4WFHD 1XGQA 1KXTB 1C16A 4NQDE 4KDWA 1UM5L 5ESQB 3PDOB 5ELIA 3JBG7 1IKFH 5GGVY 1IAMA 1AGDA 1I1FA 4N0YL 5JIPA 4GBXD 2H8PA 2X1OA 3GDBA 2X89A 3ZT5A 5E5RB 2RCSH 4CAGA 3U2SB 2VISB 4R96A 4KK5C 1EHLL 2AV1B 3BD5A 5T1KD 3NCEB 1YNTA 4L3EA 1DJSA 4PJBF 5ID0A 3EBAA 3MBEB 3TA3C 4TSAL 2R2HB 3G6DH 2UWEB 1AD0A 2CD0A 3M45A 1FVEA 5IFAL 5IBUG 5HXMA 3MJ8B 3BPNC 4Z78A 1P1ZA 5JOPD 3GMQA 3QPXL 2P7TB 2ZOKA 3JUZA 1NCWL 4M7KL 1A64A 1AGFA 3MRDB 4GFTB 4HUUB 5H37H 4ODSL 5AZEH 3ULSA 4O00A 3VXTA 2YPVL 1XGYL 3EO0B 3BZEB 2BY1A 5C09D 4TUJA 3UTOA 1BMGA 2FO4B 5EO9B 3L3JA 4GKOA 1MELA 3TBYA 1IQWH 3S5LG 4DGIL 2P8LB 1U58A 2NY1C 1NCUA 1F4YH 2CMRL 3WIFB 5E2TH 2CRZA 2EDXA 5F3BB 1CG9B 5DWUL 4F15B 4YQXL 3LEVL 2GAZA 2MOVA 4P49A 1JGLH 5MHSE 5JHDB 4NQSA 3HE7C 3MJ9L 3RL1B 4JRYE 2YK1H 2Z93A 1ZANH 3MRCB 3MQIA 4P5TD 3GJFA 3KS0H 4E5XA 4U1LA 1IC5L 4ETQB 1FRGL 1WVZA 3OKMB 3SCMA 1OAUH 3AUVA 5EU3B 3HPLA 3I3BA 1A7OH 3HUJE 1NDMB 4NO3B 3L7EB 5JW3L 4ODXB 5F93C 1U58B 4HJ0C 3MOAH 4BZ2L 2R69H 3VXRB 3NZHH 1ZHLA 3TT3L 5F9JA 4U6VL 1MCSA 4WI4A 4OKDA 4OKVA 3FQNB 2YWYA 3C5ZB 4L8SC 4PJXF 4OLZH 4MMZC 4LLMB 3TBVA 5DEGA 2EDFA 4TSBL 2IC2A 1DL7L 3LKRB 2LTQB 5EO1B 4BELD 4WW1B 1OLZA 3O0RH 3RTQD 5B3JE 5L2JB 5EORH 4RAUB 5DJDA 1XR9A 3BUYB 2YMXL 2ED7A 3ME0A 3ARTA 2N4IA 3UBXA 3V5KA 3GB7A 4FABH 2Y5TA 3FO2A 4P5TC 7FABH 2VN7A 4WUKL 1G7MB 1A5FH 3H9SB 1T5XA 4LCWB 1T4KA 5D1ZA 5HYFA 3O45A 4UUJA 3TNMA 3RVXC 1B88A 1HQRB 3PHOA 2O5YL 5ICXA 2ERJC 5C0GA 1HHIA 2HG5A 1NCWH 4OLYH 2CLRB 4IRSC 2BXZA 4LIQH 1W8OA 5ANMB 1V7NH 3L3OA 1EVUA 4OV5A 4M1DL 4IHOB 5A16A 5E7BA 1A4KA 2J4WL 1J5OH 1XT5A 2ESVD 3P30H 5DQDL 1L0QA 1W72L 3VWKC 5J12C 2Z91A 1CFVH 1RZIB 1SY6A 4HK0A 4G3YH 4O51B 5GRZA 3QNZA 3BGAA 5I1EL 1CZ8L 3PP4L 3D3VE 1G6RH 2V2WA 1MCOL 3SDXB 4YXKL 1OAUL 5F7KC 4OZGA 4O9HH 4WU5B 2P48B 1I8IA 2VQ1A 5C08B 1IGFL 3SBWA 4BQ9A 3KPMA 2X7LB 4X6FA 4DTGH 2A77L 2W91A 3V0WH 3TO2A 4JKWA 1LK2A 1NANH 3ARPA 5JOFB 3QNZB 3WD5H 2AEQL 3OB8A 2WUCL 3BYTA 3WNNA 1OP3K 4RMQA 1S7UB 4XX1E 3P4OB 4EKXA 5DMIL 3ZDYE 4Z7WA 1JZ7A 3QEQB 2ZG2A 2R0WL 4YZFF 1AE6L 4HH9A 1C5BL 3WHE0 2GTWB 2OL3H 4X4ZA 5KVEL 3CNKA 2AJVH 4DZ8B 1HQRA 5D6DA 3SDDB 4ZQKB 2OI9B 1S78C 3BIKB 3M17A 4PTTB 2B8OT 4ZXBC 5MEQB 3CFJA 5E5MB 1KG0B 1HYRC 3W2DH 3IDJA 1BGXL 5JW5A 5GS1B 4HGWB 1HXYA 3IDGB 3ARBB 4PJGE 4RGNB 4KJPD 1NUGA 3CFDB 1CFSB 1OW0A 3PQYD 1LEGB 3OBAA 4Y4KA 3SDDA 1K6QH 3MFGB 3NZ8A 4HC1L 4O5LL 4CVWA 2QBWA 1W72H 1BQUA 1TJHH 1M05B 4K3GA 3I9GL 4G80A 3H0TB 1CFNA 5D1ZC 2VRAA 4LLYA 1G9EA 2H45A 2ED8A 3WEXB 4CVXA 1EV2E 2EDTA 1VPOL 3NCJL 4Z7QF 2NY4D 4DN4H 3A6CL 4HUWB 3O6FC 3H3PL 3WS6C 1T3FB 4PJAF 5DFWH 3HS0A 4XVTL 4I77L 5HHVL 3BGFC 3X14B 1PX4A 1N4XL 4HUXB 3ARFC 2DM2A 4E5XB 5MERA 5TGBB 3T2NH 1NCDL 2ICWA 3PHQA 4ZPTA 3GZKA 1EVTC 2D4DA 3UTZA 3VFGH 3WSQL 5KJRH 3HG1B 4P2OA 1OD9A 1JZ8A 2XA3A 4NQVA 5KVFL 1FL6B 4Q2ZA 3TBTA 1BQLL 1T3FA 3FQUA 5EUOE 1HWHB 3MUHL 3DVGB 2QQNH 2OXHA 5T5NG 3IJSB 2X1PA 1A0QL 4MA7H 4HIEA 5K9QG 3VGFA 1LEKA 1JPTH 1CGYA 5CJOL 2MSPA 1QOKA 1JWUA 3CVIH 4JRXE 2X4OA 1QFWL 4AEHH 1U93B 2NW2A 4LCWE 3KS0J 4LVEA 5FO9A 1TIUA 5FO7B 4M43L 2KPNA 3KLAB 4FQCL 4DAGL 2DJ4A 1LGVA 5DJ6A 5I1DB 1KULA 2UVEA 5F7DA 4U1HB 3M8OL 3QEHA 3DXAE 4N0YH 2YR3A 2X4RB 5EIIB 4XPTL 5I8CB 1Q9OB 5T5FL 3RZCC 4K9EH 2BVPB 3L3GA 5HYQA 2BSTA 4O58H 3U7YH 4LLUB 2A1WL 1OAYH 1ZEAL 1MREL 2KL6A 2VKXA 1UJ3C 4M48H 5EO0A 5HSFA 2SEBB 4YO0A 4OM0L 1XF5B 3TVMB 5I1LB 1SVCP 4PJIB 1P7QB 2BXYA 1DUYA 3N1PC 3EW3B 5I73C 2EECA 3BT2L 4G5ZL 1E4JA 3V6FA 3W82A 1NL0L 4QRTB 1J0KA 3LIZL 5LQBL 2W65A 3HAEH 2V2XB 4JRXD 1XGTB 2HJFB 4NQEE 4WUUD 2DAVA 1SJEB 3IJYB 4JANA 3C9NB 4MCZA 4P4KC 3EGSB 4X6FB 2DQDL 2YBRA 1N7MH 5TQ0L 2Z4QA 3O2DL 3CXDL 4KRPC 4U1KA 4XBEH 1KIPA 4TQEL 3D85B 4P5KA 2PYEB 3W5MA 3REWA 1FLRL 4GUPA 3VD9A 1XF2A 1CQKA 4N8VA 1FBIH 1F00I 5T3XL 1XGRB 4Z76B 5DJ2A 4U05A 1U6AH 1MCPH 3R0NA 4Y5XA 4QRRE 1YQVH 1PG7H 3ARBD 5I66B 1SJEA 3OPZH 3DNKA 4K8RD 1G0DA 3H0TA 1IVLA 4HAGA 4MXQC 3SY0B 5DRNA 4RWHA 4Q9QH 2XI9A 1EUTA 2XQBH 1FL3B 2A9ML 5FYLE 2VDRH 35C8L 5D2LA 5GJTL 3SE4C 4PJFF 5IV2B 4BYHA 2Q76B 3ARQA 3VXME 1FGVL 1EHAA 1TQBC 1QEWA 1K8IB 3HR5B 2UUDK 3RI5K 1KJMB 3F7PC 3TPKA 4J4PA 2W0PA 4ZFOB 4NHUB 3IFNH 4Q6IC 3TA3D 4P46A 2DQGL 3PJSB 3MJ8A 2IPKA 1IFHH 4W6XB 4ZYKA 1RK0B 4KI1A 1HXYB 4FXKB 4JLRA 1IAIH 1QSFD 3MYZA 4BQBA 4OLVH 1ZHNB 4L4VB 2ATPB 4HWUA 5C3TA 4N0RA 1KOAA 4N8PA 4EI5A 5EG6C 1KJMA 3X12A 2HVJA 5J13B 2E6QA 4RMUA 3I6KA 3DGGB 3CC5B 5CD5D 5I15H 1I85A 5FO7A 2WP3T 3ALWA 3A6BL 1EJOL 1UVQB 1REIA 3CPLA 1DVFB 4JFYB 3MBXH 3NCMA 4TTDC 1T1ZB 4LVNB 4K7PH 1RU9H 3L5IA 3UC0H 1A3LL 2X10A 1HEZB 1MFBL 2XQYG 1IL1A 4AZ8A 5I18H 3OKDA 4JDZA 2I9TA 1N7ML 3QG7H 1EGJL 1FH5H 2OQJB 5HPOA 1O7SA 4KK9C 2NCMA 3MRCA 2CGRL 4FFYL 5IF0B 2YA2A 1FVDB 4WI7A 3T65B 1RJYA 2F5BH 3OKKB 3HNSH 1CICB 5DD3H 3PGDB 3KYNA 4NP4L 1OAQH 1RUKH 4RFOL 2FCBA 1T7VA 2ZCKL 2AJUL 4A2LA 3BWAA 4PRDB 2C7UB 3O6KH 1OHQA 4O51A 1DVFC 3DHJA 4L5FL 4Y19B 3E3QC 2VL5A 4XC3L 4FFWC 1HQ4A 1SQ2N 5ITBL 1TNNA 5GISL 4Y4KD 3FQRA 3KNBA 2J3SA 2EEDA 4ONGH 2J6EA 2L7JA 3FFCA 5ID1B 3Q1SL 2XNAB 5D1ZD 3QIUB 1NLBH 1EEZB 5CCKL 4PRHD 3HUJB 2R2HA 3HI5L 3OQ3B 3O6FD 1TENA 4WRLA 5HYQB 5ID0B 3I84A 3GBNH 2XA8L 3LPGA 3ESVF 4OCWL 1NC4B 3EHBD 4AMKL 1FLTX 2I60L 2AJXH 3QO1A 2P49B 5EU5B 4WGWB 4M3JA 4XAWH 3JV0A 1MFDH 4E0RB 3CLEH 1FJ1B 3BAEL 3ILPB 4H26A 1CGSL 3DMMA 5T1DL 5HI4D 3CDGB 2Y6SD 3INUL 3C5ZA 4LQFH 4C4KT 5BOPA 1T22B 3D39B 3Q3GB 1ZWIA 2DWEA 3UZEA 5C0BA 1Z9MA 4PGEB 4GW5B 1HILB 4JFPA 4BZ1L 1T83A 1NC2A 4RFNC 5E6ID 1A7BA 5B21A 3VCLB 4NQEA 4ODVH 4A6YA 5C9JA 1FYTE 2Q86A 4BUGA 1WUNT 2WQ8A 3TZVD 4HFWB 4N8VG 1J86A 2Y07L 5DJCA 5C0AA 1OTUD 1TJIH 4HGKC 1C8PA 3VWJB 4Y19A 3GJFB 3MACH 5DK3A 4MAYD 2RQ8A 4YR6B 3ARYA 4DN4L 4UB0H 3OKMA 3SCMB 4N0UA 2BDNH 1F3DJ 4LLAA 2BSRA 5JDSA 4P59L 3ARDA 3FL7A 3T09A 4DKEH 1XCTB 4RIRB 4APQC 1A7RH 2HH0H 3ZO0A 2AJZA 3QUZC 5HHOE 5EU6A 4JE4B 4KQ4L 3WYRA 1WICA 4G3YL 1AI1H 1QNZL 3HC3H 4Y5VC 3I85A 4PJEF 5IMOB 5IVXA 1BZ7B 2R56H 4QHMA 1RZIA 4LHUG 4GRWB 2Q3AA 4FQJH 2D31A 5B3NA 5JTWA 2PYFB 1EH9A 3B3IB 4GG8A 2AXFB 3W0WB 2A0LC 5C07E 1DQQB 1KJ3L 3B9AA 1QVOA 4G6AD 4PRAB 2QQKH 3VXNB 4GMTL 5E08H 1KIRA 4I2XB 3IDJB 1HHIB 2HG5B 1MI5B 3PQYE 2V2TA 4LHUB 5CP7A 4XBGB 4GAYB 3L1OH 3JVGC 4C59B 5I1IH 1G7MA 3HMXH 4NQCB 3U0WH 1KCVL 1A8JH 4LVNC 1OAZL 3VXMB 5HHPA 4HWBH 4Y19D 3G6JF 1KT2A 5ITFB 2R2BB 2OL3L 2XRAL 4OF3A 4I2XA 3QIUA 2Y36H 5EA0L 4EI6A 3IAGC 2VWEE 2NY3C 4KKNA 3HFML 5D1QC 5GSRB 5JIHA 2YXMA 1A7PL 2AK4B 4UOW0 1MLCB 2HFFA 5D1XC 1KB5A 1I8MA 1QVOB 3O4OC 1L6ZA 2ZUVA 3TBVB 3ZYOA 5IJKC 2FL5B 3CLFH 3QP3A 5DQJA 4E42A 3OGCB 4F7TA 4H0GA 1XGQB 1INQB 4RRPA 4HIHB 4JN1L 3HCVA 3RU8H 3UCRA 3VFOA 3MRLB 5I74C 1NAKH 2CUMA 3PNWB 3V5DB 5KSBA 2R9HD 4NM4H 3BP5B 4KFZC 4MQ7A 5JXAL 5C08A 4A6YH 4UBDC 1J8HA 3RGVC 1MFCL 4Z7UF 4FABL 4I18C 1S3KL 1Y0LA 3MLVH 5F96L 4D9LH 1OTSD 5JHLL 1KCKA 2BNUA 3R06B 2P42B 1P53A 4LKXA 5D1XB 5BW7A 1G84A 4XH2B 2VQTA 3OR6A 4URTB 3BX7C 1MH5B 1R5VA 3PDDA 4HFWA 1FBIL 4K9EC 4LLYB 3ZT6A 2ZPKL 4NIKB 1FN4B 3T2PA 5A16B 5DLML 5J6GA 1NC2B 4OFYA 2XWJA 2FR4B 2DBJA 3ILQD 4G42B 1OP5H 4HAFA 4HLZH 4FQXD 4Z77B 5F1KC 4IOIB 4Y5YC 3NIFF 3BP4B 4RAVA 4MD4B 3VXUE 4YFEA 3UYRH 1GVIA 5CINH 3I3DA 1MIEH 1OAZH 4RA3A 1ZLUH 4NN7C 3BKCH 5IG7A 4JQIH 4LSVL 1CDUA 5BVPL 1K9TA 1IGIH 3VXUA 1RAMA 4NGHL 2AJXL 3WNMA 3H3KA 4F33B 5HTSA 1K8IA 5CMAA 1BD2E 2CDEA 2LU3A 4ZOAA 2YUXA 1HK6A 4HJGA 3BAEH 3VXNA 3MNWB 2VXQL 3WIHA 1T03L 3CLFL 3BZ4A 3B9EA 4KJWC 3HNVH 4NT6B 3GNML 5IVZB 4KGLA 1ZLSL 1KTRL 1X9QA 4Q58C 1FRGH 3SO3B 1U41A 3MR9A 3U48A 3C60B 4FQXC 4N90D 1NDGB 5IB2B 1KNOA 3JUYA 2IAND 3QUMA 2DQFB 2BVYA 3PGCA 3QDJA 4LASH 4U6HB 2PYEA 1X5HA 5DGRA 5LWYH 2W9EL 3F58H 1NPUA 2DF3A 1KIQB 4KJYB 5LJYH 5L2KA 1NAML 3FQUB 4FP8L 2FECI 1OQXA 1WBZB 1F3JB 4DFIA 4L4TA 4HF5L 2X7LA 3OWEA 4ZFFA 4N1EA 5HHQA 4OZGB 1V7MH 4UQ3B 1CR9H 1C1EH 1T80A 2CDFA 4R4BB 4XCYB 3MXWH 5KSAB 4Z7WE 1G9ML 3QUYA 4HKXA 3T4AA 2V2XA 3KYKH 4Y4FB 3B6SB 2AJUH 1BOGA 1I3GH 5KW9L 3FJTA 4HUWA 1DFBH 5C0RL 1VCAA 2XZAH 2OR7A 3KPNA 2EE3A 3BO8A 3MLZH 3DX9B 4OV5B 4XNYH 1CYGA 4PRIA 1LWRA 4Z7VE 3KPSA 3QEUB 4WW2B 5ISZD 1A4KB 1JNLH 1JUFA 3MLSH 3CFEB 1AFVL 4N5EC 5BRZE 4CNIB 1LDSA 1DTUA 4KTYA 4NQED 2QLVB 1CK0L 3O6MH 4NQCA 2G5RA 2JB6A 4OCSL 5F3HB 1IZJA 4PJBB 2FIKB 3MA9L 5FCUH 2NXYB 3MREA 3E8UL 4WEUD 4CVZA 2XQBL 2BP3A 5BRZD 2NR6D 4OCWH 3DIFB 4ERSH 1Q0XH 1HH6A 4EBQL 4X4YB 2C1OB 4HQQH 2DLFH 5HHOB 2X4SB 1CF8L 1D5MB 1ORSB 3DUSA 1MCEA 1U93A 2Q76A 1U92B 3LEVH 5EFIA 4NCDA 3BP4A 4RAVB 3GFUA 2KQMA 5FM4A 2P24A 5FYJE 4ODWB 1P4BL 3SKJH 3MUJA 4NNXA 5FA3B 3G9VA 3KXFA 1D9KA 1I9EA 1IC4H 5I76A 1T7XA 1W0WA 2XWBA 1F3DH 1Y18B 3PL6A 3OAZK 4F57L 5E99H 1PZ5A 2VLJB 1XF2B 1G1CA 3B4NA 4QKXB 4M9OA 4HT1L 4XHQA 1MRFH 1DN0A 4HF5H 4FQ1H 5L7XH 2HTLC 3LEXA 1YEFL 5IKCA 2VDQH 4LKXB 5D1XA 3DX6A 1JZ2A 2FNBA 3GSNA 1CFBA 2WIMA 3GMMB 4OFPA 4HG4K 3KYKL 2EDWA 1ZKAA 1JGEB 5C0AE 3UXFA 3ABZA 1PKOA 4L1DA 1UZ8A 4XNZC 5DYOA 1CU4L 4I0PA 2Q86B 5IMLB 1JYVA 3O8XA 3F12A 3S4SB 5D6CA 5JHLH 2HMID 4LHQB 1A7RL 2HH0L 3EO0A 3T0AA 3FO1B 4YAQB 2I9TB 1Q72L 3QI9C 3KHQA 4AEIL 4YXLL 3MLSL 1VFBB 1W2KT 2G75B 1S9WB 2CUHA 1T5WB 3L6FA 4XBPB 5FAAA 4EOWH 3VXTB 5IOPB 4YWGH 3QCVL 5KG9A 1GGIH 4BSWB 3HPJA 4K3JL 5I2IB 1D5MA 1ORSA 3DUSB 5E6ZA 3T8XB 3D2UA 4HUVA 2A6KA 3SO5A 4UIMA 1EHLH 4PP2B 5E2WL 4XAKE 2WWKO 4NCC1 4QHKJ 2AABH 2CIIA 4HPOH 4JB9L 5F6HJ 1J5OL 5EIIA 5HHME 4TOYH 3MBEA 1QACA 4QHUA 2RB8A 4L8CB 1YY8A 1BFSA 3PWLA 1Q9OA 1JRHI 4M7LT 3L3HB 3ZE2F 4OF8A 2DKSA 2YRLA 4M62H 3SDYL 3SKUD 2CIIB 1DQQA 1CZ8H 3U0WL 4XCFL 3BDXA 4J7RA 5AZEL 3QDGB 5IOPA 4PP2A 3ZE0F 3FO0H 4N68A 4PUBL 1C16B 2NY3D 3SOBL 4XPBH 3ZYZA 4OF6A 3OAYH 3PWJB 3JWDH 3O8XD 5KN5A 1YZZA 3FQNA 3HFMH 4DEPC 1AR2A 1UA6L 2PO6B 4XT1C 5F9OL 3IS1X 2PCPA 5M7QA 5CD3A 5DYOB 2I26N 1U8OB 1JNHB 1CGSH 5EZLA 3MV7A 1RUMH 2D7QA 3KYNB 5GS2H 4C56B 1R5IB 3LCYA 4KAQH 2QSVA 2YS4A 2AJZB 4ENED 4G7YH 4PJFE 1ZA3B 1NGQH 1C5BH 4KK8C 4F8QA 1TVHB 5FKAB 3SKMA 3VI3F 4U1KB 1FIEA 2CKBL 1NAMH 4X6BB 4IBLT 4ORGB 2R69L 2FEEI 1S3KH 1ZEAH 4KDTC 2BOBB 1SEBA 3G5ZB 3X3GH 5JQ6L 1KXVC 1WWWX 2FX9H 5I76B 4AK1A 5I8KH 1GOFA 1HILA 3T3PE 2H9GA 1GGIL 4NQCD 3NFPA 1JI1A 1MPAL 1NL0H 1UCBL 1FCGA 1DQTA 1LK3H 2ZUUA 3WFBL 3FQXB 4NWUL 3D48R 2NY5C 3R8QA 4BK5A 1MCCA 3RTQC 2GFBB 3FQTB 1FJ1A 1K6QL 3QDMA 2PTTB 4TNVF 2R4RL 3UJTL 3ZL4L 2GW5A 4X83A 3IAQA 3VG9C 4BUHA 4HMCA 3BKML 2EE6A 4ALAH 1JF5A 5DEFB 1TZGL 2NTFB 2BFVH 2V5RA 6FABH 4FOMA 4WGVB 5TE7H 3B8SA 5IROA 2C4XA 1SYSA 2CUIA 3MRHA 3SOBH 4MGXA 1WBXA 4JR9L 1QLEL 2VDKH 3T2OA 4F9LA 5L88L 3KPRB 4RNRB 4KU1A 1TCRB 2B0SL 4M93C 2PW1B 3FFCB 2YRZA 5E08L 2XTJC 2NZ9C 3FOLB 1BBJA 4GRMB 4TQEH 1UH4A 1K5NB 5EH1A 4UNVA 3MBEC 4QT5A 5E4EB 1ZT1A 1SEBB 3TN0D 1ZTXH 3LRSB 3VWJD 3HHRB 5CJQL 5JR1H 1BIHA 2JK5B 1TTUA 5EA0H 1YECL 2XQYK 3G08A 4FNLH 4D9RD 1IC7H 2LVEA 5J4MA 5E99L 1VERA 3CVHB 1CD9B 4WNQA 2GHWB 4PRHA 3LZFL 4N0FA 1JPFB 5DVMA 2A6DA 4X7SL 3SDCA 4WEBL 1I1AA 1ZS8A 5HHXH 2AV7A 3BQUA 4XTRD 4F7MA 2NR6C 4R90L 2AS5M 4HIHA 4BQ8A 2ADFH 4PREA 4ZD3H 1BIIA 2X44D 4FFVD 4XI5D 2BVUA 2CJUL 3RPKA 4NUGL 2PW2B 3SPVB 1ZT1B 2J5LC 4P23C 2X41A 5I9QC 2Z91B 5KAQF 3S5LB 2R2EA 3GK8H 5DD6B 4UAOC 1QA9B 1T1ZA 1GAFH 1EMTL 3UJIH 3S34L 3KYOB 2YOCA 1LILA 4F7EB 1JP5A 5K59F 1U2HA 1UM5H 3T77B 3QZWA 4PLJC 1WCBA 4R26H 4OCMC 3QIBA 1EAJA 1I7UA 2F5BL 4GAYA 1A1NB 5FUOH 1CDHA 4K3HA 3X11B 2OR8A 4P2QD 4ZS6C 2QHRH 2DI9A 1GPOH 3MRRB 2KQNA 1DP0A 2OZ4L 4QRRD 1V8HA 5FYLH 1OM3L 4LRIA 4FZ8L 1JZ6A 1H3TA 5DI8A 5IP4A 1BPVA 1MCBA 1JWUB 1FSKB 4GOSA 4G42A 2R56L 3N1FC 4EN3B 2AXJA 3BIAX 4LAQH 2GJ6D 3C6LA 4XPBL 4R3SA 2E6PA 2PXYB 4JRXB 2VSDA 4OB5L 2B5IB 1I75A 4NYLB 2NX5D 4N0CC 1BFOB 2VOTA 5F7FA 5JDSB 5C9KA 4G8FB 2LU4A 3DUUA 2ZUWA 3ZTJG 1FFQA 1KCLA 3FT2B 4GUPB 3PHQB 3UDWA 2QADD 3PIQA 1IAOB 4HDIA 1D6VL 4Z6AT 2ZCLH 2EE2A 1X7QA 3KLHC 1UG9A 4KRMB 2Q20A 3MJ9H 5JHDA 4UOW1 3ULVC 2AI0H 3L5HA 1GC1H 5LBSL 1TNMA 3A67H 3VFMB 3A6OA 4KKAD 5L9DL 1I7TB 4LCUA 3FHQA 4K94H 1BQHB 4GQPH 3V6FB 3R1GL 1A7PH 1ZWIB 2DWEB 4XMLL 1KC5L 5DTFB 3D87B 1XGYH 4X6CF 1CFTB 1QSFB 2H2SD 3UTQB 3VFPB 4DVRL 5IGXH 3H6JA 3VXRE 4JCLA 2J7LA 3PQYA 5DK2B 4K8RC 2P7TA 4JFZL 1CCZA 5KSAD 4Z7VB 1DL7H 5C0ND 5J6HA 5KTEH 3QEQE 4LLQB 1MIML 4OTXL 1BVKB 4QOKE 3HC4L 5TFSH 3G6DL 1K4CA 3S7GA 4I3SL 3QUKA 1XGUA 2VE6A 4PTTA 4XXDB 5LAXA 4KZDL 4P99A 3K1DA 5TJWK 3RHWF 4KK9D 4GS7C 1FP5A 2D7TL 2VZOA 2DOCA 1P4IH 4HWNA 1BZQK 2IWGA 3QXAB 2IH1A 4MA3A 2NYYD 5FO8B 5CILL 4R97C 3AXLA 4MB4A 2EDQA 4PRIB 3BN3B 2Q8AL 2R1WA 4HCRH 4PBWD 3MC0A 2AXGA 4X4XA 1EDQA 3MLYH 3T4YB 5IHUL 5IMOA 4JFFB 2X4OB 3FO0L 2VAJA 4HIEB 2D31B 5HD8C 4JRYA 1RI8A 4L5FH 2BHUA 4XCEA 4FHBD 3AVEA 2NY0D 3RWDA 4NRZA 1K8DB 2GY7B 3QHFL 4LCUB 3HC3L 1WZMA 4OLWL 1LO5B 3UEZA 3RI5F 1FG2A 3TBWA 2IBZX 3VFRB 4MJ6A 1MIEL 3W0WD 1OGAE 4U4BA 2A6JB 1KCUL 1VESA 5E8NA 4I9WE 5GSVA 4XPHL 5A40E 3HG1A 4KV5F 1JHLL 2IQ9H 1NC2D 2YA0A 2V5YA 1KB5H 1QSZA 1D6EA 1Y6MR 4CJ1A 5HVWA 1S7SA 1OGAD 2VLJA 4ELMB 3RUGF 5EU7E 5A43C 3CFIC 3WHXB 3OZ9L 4H88L 1GZQA 3W5NA 3WLBB 3RDTA 1JZ3A 3KG5A 1AHWA 2HRPL 1AGBA 5D6DC 5EOTB 1RZ8B 4NHCH 3MOQA 5DD5H 3VWKD 5I6XC 1CU4H 3H42H 3OR7A 3T0EC 5LGJA 2YEZB 2IAMB 5D1QB 4NSKB 1PQZA 2D03L 4Y4FC 5D5ME 1MFCH 5E94A 5L0QC 3DIFA 1KLFA 4M1GL 3WN5A 4PJCE 5EZIL 4XWOC 5EWIL 2D7MA 4LBEB 4KTEH 1T1WA 4RDQG 1D5IH 4U1NB 5FYJH 4PBVC 4YGVA 1NGYA 2O5XH 2XWTA 1RZGA 2OLDA 3IETB 5IEHA 4MXWL 4OD2A 1T2QL 2I9LA 5AYQA 5F71A 1Y6KR 3VG0H 3QZWG 4EJ1C 5IHUH 2P47B 3B9KA 4TRPL 2Z31A 4YBLC 3MCLH 1MF2L 3FRPG 1FN4A 5JDJA 3FQRB 3KNBB 5KVDL 3OKLB 5F7WC 3QEUA 4WW2A 3JV6A 3EDDA 2GTZA 2FHFA 1YPZF 3T1WA 1JNNL 2C3GA 5EIVA 1I1AC 1QZ1A 5B22A 1AI1L 3AB0C 4M8QA 1N6VA 5DJXB 4FXGB 4NQXA 4O2CB 2D9QB 2QR0B 3O9WA 1H8NA 4JFDD 3CH1A 4LVHB 3RHWK 4P2QA 3CXHJ 2A6IB 3P0VL 2F74A 1MHCB 3F7YA 5SV4A 4OSUL 3EFDL 2BC4A 4Z5RA 3ROLB 4U1GB 1NMBL 3TT1H 4WENB 4GMTH 3HR6A 4KMTH 1CF8H 1JMZA 5DRXA 1ZT7A 1G6VK 3DO7B 1NEUA 3U9PH 1KEML 5TH2A 4TSBH 3GMLB 4M4RA 1DUYB 2BHYA 1EO7A 1H15B 4WUUA 2WWMD 3RTQB 4YDLB 5IVZA 5J0BA 2KBGA 2VDNH 3CPLB 4JG1H 3A6CH 4ODUB 4Q74A 4AMKH 4PLJD 4CDGC 4Y19E 3MRIA 3RVVD 3RL2B 5FA4A 4L8SA 5JXED 4OD1H 1E6JL 2ATPA 1A5FL 5GGRA 3MGOA 2R0KH 2APXA 1Q9KB 3BN9D 4X9GA 4YEFA 4G8GE 3BN9C 3GIZL 3TBSA 5D7IB 1BFVL 4H1LH 4S10A 4OLYL 1YQ2A 1E4XH 4C56E 3KLAA 2HLAB 1F8TH 1AGDB 1I1FB 4ETYA 3LN4B 3PWNB 2Q8BL 3D9AL 2XPGB 4POUB 5LGHL 1P84J 3JZ7A 5IHZB 4NZJA 4BSWA 3L5XL 1A4JA 2EDBA 1WGOA 4FQHB 2AXFA 4W81A 3RKDD 5D7JA 4QHLB 5E2JA 4QHMB 3BPCA 3EZJB 2ORBH 2X42A 5E00A 5B8CB 5D2LB 3H7LA 3NH7H 1C08A 1XIWB 5C0DA 1G9MH 5DHVB 43CAA 3MMEA 3MTRA 1I9IL 4Y8AA 1MAJA 2FH8A 5C0CD 5C08D 3FN0L 3HLAA 2OSLA 5I1CL 5HYJA 2GSGB 2ZSVB 1BEYH 4AT6A 3SKMB 2E8YA 1NC4D 5D70L 5F3BA 1JGLL 3IJYA 3STZA 4YPGA 4GAFB 2HMIC 1FE8L 2OK0L 1FNHA 3NMEA 4X6CB 3EYFB 5B8CA 2PCPB 4R8WH 3BZFB 4XPAH 4WCYL 3RVVC 1H5BA 1YN7B 2J6EL 4F7TB 4UT9L 3N06B 3LMJL 2Y5EA 4ZDHA 5B38B 4HUUA 3U4AA 5E4IA 4HKJA 2FD6L 3ARDD 1P1ZB 3K2MC 1U8HA 1SYVB 4FQQA 5I16A 4MX7B 5BS0E 4FQ1L 3NN8B 1B0GB 3MNVB 3WUWA 3VW3H 2B1AL 4Z78B 5K9JH 5CWSB 1SEQL 1U8MB 3KPQA 4TULH 4UT6H 5J13C 3JTSA 1Z9SA 5FDWA 1YY8B 4BFBD 5F1IA 3RWFA 3KWWB 5IHLB 4KVCH 4H5SB 4J8RA 5SX5H 3EYVB 1WAAF 1KLGA 4U0RC 2ITCA 5AAMA 3I2CL 1KJ2A 2HFEB 2XKNA 2A0LD 1FO0L 5HYJD 5TE4L 3B9DA 3EYOA 2ZNWA 3LS5H 1YPZB 2FLBT 3QI9A 3IXTA 5F6IC 5GJTH 4WW2C 4YE4L 3QIWD 4ZOBA 1J0HA 1RZJH 4LRNH 4HZLB 3VGDA 4EUPH 2DIJA 3CU1A 4I0PC 2DLEA 4MNGB 2IBZY 4I4WA 5KSBF 1I1RA 5GGSB 3BQUB 4WO4D 3BEWA 4YHKH 4J1UA 3AB0B 1QRND 3GJFK 3PWPA 4D9LL 5HYEA 5IR1B 5BV7L 5EBLB 1MUJA 1MOEA 1DBAL 3S36X 3CVHA 1BQLH 3WNKA 3DROB 1C5CL 5M95B 1KTLA 4JQXA 5AWNL 3G6JA 3UTZB 1M7DB 3BRFA 3PL6C 3I6GB 4NO0B 1PKQA 1QBLH 12E8H 3MO1A 3TYGL 5I15L 4HJ0D 2VDKL 2E8ZA 3VGBA 5GXBB 2F54D 4QHKI 4LCYA 5IEKB 1JHKL 2Q6WB 4PGBA 4AEHL 1C7TA 4GRMA 2LVCA 4LCCA 2WAHA 4NBYB 5DVLA 1Q94A 1M71B 4ELMF 4HULB 4Y4KB 2FHBA 4M6ML 2GJ6E 3FT3A 1WZLA 2HRLA 4N90E 3DHMA 4PRID 3F6LA 1Z9OA 1RUML 5DMGD 2VH5H 3VDBA 3U82B 1RZKC 4LSVH 1N26A 4XCCL 1EFQA 4KVCL 2AJVL 3FB6A 1HIMH 4Y2DD 1R3HA 1EEYB 4OQ1A 4Z7UB 3JWNC 4TUOB 4WV1A 5L8JB 1XR9B 3VJ6A 1KXQE 3GKWL 2P4AB 1UH2A 2DQJL 2R8SL 1IT9L 3MRQB 1JI2A 1FL5B 2DMKA 3BIKA 3LKRA 5L7XL 3TH4T 1Z0NA 4HHAB 3C2SA 1H0DB 1IBGL 4HX1B 3VFVB 1R3KA 3B2VH 3UC0L 1UYWL 3NFPB 5H35A 4Z7QE 4K3DL 2FLRT 3DURA 1D9KD 3EDEA 5DHYB 1QA9A 4PJXE 1DQLH 5DJ8B 2J8UE 4LARL 3DXAA 2WWMC 4Z7WB 1NDMA 1XF4B 1LP9A 4JJ5B 3HB3C 3I6GA 2VL5B 5LGKA 3V52L 1G7JB 3LKNA 3G6JB 4JKPL 1NUNB 2QADB 1OAQL 4L3CB 1PKQB 3HI1A 2VITA 1EX0A 2VXVL 2AV7B 4F7MB 2ZUQC 4PGDA 2L7UA 4PJCB 1U8LA 5B4MC 3G04B 4MQ7B 3H9HA 3ZDZE 3EGSA 1QSFE 1CWVA 4WNQB 1JPSL 4H1LB 3SCMD 3OB0H 1FFOB 1X5GA 2IAMD 4HUNB 1NFDF 4HK0B 4TUJB 5T3XD 3SHSA 2NPLX 1TPXB 3NCYP 3T0EE 3CIQA 2Y6SC 3TZVB 3ARGA 3EOYG 4H20H 3MRJB 3VGGA 3DXAB 1VGKA 3PGFH 5FIEA 4ODTL 4WFGD 2XACC 4M7KH 4MNHB 4XMPL 4I48A 3MR9B 4LAQL 1IM9A 3HC0A 4HKBA 4LPYA 4O2EB 1ZANL 4Y5YB 5E1HB 4ELME 3V95A 4JPKH 3ULUL 1CLZH 3GBNL 3MCG1 4HIIB 3MZTA 3L9RB 3MA9H 2WBJD 1LO2H 2X05A 3KWWA 5E2TL 3PWUA 1JBJA 1KLGB 2ESVB 4L8DB 4Q9RH 5KSUA 3WXVL 5J1TC 1S7VA 2YMXH 3OZ9H 3DV4B 5I1DA 2VZSA 5H94A 3WJLC 1BHGA 5D2NE 5HGAB 3KLHD 4PGCA 4LMQE 4MXVF 3WLWC 4P2RD 5I6XB 3B83A 3VD7A 2JCCB 4G8EA 3GEWB 2AI0L 3OHXB 3VH8A 5IVNA 2VZTA 5IWLC 3D69A 4LLMA 5GS0H 2GQHA 3UTQA 3VFPA 3U7YL 4AG4H 4FQXA 1BVLA 1T5WA 4WDIA 4Q9BA 2A9NL 4EIGB 3HAEG 1MAMH 5CSBA 3UBXG 1QSEA 2BX5A 3AAZA 1YJDH 3TP4A 4H25A 3L3DB 4JG0L 9CGTA 2VLLA 4IDJH 1HSAA 2FX9L 2CJUH 3ZKMD 4MXWH 3UPRA 2GK0B 2CXKA 1PG7W 5T1LA 3QG6B 3O4LA 3ARVA 5IKCB 4MD5B 2NY3B 4G8FA 5TFSL 4LPVA 1G7PB 1LD9A 3ES6B 1WCQA 4GG6B 4HUXA 5DVKA 4JFHE 1AQKH 2DL9A 5IB1B 4Q97A 3D6GA 3MA7A 1FSKC 1MCKA 5F7EH 4RGNE 2DJSA 5EN2A 1MSPA 3C6SA 3V4PH 1CFQA 2ITDA 3QXUA 3OAYK 2IPUG 3MCKB 2C3VA 5AG9A 3KLSA 4NQDA 4NRZB 5T3XH 1LEIB 1N6UA 1GC1C 2P5WA 4LSRL 4Y4HC 1FV1B 4Y2DA 4JFFA 3OPZL 3BVNB 5GJSL 1MLBB 1M7IA 3EHBC 4LP5A 4CL7A 2V5SA 3C5SB 5CGYC 4EZMA 3QUXD 5DUPH 4M7ZB 1BREA 2DYPD 3O41B 4QCIB 4EDXB 3OHXA 3VGHA 1EEUA 4V2BA 3N1GC 4FRWA 5CKAA 1CT8B 4PGCB 1MCOH 1PD6A 4XNQB 4I18A 3PWLB 3C08L 4Y0GA 4YXKH 1KCUH 5IK3A 2V7NB 2ZKHH 4K7PX 1MJJB 2H8PB 4TULL 5D72H 4P3DB 3IU4L 4L9LB 3NACL 1KB5L 1U3HA 2VISA 2VDNL 3LV3A 4JG1L 4MXVE 3GRWL 2CIKA 1TTFA 3RY6A 3O3AA 1OSZB 2YSSB 5FO9B 3ETBF 3C5SA 4NKMB 4CU7A 3V4VH 4HKBB 1IM9B 4GLRH 5E5UB 1UXWA 1CFTA 1QSFA 1BOGB 5FUCE 5DQ9B 2LU7A 4PJFA 1UYWH 4PJHE 2F53E 1OAKH 2K1MA 4EXKA 4APQA 1RMFH 1KJVA 3RKPA 4M7JL 3QFJE 3TO4D 1I9JH 1HE7A 4N0FB 1KBGL 1TCMA 4JO2L 3W9DA 5D9SA 3JVGA 5CBEB 4KZDH 1ZHBB 1OL0A 4HS3A 3KYMB 1MCNA 3BQUC 3D3VA 2IGFH 1NCDH 2NY7H 3BQUD 4WO4B 1WWCA 3QDJB 5JXEC 1S8DA 2OBGA 4HCRA 4YDJB 4P48A 3ZLQC 4QXTB 2ZUYA 4PJ5B 4G9DA 2H3NB 4HIJA 3DLQR 4WI9A 4OI7A 4RBPH 3AU1B 1U2CA 1HSAB 1RFDH 5CZVL 1T0NB 1WFOA 2FBJL 3T08A 5GJSH 3OKLA 3QQ9C 5C0DB 1BBJB 3C8KA 5E8PB 1TJHL 5EU4B 3MFFA 1JTTA 3JV6B 5C07A 3EO9L 5FGSA 5C0BD 3VFGL 5I1KL 5J11C 1FZOA 5GRXG 3DO3A 3I6KB 3RAJH 1T22A 3TH2T 3P73B 4L9LA 4ZUSA 4JY6B 3UO1L 2XN9D 4JDVB 5GRUH 1KYOJ 5TE7L 5C0BE 2HLAA 5DC4B 4OCYH 3KJ4B 1FFRA 1L9NA 3SJVD 2LFGA 2Z92B 3JTTA 3VE0A 2Y36L 3WN5B 3S37X 1YY9D 4ZUSB 3VRLE 3BE1H 5DO2D 2JB6B 3SJVA 2W0FA 1BECA 3IAPA 1RUPH 1IQDA 3ARXA 1ZV5A 1IT9H 1Q9WB 3ARRA 4YHOH 4E41D 2HKHH 3EYQC 3RDTB 3TV3H 1IBGH 1BJ8A 2YUVA 3LKQB 4RRPG 1XH3B 4GRLD 5JXAH 2B1HH 4N8VB 2F5AH 4HZAA 5ADPL 3CU7A 3VXOB 3VXSD 4G9DB 4GG6A 1MQ8A 4XNXH 3CDFA 5ICZB 5DFVC 2MHAA 5KZCD 5C1MB 1V7ML 4XC1L 3ROLA 1ZMYA 4MMXC 3FMGH 4H8WH 4UV4H 3EJZC 3WDJA 3HZKA 4LSPH 1RZJL 3DYPA 4LRNL 5CLTA 3AREA 1D5ZA 3UTTE 1VEOA 1DLFL 2P5EA 4H0HB 4P4KB 5BZWA 4P2RA 1QQDA 3WIHL 5DC0A 3MJ7B 4QT5B 3S34H 4PYHA 5IMKA 4Y16A 2GTZB 2HTKD 3LHPL 4PJHB 1DQMH 1ERNA 3FOLA 4PJ7F 1T2QH 5J3HD 2WBJA 5I75B 3RX8A 2OTPA 3P0GB 4XVUC 2JJWA 1WITA 2NXZB 4I3RH 4X98B 5ICXB 1MWAA 3MLYL 4O9HL 1UWXK 3BKYL 3O2DH 2Z8RA 5E6IB 3VXRD 1BOYA 4QHNB 3O4LD 1JNNH 5F1IB 4OZIA 1GHFL 3LAFA 4B50A 4HFUH 4G6ML 3AC0A 3CSPA 4PJAB 1MY5A 3QUZD 4YHOL 5E2UH 1OSPH 4JVPA 2NW3B 1U8HB 2BNQD 3I75B 4UTAH 2BY2A 4WW1A 4XNZB 2M2DA 5ILTL 5IW1A 1FZOB 3Q6GH 2AJYH 3F7VA 3PABA 4AG4L 4UDTA 3ARSA 4GMSL 4D9QE 5T3ZH 3ZDYF 5CHNB 2PN5A 2X9WA 4XB7A 2P5EB 2B7DT 4JY5H 4XNXL 2P46B 1N5AA 8CGTA 3RWEA 4CRPA 1A3LH 4H1LA 2X4UB 2COQA 4MA8L 5CP3A 5CSZA 4RMWA 4HG4J 4S2SB 1JGVH 5J9PB 3UPCA 1S8DB 4YDJA 1DN2A 3IS0X 3TVMC 4JHZA 1NAMA 1BF8A 3M8OH 1OF2A 3OKNB 5J89A 4GW4A 3QEQD 1KTLB 4NHCL 3QXTA 2Z93B 1AJ7L 1J18A 1NGPL 1SY6L 2MPAL 3MV8E 2XG5A 5CUSL 1N5AB 5IBTH 5F70A 1NEZB 1JWMA 2F8VA 3MV7D 2DLGA 1BX2B 1CVRA 4KH2A 5CHNA 1DZBA 4NRYB 3NCYS 4KKLC 4Z18A 2AEPL 3QCVH 3SGJA 5F9WB 3CAFA 4FFYH 2BZDA 4HZLA 1TQCC 2ZJSH 1N2RB 3HNSL 2E9IA 1NANI 5DMKA 4DN3H 2ZOLB 2J12B 1UH3A 3TO4A 4JVUA 4Y5XC 2ZCKH 1ZXQA 1XF3A 4ZUVB 3ILPA 1X5YA 1HXMB 5C0CB 5BXFB 4APQD 4S1RL 4OZHB 3WBDA 4Z7NE 3RZWA 4U1IA 2JCCA 1JGUL 4H1LG 4PV9A 5F72S 1R6VA 4YDVA 1QG3A 2EXWD 4WWID 1EEYA 1KN4L 3SDXF 1P2CB 3DMMD 4L3EB 3C5JB 1AC6A 4OZHE 5E2UL 1OAXL 3VRJB 2VC2H 1A1NA 3O4OB 3ZTJH 1UJ3B 4JGMA 4O02L 2YD7A 4UTBH 1P7HL 4PJGA 4S1QL 1FNGB 1NMAL 1AKJA 5DK0B 1MFDL 1A0QH 4MA7L 4O2EA 4KROD 1HXMA 5BXFA 5IWLA 2WBJB 4IRSD 3UX9B 2AW2A 1JE6A 1RIHH 2EEBA 4LNRA 3QQ4A 4PPTA 5IMKB 5IT2H 3NFNB 3VXSA 3OXRA 1YY9C 1X5JA 2I5YL 3OJDA 1AXIB 4PRNB 4WJ5A 5JHDD 2FWOA 1YN7A 5I1AB 4EVNA 4YQXH 5ISZA 5C0EA 4P0DA 1OT2A 4ZO6A 1P7KB 4FQIL 2Z0BA 3D0LA 3QIBD 1ONQB 1GXEA 3OJVC 4KTDL 1CFQB 1O0VA 3F7YB 3KDMA 4JFOB 1IFHL 4YEEA 3X3FH 5GRYA 3N85H 3U9UB 2OMNA 4YHIA 3GSRB 2R1XA 2ZCHL 2GI7A 2J1KA 1NKOA 5CGMA 2ZG3A 3IF1B 1OGAB 3MOAL 4LVOC 1K85A 1OAYL 3ULUF 5BRZA 2DQHH 4L8BB 1U91B 2EH7H 4M9PA 3QFJB 4EUPA 4WJ5B 4BZYA 2YUWA 5DHYA 1LP9B 4JJ5A 1A1MB 4TPRL 1B2WL 3L3DA 3NCBB 3B2VL 4YE4H 1YEGL 4Y4KC 3L7FB 5EC1B 4F7PA 1HI6A 3GHEL 3MV9E 1YUHB 5J57B 3FKUS 5FOJA 3SE9L 4HIXL 1FNLA 5FYKD 1N6QH 2YC1A 3BSZH 5E24E 3RGHA 1Z2KA 3CZFA 4PBXA 3QG7L 1YNKL 4GXUM 4OD3H 4PY8J 1U0QA 5EDXA 3GBLA 3QUML 2BY3A 5GGVL 3C2AH 3KPRE 4YJZL 4Z8FL 4BH8B 4DZBA 3TZVC 4FQJL 4R26L 1RZFL 1YEIL 2QKIA 1IGJA 5L88H 1DE4B 2CKNA 4LK4A 4N8CL 2FEDC 2HWZL 4R7DB 3RPIA 1CLYH 3WS6A 4Z77A 2ZOLA 3LQAC 1YQVL 3HE6A 2V5MA 4JDVA 1GHFH 1M7IB 3V7AE 4OIBA 1G6RA 4HMDA 4G6MH 1FV1A 4ACPA 1OARH 1T1XB 2IBGA 3BE1L 3UDWC 1RUQH 4PS4H 2BVOA 5FKPA 5IJKA 2A73A 4LCWD 2H41A 1HHGB 3WLBA 3RP1A 4I48B 3OL2A 4FQ2H 4XB8A 5FYKH 4UQ2B 4DCQA 1EAPB 1UZ6F 5I1EH 3WHXA 3G5XA 4PP1D 2YHGA 5EZJB 1YC7A 1QBAA 2QQKL 3O11B 2DD8H 2YD6A 5T3ZE 2X1XR 3IFLH 3ES6A 4WHYH 1EUUA 3QUYB 4HKXB 3T4AB 2A9MH 3UPAA 2A83A 2V17H 5HHXL 5IIEA 5E9DB 3UROR 1OWWA 1VKXB 4K23H 3KPMB 5E8NB 1MHCA 3NGBC 1XR8B 4KK6C 3ZYJA 4NNYB 1JL8A 3LQAH 1YMMA 2VYRE 4KVNH 5D93C 5I30L 1H3PL 1FPTH 4PG2C 4CUCA 4H25B 4OIIL 4PJFB 1F4AA 3PGCB 1MHPH 1YDPA 2FL5A 3LD8C 1QSEB 1N5YL 1UXWB 3THMH 3G5XB 1WIOA 5GS2D 2FWOB 4JHAL 4WI5A 5KANI 4CADA 1ZLWK 3AXLB 4X9BA 1KCSL 4X6DA 5FOBA 4G9FA 4PJEB 3IXAB 3NIDE 4DQOL 2VNCA 4DUVA 3QXAA 4NRXA 4X4XB 4YFDB 5DJYB 1W0YT 1JYXA 3RNQA 4JHWL 3S97C 2HVKA 3RNKB 3P4LA 3LHPH 1Z5LA 3NFSH 2W0FB 5FV1L 4NPYB 4WIQA 3HE6B 4V1DE 5IK3B 4ZO9A 3LPWA 2WUCH 3JWDC 3V7MA 3OG6B 1HN1A 3DETC 4JFZH 2VO5A 2N56A 2FB4L 3MGOB 4U1SB 3FT4B 4LARH 5DGQA 1AH1A 4YHNA 4HBCL 1YEDB 4OUUA 1PGRB 2W0KA 3BH9B 4P4KD 2R0WH 5DEFA 4Z0XA 3LSOB 3DV6A 4PLOB 5HY9A 1BVKA 1MFEL 5E94B 4UIMB 1G7HA 1MRDH 5BMFH 4ZPVB 1PQZB 3K2UL 4NRXB 2I25N 5DSCA 1I7ZA 2AQ1A 2NY4B 4D0CB 2ENYA 3VWKA 3QRFM 3VRLF 4LFHD 3PGFL 1P4IL 4N5ED 3T0WA 1KJ2H 4N9OB 3H7BA 1YEEL 2APBA 1A1OA 4OCYL 3DO7A 1EEQA 5IB5B 2G75A 1XCQA 4R2GD 2VLRB 3RBGA 1DBBH 5IW3A 2APVA 3I02B 5IMMA 4WTZG 4KQ3H 1EA9C 4GG6F 1MJ7H 2RCSL 4UDUA 5TF1L 1A6TA 4CN4A 4Y5VA 3QQ3B 5D7SH 4DGIH 3QA3B 5JORA 4WO4A 3REWB 1T6WA 3TVMD 1HH9B 4XAWL 2W9DH 5T1LB 5IVOA 1LD9B 4MB3A 4WFHE 4X6EB 3K4ZA 4DFHA 3BPNB 4JPWH 5C0AB 2DLIA 4M8QB 5DEZA 4JY4A 4QWWD 3HUJF 2LQRA 3FB7A 2HTKC 2YN5A 5IROC 1DN0B 1GYAA 3MV7B 3GRWH 2CRMA 3WL9B 2XY2A 5HVGB 5IMMB 2A74A 4NFDA 4ZNEE 3P9WB 3WXVH 5ALBL 1ACZA 4IJ3C 4TVPL 2Z31B 5IFJA 1ADQA 3CCHB 1BVLB 3VGAB 6CGTA 4J12A 4PR5B 2JJSC 1BJ1H 1E4XI 2M1KA 4ZTPH 4HWEH 2NY1B 4ZPVA 5KSBE 4QRPD 1YEKH 5HD8D 5KTEL 4R4FH 4PJAA 4P57A 4H26B 4D0CA 4LEXL 4HK3N 5D7LE 4EI6B 4E0RA 2KZWA 3CMOL 4R7NB 1YEDA 4PB9H 2VDML 4HIXH 2HN7B 5DHVH 4XWGH 1G7HB 5H8DA 2JCCF 4O58L 1JPTL 1MNUL 5L6YH 4PP1C 2BNQE 1I7UB 2R2CA 3HE7A 3O2VL 4CW1A 3K2UH 5DJZB 5JUEL 2YPKB 4LDEB 3W39B 1A7OL 3E8UH 2KUTA 1B6UA 1XAUA 3P4MA 4OIAA 3MGTA 4TVPD 2FX8L 5DJYA 3WNPA 5BJTA 4G9FB 3B9VA 3KPSB 4L9DA 2O5XL 3RNQB 3FO9A 4NDMA 4JFED 4PGBB 2DQIH 4U0RB 5FB8B 1JPSH 4Y2DB 1QR1B 2XKUA 2Z8SA 2P5WB 1J05A 2PW2A 1ZE3C 5I9QB 2ATKA 1IC4L 2XXCB 4F7CA 2XIDA 1N59A 3OKKA 4EI5C 4LSRH 3FQWB 2VZ1A 1NFDB 5EZIH 4YXHL 3MRKA 3T1FB 3BT2H 1SJHA 1XEDA 4J6RH 1V05A 4PJDA 2ARJB 5EUKB 1Q9LA 3SKNB 2EYTA 3UTSE 4PJCF 3ZE2E 2FBOJ 1HYSC 2ZP0T 1J05B 2UVFA 3BDYL 4BFIB 5D7JD 5HGHB 1PZ5B 5EOQL 5I1GL 4I0KA 4A6YB 4HD9A 3MYJB 5KVDH 3D85D 1KENL 1UACH 3UTSA 3GRWA 2W60A 2JELL 3LS4L 4XPGL 5E00B 2ZG1A 1PYWB 1D3CA 4LDOB 4IMKA 3MGTB 3S3SA 2D03H 2IEPA 4TNVK 3DRTA 3VMOA 1I9JL 3CMGA 1TZHA 1UM4L 1TCRA 3QRGH 4HJGB 1MCPL 5DDHB 3QSKB 3LB6C 2VLKD 4HT1H 2VZUA 4F80A 4Z7UA 2F53A 4JLRB 4ZXBD 3CK0H 3IDYB 3KXFD 3VJ6B 3QHZH 1BAFH 1J8HD 4E41B 5EU5A 4BSJA 4TUOA 5ESVA 3K74B 2YD3A 2AEQH 4AEFA 2W9EH 4OCXH 2BHZA 3U0TA 3QIBB 4IOIA 4HEME 1M6OB 2EYRB 1PDKA 1WCBB 4HBCH 3SE8L 4LGRB 1TZHB 5D71H 1HHHB 2XZCH 1HZHL 2FHCA 2YD9A 4RX4D 3CCHA 3O6LL 2UZIH 3DVFA 2Q1EA 3FHAA 4PJ5E 2XZAL 2GJZB 1ZHLB 1AE6H 1HINL 3T0EB 3LPFA 3ZKND 1C5DB 4O2FA 4PLNC 1I7TA 1F58H 3S5LA 4NWTL 5SWSB 3C8KB 2IQAA 5H2BA 4WHTB 2XN9B 3UO1H 2VXUL 2Y7QB 1RFDL 5CZVH 4Y4FA 3R06A 1NMAH 2OTWB 2CDGB 4OSUH 1OCWL 4JM2C 2PETA 4L1HA 1L4IA 4MJIA 1HCVA 4R2GC 1OGAA 1NAMB 1KLUB 3AREB 4JM2D 2Q7YB 4MJ6B 5D2NA 2D7PA 4PJDE 1BFOA 3QCTH 1I8IB 2VQ1B 1OB1A 3LVEA 4R0LA 1ZAGA 3NABL 2R29H 3OAUH 4RMSA 4F9PC 5J56B 3MLPA 4HS6A 1U8QB 2N7BA 4PRBA 3PWPB 1INQA 3OGCA 3S37H 1QR1A 4PJXB 1XMWA 2AERT 5CD3B 4OGZA 3ULVH 3P4NB 4EVNB 1UM6H 5CCKH 2P5WD 4XP1H 3JWDL 4AJ0A 4WHCA 1B0RB 2X9XA 1W8NA 4MA3B 1IGYA 4KJQD 3EDKA 2G9HB 5CJ8A 2YRPA 4JFDB 3FONA 5HHPB 3QUXB 4YDKL 2VSCA 3T2QA 1WBXB 5C0NC 1P2CA 1U3JA 4FQPA 5CJ5A 5CEYB 1UJ3A 1QSVA 3QXVA 5CP7B 4IIQB 4P9HC 4LCWA 1RULH 1C7SA 5E70A 2VDPL 5DT1L 5K33A 2WM0A 3FTGA 4MX7A 1MNUH 4F7EA 3FB6B 3GB7B 2EZ0D 5ADPH 1RHHB 5IBTL 4GH7B 2G9HA 4RGND 4MSWB 2BOCB 4YHMH 2WBKA 3V6OC 1YNKH 1DSFL 1XF3B 1VPOH 2WANA 4X4MA 4RGOL 2H2SC 1FORL 2DL2A 2EDRA 2XYCA 5BO1L 3AMLA 1MRCL 4LCCB 1SM3H 3BPLB 1NUFA 3MXWL 5I19L 1JZ5A 3F12B 3S4SA 2QSCH 4DN3L 5IJVA 1L0YA 3VW3L 2VB5A 3FB8B 1OB1B 4J3UA 2GIYA 5GS1C 3DRQB 4XH2A 2BSRB 1IKNC 2KH2B 1TDQA 3O4LB 2ICWB 4W4OA 5DS8A 4XP4L 2YPLD 4WWKB 3MLTB 4TNWK 4M48L 5T33H 1CG9A 3WJLA 4D9RE 4R3SB 1RZJC 3WEXA 2OTUB 5EBMA 4UILH 2VKWA 4JRXA 2DTMH 3DWTA 1U9KA 1Q0YL 5BV7B 5IT2L 1QLFA 4ZTOL 3W81A 3I75A 1W0VA 2Z31D 2D4FA 2P43B 1NGXA 1HNFA 3L5JA 2PXYC 5ALBH 4GW1B 3RA7L 1H3UA 1U95A 2R9HC 2WUBH 1QRNE 2BOCA 3AMKA 3RVWC 4PTUA 5KSVA 3IYLW 3LD8B 5DD5L 1K3IA 1EMTH 3UJIL 5LCVH 3EKCA 5JZ7C 4BH8A 4DZBB 2X4SA 4GS7B 1A3QA 4Z0BL 5IM7A 1OW0C 1CDIA 2GITB 3DV6B 5HY9B 2ESVA 4L8DA 4EIZC 5CZXC 2VMFA 2MCG1 3HB3D 1QR4A 3IFOA 2IAMA 2R1YB 4GJTB 1P9MA 3VFUA 4GSDH 4LLQA 5F8RC 1DSFH 3MROA 4KTEL 1IAKA 1KTKE 4PRPE 3E2HC 2R8SH 1A6VL 1LNUB 1XZ0B 3LIZH 1CFVL 3U79A 5K9QI 3IDIB 5MENA 5ISZE 2ICEA 1IGYB 3RGVA 1G7IA 1FIGH 4WTWA 3OB0K 1S7UA 4MNHA 1DBKH 4NZUH 3V6OA 5FGRA 5B39B 1HHJA 2GCYA 1X5LA 2BOBA 2N7AA 2EDDA 4XCYA 3GSOA 5KSAA 1FFPB 4KUZL 3UTTD 3BZDA 3MLVL 4EI5D 2P8PB 1VKXA 3O8XB 1EFXD 2C7UA 5I17B 4WTXA 3ZE0E 4XXCC 3HNTH 3O3UN 4JCMA 3RJQB 1AIFB 3DXAD 5HYJB 1HOCA 4JGUA 2VITB 3KJ6H 1H3WM 2OZ4H 1T20B 1T66C 1HHJB 2GCYB 4NQXB 1EAPA 2B5IC 1NDGA 5J7CC 3Q5TA 5MEPA 5DR5L 2H2PC 1CXLA 4NM4L 2EDNA 4DOHB 2DQFA 3RY5A 1XH3A 3W9EA 1MJUH 2X4NB 4IS6B 1IGMH 4YK4B 1OSZA 3N0PB 1YC8A 4YIQB 5DMIH 5T1LD 2I9LB 1NQBA 5D7JB 5IEHB 5HVHB 4JPWL 4M02A 1BVZA 1U92A 3HZYA 5I1HH 1UKTA 3C6LD 4YUEL 5BVPH 1ZLVH 3WUZA 4JPVH 1RK0A 4BH7A 3FN9A 4DKFL 4XMLH 1NBZA 3NN8A 4L4VA 1KB9J 1ORQB 4JHBA 4ZUTB 3O6KL 3P9MB 4Y1AA 4YGAB 3CFJB 1FAKT 2A6KB 3PDGA 1LO4L 1KTDB 4MD0B 4R90H 2D9CA 2VN4A 5IQ7L 2IANB 2JIXD 4NCC2 3TWCL 1XFPA 3ARWA 3MUY1 2JLLA 1MPAH 1CD1B 1JUFB 3KHOA 2XNAA 1MIMH 4OTXH 4X80H 4XMKH 1RY7B 3GHEH 2QV2A 3MFFB 2UUDH 1HZHH 5E8PA 1CXKA 3AS3A 3GMOA 5JO5B 3T3PF 4KJQC 5DRNB 1D6EB 2CK2A 1IGIL 1HKLL 2IPUK 1IKFL 4U3CA 4QRPE 2UWEF 1RK1A 1OVZA 1T83C 5DD3L 4GW4B 1QYGL 4HS3B 3TA3A 3H9SE 5GRWA 3UTPE 4NZRL 3CX5J 4D9QD 5EBLA 2JJTA 4L4TD 4ZFFB 3G6AA 3QH3A 1KIPB 3MLRH 3DROA 4JFQB 5JIIA 1ZVHA 1CD8A 5KW9H 1MUJB 3CH1B 5TPWL 3QEGH 4HV8A 1TXKA 3B43A 5IFAH 5GISH 3P2TA 1PX3A 2APTA 2IH3B 4UDTB 2PR4L 4FZ8H 3NCCB 5ABDE 3OKDB 2XZQH 1TZGH 5T33L 3HAEA 2YZ1A 4MZ3A 2Y9RT 1OAXH 1VENA 2YSSA 3NZHL 4UV7H 3TT3H 4JFYA 4XRCA 1E6OL 5A2JH 4TYUA 4JR9H 3DECA 3CSBA 3GM8A 4XVUD 3BHBB 3IFLL 5E1AB 2FRGP 1LO0H 3ZKMC 1D5XA 3FCTA 2DM4A 3MRHB 4QHUB 2NY0B 4X8XA 4P4RB 4P2OD 1TTGA 1RUAH 5BZDA 3GO1L 3L3HA 2FJHA 2YPKA 1RJCA 2A1WH 4P9MH 5A3ID 4P59H 5B8CC 5FYKL 2P8MB 1S5HB 1UACL 4B7LA 4L8CA 3WUWB 5DJ6B 5HVFB 1UB6A 3T77A 3MNZB 4GXVH 1X4ZA 3KPQB 1T2XA 4FQQB 5I16B 3V8CA 1GZPA 4KC3B 1Z3GL 5I71B 4BJLA 3CZJA 1LDPL 5F1OB 4ENEC 3V2AR 1LE5B 3WDIA 4X80L 4Z7VF 4ONFH 4Y16B 4HUVB 1V5JA 3LZFH 2FIRT 3HPJB 3V9FA 1EK3A 4P3WA 4X7SH 1BLNA 3IKCA 1DQDH 3V6ZB 5KANG 3HI6H 2AVGA 1ZS8B 3U1SL 4D8PA 2UWEE 2HT2D 4EQ3A 3SKOA 2BNRA 4XP5H 1HSBA 1MJ8L 2DS4A 5CZKA 3F5WA 1I8KA 1ZOXA 1T21A 3GK8L 1JVKA 3DX6B 4ORGA 4M1DH 4Q6YA 4L3CA 2O5ZH 4LVHC 5GIRB 1V3LA 4WFEE 4N9GA 1B90A 2F58H 3MRPA 4UINL 1AXTL 5ALCL 4UT7L 3JV4B 5INCB 4ONHA 4DKAA 1R0AL 3OTTA 4MQXC 2JJTC 5E8OB 4R97B 3VA2C 2PF6A 3MMEB 3EAKA 4DTGL 2ENSA 1C08B 1XIWA 2IADB 3RIFF 5C0FA 5FYKE 1TJGL 3SDAD 4PGEA 2D7NA 2FX7H 4XTRC 1KV3A 1YEEH 3Q3GA 4PJ7B 1AQDB 4YBLB 1YEIH 4E42B 1H0DA 3ZT7A 4KKCD 4GW5A 5HI5C 5F44A 5IFHL 5T3ZD 4QXUL 3BP6B 4DJMA 5D7IE 2XFXB 3NABH 4G8GB 5TF1H 4G6KL 5GZNC 4UIKL 4LGPB 4XVSL 5HPMB 4GQ9L 5E5MA 4TSCH 1MCDA 2LAGB 5C07D 4YHZL 1NC4A 3NCFB 3FOMB 4JO4H 5IB3A 3FT3B 5H37G 2BCKB 3L5WB 2DD8L 1NFIA 2LAAA 4K3EL 1B0GA 3MNVA 5L9DH 3QDGD 4KMTL 4Z7VA 1A14H 2XWJB 1SYVA 4G8GD 4JFDA 4ZS6D 3KYOA 4YZFE 4ZFZB 4IEFB 1A7QL 4GXUN 3ARGB 2HT2C 4TUKL 1VFUA 3W0WA 4AM0B 4MA1B 4P4KA 4RGMB 1BZ7A 4MDIA 1I3UA 4LEXH 3V0VA 4KI5D 3RRQA 5CINL 3ESUF 3EYFA 1W72A 1BIIB 3NH7L 5HHQB 1JPFA 4W6WB 2B2XH 4PRHB 2X1QA 4ZO7A 5MP6L 2UY7A 4NNYA 5DC9B 1I1AB 5JPMA 4FZEL 1RQ5A 5LWYL 2HT3C 3T2NL 4G8IB 1QD0A 4X9IA 4J1UB 1G7JA 3LKNB 4FQLL 1CICC 2MHAB 1JN6A 2OL3A 5GHWL 3E2HB 4I4WB 4Z7OE 4IRJC 1CR9L 4AM0A 5ETUA 1L7IL 3KJ6L 3IDUA 3OJDB 2PXYA 3HN3A 3GNMH 2QQNL 43CAB 3QIWA 3PXJA 2AK1H 3EYQD 2OS7A 1MLCA 4HX1A 3VFVA 3X13B 1C5DA 4O2FB 3EJYD 2RAMA 3T0EA 1HHGA 4HHAA 1RIUH 1WEJH 4KKAC 1KPVA 1I1AD 2KKQA 4RX4A 2FX8H 4IHOA 1AKJD 1RZ7H 3PHOB 3T04D 3VXSE 5C0GB 2EDYA 2VWEC 3O45B 4UUJB 3TNMB 5ANMA 1JNLL 4YK4C 3RVXD 1FL5A 2NTFA 3BPOB 4YHPA 5HHOA 4YXHH 3DPBA 3MRRA 4LHUA 5HDQL 1IGJB 4K07A 3DVNA 5EUOF 3U4EB 1QFWI 4U1IB 4EDXA 4NFCA 4RAUA 5DJDB 4DVBB 5DJ0A 5BVJA 4HSQA 4XPTH 5HHMB 1CDYA 1N8ZA 1OARL 4DUXA 1CL7H 1UZ6E 3AS0A 1DQJB 4XCNB 3U4BH 4KJPC 4QYOA 2J8HA 5GRVK 4M7LL 3WKML 5L2JA 2FR4A 1SBSL 4FQCH 4DAGH 5FM5M 4OZFG 1J11A 3K1KC 1TZIB 4M4PA 4XPHH 3S3PA 5IVXB 2JTDA 3VFWB 3QDJE 3D39D 4J3XA 1PEZA 5E56A 3D18B 3H42L 4OCSH 4RAHA 3MRPB 4K23L 4NO3A 2EIDA 5TE4H 1QUNA 1U3YA 2NY6B 1JN6B 2OL3B 1J88A 1EO8L 1A6VH 1HNGA 3QDJD 1J8HB 4H0IA 2Q3ZA 1UC6A 3EUUA 1I1CA 2GK0A 3HG1E 1O7VA 4L4TB 3OJMB 2FGZA 1MHPL 3RWEB 1N5YH 3ISWA 4NZRH 4JFOA 4WHDA 1JCKA 4XP6L 3DTXB 2I07B 2QR0A 4P9HL 3OF6A 1FC2D 5LGHH 4JRYB 1LO5A 1WFUA 1G0YR 4EUPG 4XNYL 4PRIE 1CE6A 4RQQA 3GSOB 3KXFB 4MDIB 5EWIH 1YYMH 1IC7L 5IB2A 2XY1A 4QOKD 4LU5L 3HNTL 3D69B 4HK3J 2SEBA 4YO0B 5KVGL 2NYYC 2BJML 1CK0H 4J3OC 4IOFC 2K7QA 3I6LD 3PWNA 3S8WA 2EKSB 1WC7A 2VDOL 5HGAA 1T0MB 4ZD3L 2MKLC 5FYLD 3X11A 1RZGB 1YEHL 3IETA 1MVUB 4W6YB 5GQBA 1FNSL 3MREB 3LN5B 4RGMC 4CVZB 3TGXA 4IIQA 3MRBB 4FFVC 2Z35B 1DBAH 3HE7D 4JFEB 3HMXA 5A2KH 1XGUB 2VE6B 3QUKB 5LAXB 4JFEE 1C12A 2BRRH 2DJUA 3TO4C 2DYPB 3BXNB 3SE3A 1D5BA 1EPFA 3C87A 4NUJA 1B6DA 4Q0XH 5D1QA 1UEMA 3U7AA 2G5BA 4X99A 2P5EE 2EKSA 4S1QH 3SDYH 4UAOB 5SWZE 3T8XA 1J7VR 1CGXA 1CDJA 1JHKH 1LMKA 2IFGA 3BYYA 2VIRA 5IVXE 4TTGA 3TNNA 3V0WL 1VACB 1V7NL 4X7TA 1W0VB 1YDPB 1KF9B 5FUOL 3B6SA 4DK6A 5FUCC 3MRGA 3WFEH 4FFZL 1CLCA 1R5WA 1YMHB 4JDTH 3GSWB 5ENWA 3MA7B 2EE9A 1X5XA 4JFQA 2W9DL 5LKNA 4G43A 4MNQB 4MAYA 3DVGA 1KENH 1Q8MA 1RZKL 2WLZA 3FT2A 4OFYD 4UT6L 3OGOE 3E1F1 4Y8DC 2W59A 2Y4SA 1L7TL 3GSNB 3O9WD 4NC1C 4U6HA 2VXVH 2X5PA 2Q8BH 1NGQL 3EOTL 4QGTA 2MMXA 4OZHF 1CGUA 4MNQA