4BLNA

Crystal structure of fungal versatile peroxidase i from pleurotus ostreatus - crystal form iii
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
329
structure length
329
Chain Sequence
ATCADGRTTANAACCVLFPILDDIQENLFDGAQCGEEVHESLRLTFHDAIGFSPTLGGGGADGSIITFDTIETNFPANAGIDEIVSAQKPFVAKHNISAGDFIQFAGAVGVSNCPGGVRIPFFLGRPDAVAASPDHLVPEPFDSVDTILARMGDAGFSAVEVVWLLASHSIAAADKVDPSIPGTPFDSTPGVFDSQFFIETQLKGRLFPGTPDNKGEVQSPLQGEIRLQSDHLLARDPQTACEWQSMVNNQPKIQNRFAGTMSKMALLGQDKSKLIDCSDIIPTPPALVGAAHLPAGFSLSDVEQACAETPFPALTADPGPVTSVPPVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligninolytic Peroxidase Genes in the Oyster Mushroom Genome: Heterologous Expression, Molecular Structure, Catalytic and Stability Properties, and Lignin-Degrading Ability.
pubmed doi rcsb
molecule keywords VERSATILE PEROXIDASE I
molecule tags Oxidoreductase
source organism Pleurotus ostreatus
total genus 104
structure length 329
sequence length 329
ec nomenclature ec 1.11.1.16: Versatile peroxidase.
pdb deposition date 2013-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00141 peroxidase Peroxidase
A PF11895 Peroxidase_ext Fungal peroxidase extension region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.420.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 2 Peroxidase, domain 2 4blnA02
1.10.520.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 4blnA01
3M27A 1KRJA 1A2FA 5SYKA 1AEBA 2AS1A 1H5IA 5SYXA 2BOQA 3FM1A 2WD4A 4XV5A 1QPAA 1BEPA 4PAEA 5AMMA 2CCDA 2B0ZA 1KXNA 1B80A 5JPRA 3VLLA 1ARXA 4A78A 5ABQA 1C8IA 1AEJA 1H5LA 1UB2A 2AS6A 5CIEA 2AS2A 2VNXX 4BLXA 1KOKA 5SW4A 3VLJA 1A2GA 1GW2A 5SYYA 4JN0A 1DJ1A 1SBMA 1H3JA 1DSGA 2VCNA 1H58A 2PCBA 2XI6A 2XJ8A 1S6VA 1U74A 3M2EA 5EJXA 4JM9A 4XV7A 1EBEA 1ITKA 5L05A 2GGNX 1H5GA 1CMQA 4NVMB 5ABNA 1ZBYA 5ABOA 1H5AA 4FCNA 4XV4A 4JMTA 5KQ0A 4A5GA 1CCEA 1AA4A 3UT2A 4JQKA 3R98A 1W4YA 2EURA 4BLKA 4C50A 5CIGA 4CZRA 3VLKA 1LGAA 5SXXA 1CMTA 3M2IA 3VLIA 2AS3A 1ARPA 1CMUA 1U2KA 4JPUA 2RBZX 1JDRA 2EUNA 1AEOA 1MNPA 2E3AA 5KQIA 1CPDA 1AEDA 1S73A 1SJ2A 4A6ZA 2RC2X 4NVEA 2ICVA 4CUOA 1AEMA 1H5KA 5KQ2A 2XIHA 4BLZA 1DS4A 1MKRA 2CCAA 2VCFX 1GZBA 1AENA 4CZPA 1GWTA 4BM1A 1AEKA 4BLNA 3E2NA 1CK6A 5D6MA 2EUSA 4NVAA 1BEKA 2B11A 4JQNA 2RC0X 5FNBA 1BEMA 2XJ5A 4JQMA 2IA8A 1STQA 1CCCA 4CZOA 1DSPA 5SYWA 2CCPA 5SXQA 2YLJA 5SXRA 2EUOA 4JB4A 3M2BA 5SXTA 5AOGA 7CCPA 5SYVA 4P4QA 3FMUA 5SX3A 3RRWA 1ATJA 1GWOA 4JMWA 2RBTX 2EUQA 1GZAA 3M25A 3M2CA 5CCPA 5CICA 5SYIA 2E3BA 5CIFA 2AQDA 5KSFA 4BM2A 4CZNA 1Z53A 4CCXA 4JPTA 4NVJB 1B82A 2X08A 2W23A 5L86A 4NVFA 1OAGA 1HSRA 1ARWA 1BESA 5CIDA 1H5FA 4GEDA 3FJWA 1MKQA 1DSOA 5EJTA 2B12A 3ZCGA 1CCAA 4NVIB 1AEQA 2RC1X 4BM3A 2GHHX 2PCCA 5JHZA 2Y6BA 2VO2X 1CCGA 1AEUA 2CL4X 3WNUA 2RBUX 1RYCA 3M23A 1ARYA 2E39A 4JM6A 5SXWA 1AEEA 2CYPA 1GX2A 1CCBA 2RBYX 1B85A 3FKGA 4FCSA 2RBWX 4XV6A 1QO4A 2EUPA 1DSEA 3VLMA 3ZCYA 2BCNA 2JTIA 4CVJA 4BLYA 1PA2A 1MN2A 1SCHA 4NVLA 5KQKA 1BJ9A 1GWUA 4G05A 1OAFA 2EUTA 5SX6A 1AC4A 2GHEX 3M28A 4NVBA 4NVHB 4CVIA 4JMVA 1DJ5A 2XILA 4XV8A 3M26A 1W4WA 1SOGA 3M2HA 1KZMA 3X16A 1APXA 1U2LA 4JPLA 4BLLA 1MN1A 4JMSA 1H57A 3R99A 2GHCX 5KQ6A 4BM0A 3FM4A 3VLHA 1BEJA 5SYUA 5KQHA 2CEPA 1ARUA 1H5JA 4JM5A 4NFGA 3M29A 1H5MA 1V0HX 4CCPA 1CPEA 5SX2A 2ANZA 1LYCA 3HDLA 3E2OA 2V23A 3RIVA 4OQ7A 3M5QA 4JMAA 3M2FA 1CPGA 1YZPA 3M2AA 1LLPA 2GB8A 1AEGA 1AEHA 4NVOB 4NVCA 2Y6AA 4FDQA 4NVNB 2GHKX 5CIBA 5L02A 3UW8A 1CCKA 1CMPA 1IYNA 1BGPA 1QGJA 1LY9A 2RBXX 5SX7A 2XIFA 3RIWA 2X07A 2N18A 1ARVA 2VKAA 4XVAA 1DCCA 2ATJA 3M2DA 5CIHA 4JQJA 1CCJA 5SXSA 2YCGA 3ZCHA 3Q3UA 7ATJA 1MK8A 1HCHA 1ZBZA 5CJHA 4C51A 1YZRA 1CPFA 5JHXA 1H5EA 5SW6A 4JMZA 2GHDX 4JMBA 1AEVA 1LY8A 6CCPA 1H5HA 4BM4A 1U75A 3ATJA 5SW5A 1CCPA 1JCIA 3WXOA 4FEFA 3M2GA 5JQRA 1U2JA 1H5CA 4A71A 1AC8A 5SYJA 1H5DA 1BEQA 3FM6A 2VCSA 5SX0A 2EUUA 5SX1A 5JHYA 4ATJA 5SYLA 1BVAA 1AEFA 4A7MA 4JM8A 4USCA 1AESA 3CCXA 5ALAA 2AS4A 3M8MA 1AETA 2VNZX 1H55A 4NVGB 3EXBA 1CCIA 1YYDA 2RBVX 4CZQA 1YYGA 5FNEA 5AL9A 2Y5AA 5SX0B 1LYKA 2B10A 1CYFA 1CCLA 4NVKB 1KXMA 5SYHA 5KSKA 1FHFA 2V2EA 1ML2A 2XJ6A 5KQ3A 4NVDA 3CCPA 6ATJA 1SDQA
chains in the Genus database with same CATH superfamily
3M27A 1KRJA 1A2FA 4H79A 5SYKA 1AEBA 2AS1A 1H5IA 5SYXA 2BOQA 3FM1A 2WD4A 4XV5A 1QPAA 1BEPA 4PAEA 5AMMA 2CCDA 2B0ZA 1KXNA 1B80A 5JPRA 3VLLA 1ARXA 4A78A 5ABQA 1C8IA 1AEJA 1H5LA 1UB2A 2AS6A 5CIEA 2AS2A 5CD4J 2VNXX 4BLXA 1KOKA 5SW4A 3VLJA 1A2GA 1GW2A 5SYYA 4JN0A 1DJ1A 1SBMA 1H3JA 1DSGA 2VCNA 1H58A 2PCBA 2XI6A 2XJ8A 1S6VA 1U74A 3M2EA 5EJXA 4JM9A 4XV7A 1EBEA 1ITKA 5L05A 2GGNX 1H5GA 1CMQA 4NVMB 5ABNA 1ZBYA 2ZCAA 5ABOA 1H5AA 4FCNA 4XV4A 4JMTA 5KQ0A 4A5GA 1CCEA 1AA4A 3UT2A 4JQKA 3R98A 1W4YA 2EURA 4BLKA 4C50A 5CIGA 4CZRA 3VLKA 1LGAA 5SXXA 1CMTA 3M2IA 3VLIA 2AS3A 1ARPA 1CMUA 1U2KA 4JPUA 2RBZX 1JDRA 2EUNA 1AEOA 1MNPA 2E3AA 5KQIA 1CPDA 1AEDA 1S73A 1SJ2A 4A6ZA 2RC2X 4NVEA 2ICVA 5H9EB 4CUOA 1AEMA 1H5KA 5KQ2A 2XIHA 4BLZA 1DS4A 1MKRA 2CCAA 2VCFX 1GZBA 1AENA 4CZPA 1GWTA 4BM1A 1AEKA 4BLNA 3E2NA 1CK6A 5D6MA 2EUSA 4NVAA 1BEKA 2B11A 4JQNA 2RC0X 5FNBA 1BEMA 2XJ5A 4JQMA 2IA8A 1STQA 1CCCA 4CZOA 1DSPA 5SYWA 2CCPA 5SXQA 2YLJA 5SXRA 2EUOA 4JB4A 3M2BA 5SXTA 5AOGA 7CCPA 2BO5A 5SYVA 4P4QA 3FMUA 5SX3A 3RRWA 1ATJA 1GWOA 4JMWA 2RBTX 2EUQA 1GZAA 3M25A 3M2CA 5CCPA 5CICA 5SYIA 2E3BA 5CIFA 2AQDA 5KSFA 4BM2A 4QYZB 4CZNA 1Z53A 4CCXA 4JPTA 4NVJB 1B82A 2X08A 2W23A 5L86A 4NVFA 1OAGA 1HSRA 1ARWA 1BESA 5CIDA 1H5FA 4GEDA 2A7UB 3FJWA 1MKQA 1DSOA 5EJTA 2B12A 3ZCGA 1CCAA 4NVIB 4GKFA 1AEQA 2RC1X 4BM3A 2GHHX 2PCCA 5JHZA 2Y6BA 2VO2X 1CCGA 1AEUA 2CL4X 3WNUA 2RBUX 1RYCA 3M23A 1ARYA 2E39A 4JM6A 5SXWA 1AEEA 2CYPA 2ZOPA 1GX2A 1CCBA 2RBYX 1B85A 3FKGA 4FCSA 4H7AA 2RBWX 4XV6A 2OEBA 1QO4A 2EUPA 1DSEA 3VLMA 3ZCYA 2BCNA 2JTIA 4CVJA 4BLYA 1PA2A 1MN2A 1SCHA 4NVLA 5KQKA 1BJ9A 1GWUA 4G05A 1OAFA 2EUTA 5SX6A 1AC4A 2GHEX 3M28A 4NVBA 4NVHB 4CVIA 4JMVA 1DJ5A 2XILA 4XV8A 3M26A 5H9FB 1W4WA 1SOGA 3M2HA 1KZMA 3X16A 1APXA 1U2LA 4JPLA 3X1LF 4BLLA 1MN1A 4JMSA 1H57A 3R99A 2GHCX 5KQ6A 4BM0A 3FM4A 3VLHA 1BEJA 5SYUA 5KQHA 2CEPA 1ARUA 1H5JA 4JM5A 4NFGA 3M29A 1H5MA 1V0HX 4CCPA 1CPEA 5SX2A 2ANZA 1LYCA 3HDLA 3E2OA 2V23A 3RIVA 4OQ7A 3M5QA 4JMAA 3M2FA 1CPGA 1YZPA 3M2AA 1LLPA 2GB8A 1AEGA 1AEHA 4NVOB 4NVCA 2Y6AA 4FDQA 4NVNB 2GHKX 5CIBA 5L02A 3UW8A 1CCKA 1CMPA 1IYNA 1BGPA 1QGJA 1LY9A 2RBXX 5SX7A 2XIFA 3RIWA 2X07A 2N18A 1ARVA 2VKAA 4XVAA 1DCCA 2JMXA 2ATJA 2WSSS 3M2DA 5CIHA 4JQJA 1CCJA 5SXSA 1ABVA 2YCGA 3ZCHA 3Q3UA 7ATJA 1MK8A 1HCHA 1ZBZA 5CJHA 4C51A 1YZRA 1CPFA 5JHXA 1H5EA 5SW6A 4JMZA 2GHDX 4JMBA 1AEVA 1LY8A 6CCPA 3WA8A 1H5HA 4BM4A 1U75A 3ATJA 5SW5A 1CCPA 1JCIA 3WXOA 4FEFA 3M2GA 5JQRA 1U2JA 1H5CA 4A71A 1AC8A 5SYJA 1H5DA 1BEQA 4JZAA 3FM6A 2VCSA 5SX0A 2EUUA 5SX1A 5JHYA 4ATJA 5SYLA 1BVAA 1AEFA 4A7MA 4JM8A 4USCA 1AESA 3CCXA 5ALAA 2AS4A 3M8MA 1AETA 2VNZX 1H55A 4NVGB 4U7UB 3EXBA 1CCIA 1YYDA 2RBVX 4CZQA 1YYGA 5FNEA 5AL9A 2Y5AA 5SX0B 1LYKA 2B10A 1CYFA 1CCLA 4NVKB 1KXMA 5SYHA 5KSKA 1FHFA 2V2EA 1ML2A 2XJ6A 5KQ3A 4NVDA 3CCPA 6ATJA 1SDQA
chains in the Genus database with same CATH topology
3M27A 1KRJA 1A2FA 4H79A 5SYKA 1AEBA 2AS1A 1H5IA 5SYXA 2BOQA 3FM1A 2WD4A 4XV5A 1QPAA 1BEPA 4PAEA 5AMMA 2CCDA 2B0ZA 1KXNA 1B80A 5JPRA 3VLLA 1ARXA 4A78A 5ABQA 1C8IA 1AEJA 1H5LA 1UB2A 2AS6A 5CIEA 2AS2A 5CD4J 2VNXX 4BLXA 1KOKA 5SW4A 3VLJA 1A2GA 1GW2A 5SYYA 4JN0A 1DJ1A 1SBMA 1H3JA 1DSGA 2VCNA 1H58A 2PCBA 2XI6A 2XJ8A 1S6VA 1U74A 3M2EA 5EJXA 4JM9A 4XV7A 1EBEA 1ITKA 5L05A 2GGNX 1H5GA 1CMQA 4NVMB 5ABNA 1ZBYA 2ZCAA 5ABOA 1H5AA 4FCNA 4XV4A 4JMTA 5KQ0A 4A5GA 1CCEA 1AA4A 3UT2A 4JQKA 3R98A 1W4YA 2EURA 4BLKA 4C50A 5CIGA 4CZRA 3VLKA 1LGAA 5SXXA 1CMTA 3M2IA 3VLIA 2AS3A 1ARPA 1CMUA 1U2KA 4JPUA 2RBZX 1JDRA 2EUNA 1AEOA 1MNPA 2E3AA 5KQIA 1CPDA 1AEDA 1S73A 1SJ2A 4A6ZA 2RC2X 4NVEA 2ICVA 5H9EB 4CUOA 1AEMA 1H5KA 5KQ2A 2XIHA 4BLZA 1DS4A 1MKRA 2CCAA 2VCFX 1GZBA 1AENA 4CZPA 1GWTA 4BM1A 1AEKA 4BLNA 3E2NA 1CK6A 5D6MA 2EUSA 4NVAA 1BEKA 2B11A 4JQNA 2RC0X 5FNBA 1BEMA 2XJ5A 4JQMA 2IA8A 1STQA 1CCCA 4CZOA 1DSPA 5SYWA 2CCPA 5SXQA 2YLJA 5SXRA 2EUOA 4JB4A 3M2BA 5SXTA 5AOGA 7CCPA 5SYVA 4P4QA 3FMUA 5SX3A 3RRWA 1ATJA 1GWOA 4JMWA 2RBTX 2EUQA 1GZAA 3M25A 3M2CA 5CCPA 5CICA 5SYIA 2E3BA 5CIFA 2AQDA 5KSFA 4BM2A 4QYZB 4CZNA 1Z53A 4CCXA 4JPTA 4NVJB 1B82A 2X08A 2W23A 5L86A 4NVFA 1OAGA 1HSRA 1ARWA 1BESA 5CIDA 1H5FA 4GEDA 3FJWA 1MKQA 1DSOA 5EJTA 2B12A 3ZCGA 1CCAA 4NVIB 1AEQA 2RC1X 4BM3A 2GHHX 2PCCA 5JHZA 2Y6BA 2VO2X 1CCGA 1AEUA 2CL4X 3WNUA 2RBUX 1RYCA 3M23A 1ARYA 2E39A 4JM6A 5SXWA 1AEEA 2CYPA 1GX2A 1CCBA 2RBYX 1B85A 3FKGA 4FCSA 4H7AA 2RBWX 4XV6A 1QO4A 2EUPA 1DSEA 3VLMA 3ZCYA 2BCNA 2JTIA 4CVJA 4BLYA 1PA2A 1MN2A 1SCHA 4NVLA 5KQKA 1BJ9A 1GWUA 4G05A 1OAFA 2EUTA 5SX6A 1AC4A 2GHEX 3M28A 4NVBA 4NVHB 4CVIA 4JMVA 1DJ5A 2XILA 4XV8A 3M26A 5H9FB 1W4WA 1SOGA 3M2HA 1KZMA 3X16A 1APXA 1U2LA 4JPLA 4BLLA 1MN1A 4JMSA 1H57A 3R99A 2GHCX 5KQ6A 4BM0A 3FM4A 3VLHA 1BEJA 5SYUA 5KQHA 2CEPA 1ARUA 1H5JA 4JM5A 4NFGA 3M29A 1H5MA 1V0HX 4CCPA 1CPEA 5SX2A 2ANZA 1LYCA 3HDLA 3E2OA 2V23A 3RIVA 4OQ7A 3M5QA 4JMAA 3M2FA 1CPGA 1YZPA 3M2AA 1LLPA 2GB8A 1AEGA 1AEHA 4NVOB 4NVCA 2Y6AA 4FDQA 4NVNB 2GHKX 5CIBA 5L02A 3UW8A 1CCKA 1CMPA 1IYNA 1BGPA 1QGJA 1LY9A 2RBXX 5SX7A 2XIFA 3RIWA 2X07A 2N18A 1ARVA 2VKAA 4XVAA 1DCCA 2ATJA 3M2DA 5CIHA 4JQJA 1CCJA 5SXSA 2YCGA 3ZCHA 3Q3UA 7ATJA 1MK8A 1HCHA 1ZBZA 5CJHA 4C51A 1YZRA 1CPFA 5JHXA 1H5EA 5SW6A 4JMZA 2GHDX 4JMBA 1AEVA 1LY8A 6CCPA 3WA8A 1H5HA 4BM4A 1U75A 3ATJA 5SW5A 1CCPA 1JCIA 3WXOA 4FEFA 3M2GA 5JQRA 1U2JA 1H5CA 4A71A 1AC8A 5SYJA 1H5DA 1BEQA 4JZAA 3FM6A 2VCSA 5SX0A 2EUUA 5SX1A 5JHYA 4ATJA 5SYLA 1BVAA 1AEFA 4A7MA 4JM8A 4USCA 1AESA 3CCXA 5ALAA 2AS4A 3M8MA 1AETA 2VNZX 1H55A 4NVGB 4U7UB 3EXBA 1CCIA 1YYDA 2RBVX 4CZQA 1YYGA 5FNEA 5AL9A 2Y5AA 5SX0B 1LYKA 2B10A 1CYFA 1CCLA 4NVKB 1KXMA 5SYHA 5KSKA 1FHFA 2V2EA 1ML2A 2XJ6A 5KQ3A 4NVDA 3CCPA 6ATJA 1SDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M27 A;  1KRJ A;  1A2F A;  5SYK A;  1AEB A;  2AS1 A;  1H5I A;  5SYX A;  2BOQ A;  3FM1 A;  2WD4 A;  4XV5 A;  1QPA A;  1BEP A;  4PAE A;  5AMM A;  2CCD A;  2B0Z A;  1KXN A;  1B80 A;  5JPR A;  3VLL A;  1ARX A;  4A78 A;  5ABQ A;  1C8I A;  1AEJ A;  1H5L A;  1UB2 A;  2AS6 A;  5CIE A;  2AS2 A;  2VNX X;  4BLX A;  1KOK A;  5SW4 A;  3VLJ A;  1A2G A;  1GW2 A;  5SYY A;  4JN0 A;  1DJ1 A;  1SBM A;  1H3J A;  1DSG A;  2VCN A;  1H58 A;  2PCB A;  2XI6 A;  2XJ8 A;  1S6V A;  1U74 A;  3M2E A;  5EJX A;  4JM9 A;  4XV7 A;  1EBE A;  1ITK A;  5L05 A;  2GGN X;  1H5G A;  1CMQ A;  4NVM B;  5ABN A;  1ZBY A;  5ABO A;  1H5A A;  4FCN A;  4XV4 A;  4JMT A;  5KQ0 A;  4A5G A;  1CCE A;  1AA4 A;  3UT2 A;  4JQK A;  3R98 A;  1W4Y A;  2EUR A;  4BLK A;  4C50 A;  5CIG A;  4CZR A;  3VLK A;  1LGA A;  5SXX A;  1CMT A;  3M2I A;  3VLI A;  2AS3 A;  1ARP A;  1CMU A;  1U2K A;  4JPU A;  2RBZ X;  1JDR A;  2EUN A;  1AEO A;  1MNP A;  2E3A A;  5KQI A;  1CPD A;  1AED A;  1S73 A;  1SJ2 A;  4A6Z A;  2RC2 X;  4NVE A;  2ICV A;  4CUO A;  1AEM A;  1H5K A;  5KQ2 A;  2XIH A;  4BLZ A;  1DS4 A;  1MKR A;  2CCA A;  2VCF X;  1GZB A;  1AEN A;  4CZP A;  1GWT A;  4BM1 A;  1AEK A;  4BLN A;  3E2N A;  1CK6 A;  5D6M A;  2EUS A;  4NVA A;  1BEK A;  2B11 A;  4JQN A;  2RC0 X;  5FNB A;  1BEM A;  2XJ5 A;  4JQM A;  2IA8 A;  1STQ A;  1CCC A;  4CZO A;  1DSP A;  5SYW A;  2CCP A;  5SXQ A;  2YLJ A;  5SXR A;  2EUO A;  4JB4 A;  3M2B A;  5SXT A;  5AOG A;  7CCP A;  5SYV A;  4P4Q A;  3FMU A;  5SX3 A;  3RRW A;  1ATJ A;  1GWO A;  4JMW A;  2RBT X;  2EUQ A;  1GZA A;  3M25 A;  3M2C A;  5CCP A;  5CIC A;  5SYI A;  2E3B A;  5CIF A;  2AQD A;  5KSF A;  4BM2 A;  4CZN A;  1Z53 A;  4CCX A;  4JPT A;  4NVJ B;  1B82 A;  2X08 A;  2W23 A;  5L86 A;  4NVF A;  1OAG A;  1HSR A;  1ARW A;  1BES A;  5CID A;  1H5F A;  4GED A;  3FJW A;  1MKQ A;  1DSO A;  5EJT A;  2B12 A;  3ZCG A;  1CCA A;  4NVI B;  1AEQ A;  2RC1 X;  4BM3 A;  2GHH X;  2PCC A;  5JHZ A;  2Y6B A;  2VO2 X;  1CCG A;  1AEU A;  2CL4 X;  3WNU A;  2RBU X;  1RYC A;  3M23 A;  1ARY A;  2E39 A;  4JM6 A;  5SXW A;  1AEE A;  2CYP A;  1GX2 A;  1CCB A;  2RBY X;  1B85 A;  3FKG A;  4FCS A;  2RBW X;  4XV6 A;  1QO4 A;  2EUP A;  1DSE A;  3VLM A;  3ZCY A;  2BCN A;  2JTI A;  4CVJ A;  4BLY A;  1PA2 A;  1MN2 A;  1SCH A;  4NVL A;  5KQK A;  1BJ9 A;  1GWU A;  4G05 A;  1OAF A;  2EUT A;  5SX6 A;  1AC4 A;  2GHE X;  3M28 A;  4NVB A;  4NVH B;  4CVI A;  4JMV A;  1DJ5 A;  2XIL A;  4XV8 A;  3M26 A;  1W4W A;  1SOG A;  3M2H A;  1KZM A;  3X16 A;  1APX A;  1U2L A;  4JPL A;  4BLL A;  1MN1 A;  4JMS A;  1H57 A;  3R99 A;  2GHC X;  5KQ6 A;  4BM0 A;  3FM4 A;  3VLH A;  1BEJ A;  5SYU A;  5KQH A;  2CEP A;  1ARU A;  1H5J A;  4JM5 A;  4NFG A;  3M29 A;  1H5M A;  1V0H X;  4CCP A;  1CPE A;  5SX2 A;  2ANZ A;  1LYC A;  3HDL A;  3E2O A;  2V23 A;  3RIV A;  4OQ7 A;  3M5Q A;  4JMA A;  3M2F A;  1CPG A;  1YZP A;  3M2A A;  1LLP A;  2GB8 A;  1AEG A;  1AEH A;  4NVO B;  4NVC A;  2Y6A A;  4FDQ A;  4NVN B;  2GHK X;  5CIB A;  5L02 A;  3UW8 A;  1CCK A;  1CMP A;  1IYN A;  1BGP A;  1QGJ A;  1LY9 A;  2RBX X;  5SX7 A;  2XIF A;  3RIW A;  2X07 A;  2N18 A;  1ARV A;  2VKA A;  4XVA A;  1DCC A;  2ATJ A;  3M2D A;  5CIH A;  4JQJ A;  1CCJ A;  5SXS A;  2YCG A;  3ZCH A;  3Q3U A;  7ATJ A;  1MK8 A;  1HCH A;  1ZBZ A;  5CJH A;  4C51 A;  1YZR A;  1CPF A;  5JHX A;  1H5E A;  5SW6 A;  4JMZ A;  2GHD X;  4JMB A;  1AEV A;  1LY8 A;  6CCP A;  1H5H A;  4BM4 A;  1U75 A;  3ATJ A;  5SW5 A;  1CCP A;  1JCI A;  3WXO A;  4FEF A;  3M2G A;  5JQR A;  1U2J A;  1H5C A;  4A71 A;  1AC8 A;  5SYJ A;  1H5D A;  1BEQ A;  3FM6 A;  2VCS A;  5SX0 A;  2EUU A;  5SX1 A;  5JHY A;  4ATJ A;  5SYL A;  1BVA A;  1AEF A;  4A7M A;  4JM8 A;  4USC A;  1AES A;  3CCX A;  5ALA A;  2AS4 A;  3M8M A;  1AET A;  2VNZ X;  1H55 A;  4NVG B;  3EXB A;  1CCI A;  1YYD A;  2RBV X;  4CZQ A;  1YYG A;  5FNE A;  5AL9 A;  2Y5A A;  5SX0 B;  1LYK A;  2B10 A;  1CYF A;  1CCL A;  4NVK B;  1KXM A;  5SYH A;  5KSK A;  1FHF A;  2V2E A;  1ML2 A;  2XJ6 A;  5KQ3 A;  4NVD A;  3CCP A;  6ATJ A;  1SDQ A; 
#chains in the Genus database with same CATH topology
 3M27 A;  1KRJ A;  1A2F A;  4H79 A;  5SYK A;  1AEB A;  2AS1 A;  1H5I A;  5SYX A;  2BOQ A;  3FM1 A;  2WD4 A;  4XV5 A;  1QPA A;  1BEP A;  4PAE A;  5AMM A;  2CCD A;  2B0Z A;  1KXN A;  1B80 A;  5JPR A;  3VLL A;  1ARX A;  4A78 A;  5ABQ A;  1C8I A;  1AEJ A;  1H5L A;  1UB2 A;  2AS6 A;  5CIE A;  2AS2 A;  5CD4 J;  2VNX X;  4BLX A;  1KOK A;  5SW4 A;  3VLJ A;  1A2G A;  1GW2 A;  5SYY A;  4JN0 A;  1DJ1 A;  1SBM A;  1H3J A;  1DSG A;  2VCN A;  1H58 A;  2PCB A;  2XI6 A;  2XJ8 A;  1S6V A;  1U74 A;  3M2E A;  5EJX A;  4JM9 A;  4XV7 A;  1EBE A;  1ITK A;  5L05 A;  2GGN X;  1H5G A;  1CMQ A;  4NVM B;  5ABN A;  1ZBY A;  2ZCA A;  5ABO A;  1H5A A;  4FCN A;  4XV4 A;  4JMT A;  5KQ0 A;  4A5G A;  1CCE A;  1AA4 A;  3UT2 A;  4JQK A;  3R98 A;  1W4Y A;  2EUR A;  4BLK A;  4C50 A;  5CIG A;  4CZR A;  3VLK A;  1LGA A;  5SXX A;  1CMT A;  3M2I A;  3VLI A;  2AS3 A;  1ARP A;  1CMU A;  1U2K A;  4JPU A;  2RBZ X;  1JDR A;  2EUN A;  1AEO A;  1MNP A;  2E3A A;  5KQI A;  1CPD A;  1AED A;  1S73 A;  1SJ2 A;  4A6Z A;  2RC2 X;  4NVE A;  2ICV A;  5H9E B;  4CUO A;  1AEM A;  1H5K A;  5KQ2 A;  2XIH A;  4BLZ A;  1DS4 A;  1MKR A;  2CCA A;  2VCF X;  1GZB A;  1AEN A;  4CZP A;  1GWT A;  4BM1 A;  1AEK A;  4BLN A;  3E2N A;  1CK6 A;  5D6M A;  2EUS A;  4NVA A;  1BEK A;  2B11 A;  4JQN A;  2RC0 X;  5FNB A;  1BEM A;  2XJ5 A;  4JQM A;  2IA8 A;  1STQ A;  1CCC A;  4CZO A;  1DSP A;  5SYW A;  2CCP A;  5SXQ A;  2YLJ A;  5SXR A;  2EUO A;  4JB4 A;  3M2B A;  5SXT A;  5AOG A;  7CCP A;  2BO5 A;  5SYV A;  4P4Q A;  3FMU A;  5SX3 A;  3RRW A;  1ATJ A;  1GWO A;  4JMW A;  2RBT X;  2EUQ A;  1GZA A;  3M25 A;  3M2C A;  5CCP A;  5CIC A;  5SYI A;  2E3B A;  5CIF A;  2AQD A;  5KSF A;  4BM2 A;  4QYZ B;  4CZN A;  1Z53 A;  4CCX A;  4JPT A;  4NVJ B;  1B82 A;  2X08 A;  2W23 A;  5L86 A;  4NVF A;  1OAG A;  1HSR A;  1ARW A;  1BES A;  5CID A;  1H5F A;  4GED A;  2A7U B;  3FJW A;  1MKQ A;  1DSO A;  5EJT A;  2B12 A;  3ZCG A;  1CCA A;  4NVI B;  4GKF A;  1AEQ A;  2RC1 X;  4BM3 A;  2GHH X;  2PCC A;  5JHZ A;  2Y6B A;  2VO2 X;  1CCG A;  1AEU A;  2CL4 X;  3WNU A;  2RBU X;  1RYC A;  3M23 A;  1ARY A;  2E39 A;  4JM6 A;  5SXW A;  1AEE A;  2CYP A;  2ZOP A;  1GX2 A;  1CCB A;  2RBY X;  1B85 A;  3FKG A;  4FCS A;  4H7A A;  2RBW X;  4XV6 A;  2OEB A;  1QO4 A;  2EUP A;  1DSE A;  3VLM A;  3ZCY A;  2BCN A;  2JTI A;  4CVJ A;  4BLY A;  1PA2 A;  1MN2 A;  1SCH A;  4NVL A;  5KQK A;  1BJ9 A;  1GWU A;  4G05 A;  1OAF A;  2EUT A;  5SX6 A;  1AC4 A;  2GHE X;  3M28 A;  4NVB A;  4NVH B;  4CVI A;  4JMV A;  1DJ5 A;  2XIL A;  4XV8 A;  3M26 A;  5H9F B;  1W4W A;  1SOG A;  3M2H A;  1KZM A;  3X16 A;  1APX A;  1U2L A;  4JPL A;  3X1L F;  4BLL A;  1MN1 A;  4JMS A;  1H57 A;  3R99 A;  2GHC X;  5KQ6 A;  4BM0 A;  3FM4 A;  3VLH A;  1BEJ A;  5SYU A;  5KQH A;  2CEP A;  1ARU A;  1H5J A;  4JM5 A;  4NFG A;  3M29 A;  1H5M A;  1V0H X;  4CCP A;  1CPE A;  5SX2 A;  2ANZ A;  1LYC A;  3HDL A;  3E2O A;  2V23 A;  3RIV A;  4OQ7 A;  3M5Q A;  4JMA A;  3M2F A;  1CPG A;  1YZP A;  3M2A A;  1LLP A;  2GB8 A;  1AEG A;  1AEH A;  4NVO B;  4NVC A;  2Y6A A;  4FDQ A;  4NVN B;  2GHK X;  5CIB A;  5L02 A;  3UW8 A;  1CCK A;  1CMP A;  1IYN A;  1BGP A;  1QGJ A;  1LY9 A;  2RBX X;  5SX7 A;  2XIF A;  3RIW A;  2X07 A;  2N18 A;  1ARV A;  2VKA A;  4XVA A;  1DCC A;  2JMX A;  2ATJ A;  2WSS S;  3M2D A;  5CIH A;  4JQJ A;  1CCJ A;  5SXS A;  1ABV A;  2YCG A;  3ZCH A;  3Q3U A;  7ATJ A;  1MK8 A;  1HCH A;  1ZBZ A;  5CJH A;  4C51 A;  1YZR A;  1CPF A;  5JHX A;  1H5E A;  5SW6 A;  4JMZ A;  2GHD X;  4JMB A;  1AEV A;  1LY8 A;  6CCP A;  3WA8 A;  1H5H A;  4BM4 A;  1U75 A;  3ATJ A;  5SW5 A;  1CCP A;  1JCI A;  3WXO A;  4FEF A;  3M2G A;  5JQR A;  1U2J A;  1H5C A;  4A71 A;  1AC8 A;  5SYJ A;  1H5D A;  1BEQ A;  4JZA A;  3FM6 A;  2VCS A;  5SX0 A;  2EUU A;  5SX1 A;  5JHY A;  4ATJ A;  5SYL A;  1BVA A;  1AEF A;  4A7M A;  4JM8 A;  4USC A;  1AES A;  3CCX A;  5ALA A;  2AS4 A;  3M8M A;  1AET A;  2VNZ X;  1H55 A;  4NVG B;  4U7U B;  3EXB A;  1CCI A;  1YYD A;  2RBV X;  4CZQ A;  1YYG A;  5FNE A;  5AL9 A;  2Y5A A;  5SX0 B;  1LYK A;  2B10 A;  1CYF A;  1CCL A;  4NVK B;  1KXM A;  5SYH A;  5KSK A;  1FHF A;  2V2E A;  1ML2 A;  2XJ6 A;  5KQ3 A;  4NVD A;  3CCP A;  6ATJ A;  1SDQ A; 
#chains in the Genus database with same CATH homology
 3M27 A;  1KRJ A;  1A2F A;  4H79 A;  5SYK A;  1AEB A;  2AS1 A;  1H5I A;  5SYX A;  2BOQ A;  3FM1 A;  2WD4 A;  4XV5 A;  1QPA A;  1BEP A;  4PAE A;  5AMM A;  2CCD A;  2B0Z A;  1KXN A;  1B80 A;  5JPR A;  3VLL A;  1ARX A;  4A78 A;  5ABQ A;  1C8I A;  1AEJ A;  1H5L A;  1UB2 A;  2AS6 A;  5CIE A;  2AS2 A;  5CD4 J;  2VNX X;  4BLX A;  1KOK A;  5SW4 A;  3VLJ A;  1A2G A;  1GW2 A;  5SYY A;  4JN0 A;  1DJ1 A;  1SBM A;  1H3J A;  1DSG A;  2VCN A;  1H58 A;  2PCB A;  2XI6 A;  2XJ8 A;  1S6V A;  1U74 A;  3M2E A;  5EJX A;  4JM9 A;  4XV7 A;  1EBE A;  1ITK A;  5L05 A;  2GGN X;  1H5G A;  1CMQ A;  4NVM B;  5ABN A;  1ZBY A;  2ZCA A;  5ABO A;  1H5A A;  4FCN A;  4XV4 A;  4JMT A;  5KQ0 A;  4A5G A;  1CCE A;  1AA4 A;  3UT2 A;  4JQK A;  3R98 A;  1W4Y A;  2EUR A;  4BLK A;  4C50 A;  5CIG A;  4CZR A;  3VLK A;  1LGA A;  5SXX A;  1CMT A;  3M2I A;  3VLI A;  2AS3 A;  1ARP A;  1CMU A;  1U2K A;  4JPU A;  2RBZ X;  1JDR A;  2EUN A;  1AEO A;  1MNP A;  2E3A A;  5KQI A;  1CPD A;  1AED A;  1S73 A;  1SJ2 A;  4A6Z A;  2RC2 X;  4NVE A;  2ICV A;  5H9E B;  4CUO A;  1AEM A;  1H5K A;  5KQ2 A;  2XIH A;  4BLZ A;  1DS4 A;  1MKR A;  2CCA A;  2VCF X;  1GZB A;  1AEN A;  4CZP A;  1GWT A;  4BM1 A;  1AEK A;  4BLN A;  3E2N A;  1CK6 A;  5D6M A;  2EUS A;  4NVA A;  1BEK A;  2B11 A;  4JQN A;  2RC0 X;  5FNB A;  1BEM A;  2XJ5 A;  4JQM A;  2IA8 A;  1STQ A;  1CCC A;  4CZO A;  1DSP A;  5SYW A;  2CCP A;  5SXQ A;  2YLJ A;  5SXR A;  2EUO A;  4JB4 A;  3M2B A;  5SXT A;  5AOG A;  7CCP A;  5SYV A;  4P4Q A;  3FMU A;  5SX3 A;  3RRW A;  1ATJ A;  1GWO A;  4JMW A;  2RBT X;  2EUQ A;  1GZA A;  3M25 A;  3M2C A;  5CCP A;  5CIC A;  5SYI A;  2E3B A;  5CIF A;  2AQD A;  5KSF A;  4BM2 A;  4QYZ B;  4CZN A;  1Z53 A;  4CCX A;  4JPT A;  4NVJ B;  1B82 A;  2X08 A;  2W23 A;  5L86 A;  4NVF A;  1OAG A;  1HSR A;  1ARW A;  1BES A;  5CID A;  1H5F A;  4GED A;  3FJW A;  1MKQ A;  1DSO A;  5EJT A;  2B12 A;  3ZCG A;  1CCA A;  4NVI B;  1AEQ A;  2RC1 X;  4BM3 A;  2GHH X;  2PCC A;  5JHZ A;  2Y6B A;  2VO2 X;  1CCG A;  1AEU A;  2CL4 X;  3WNU A;  2RBU X;  1RYC A;  3M23 A;  1ARY A;  2E39 A;  4JM6 A;  5SXW A;  1AEE A;  2CYP A;  1GX2 A;  1CCB A;  2RBY X;  1B85 A;  3FKG A;  4FCS A;  4H7A A;  2RBW X;  4XV6 A;  1QO4 A;  2EUP A;  1DSE A;  3VLM A;  3ZCY A;  2BCN A;  2JTI A;  4CVJ A;  4BLY A;  1PA2 A;  1MN2 A;  1SCH A;  4NVL A;  5KQK A;  1BJ9 A;  1GWU A;  4G05 A;  1OAF A;  2EUT A;  5SX6 A;  1AC4 A;  2GHE X;  3M28 A;  4NVB A;  4NVH B;  4CVI A;  4JMV A;  1DJ5 A;  2XIL A;  4XV8 A;  3M26 A;  5H9F B;  1W4W A;  1SOG A;  3M2H A;  1KZM A;  3X16 A;  1APX A;  1U2L A;  4JPL A;  4BLL A;  1MN1 A;  4JMS A;  1H57 A;  3R99 A;  2GHC X;  5KQ6 A;  4BM0 A;  3FM4 A;  3VLH A;  1BEJ A;  5SYU A;  5KQH A;  2CEP A;  1ARU A;  1H5J A;  4JM5 A;  4NFG A;  3M29 A;  1H5M A;  1V0H X;  4CCP A;  1CPE A;  5SX2 A;  2ANZ A;  1LYC A;  3HDL A;  3E2O A;  2V23 A;  3RIV A;  4OQ7 A;  3M5Q A;  4JMA A;  3M2F A;  1CPG A;  1YZP A;  3M2A A;  1LLP A;  2GB8 A;  1AEG A;  1AEH A;  4NVO B;  4NVC A;  2Y6A A;  4FDQ A;  4NVN B;  2GHK X;  5CIB A;  5L02 A;  3UW8 A;  1CCK A;  1CMP A;  1IYN A;  1BGP A;  1QGJ A;  1LY9 A;  2RBX X;  5SX7 A;  2XIF A;  3RIW A;  2X07 A;  2N18 A;  1ARV A;  2VKA A;  4XVA A;  1DCC A;  2ATJ A;  3M2D A;  5CIH A;  4JQJ A;  1CCJ A;  5SXS A;  2YCG A;  3ZCH A;  3Q3U A;  7ATJ A;  1MK8 A;  1HCH A;  1ZBZ A;  5CJH A;  4C51 A;  1YZR A;  1CPF A;  5JHX A;  1H5E A;  5SW6 A;  4JMZ A;  2GHD X;  4JMB A;  1AEV A;  1LY8 A;  6CCP A;  3WA8 A;  1H5H A;  4BM4 A;  1U75 A;  3ATJ A;  5SW5 A;  1CCP A;  1JCI A;  3WXO A;  4FEF A;  3M2G A;  5JQR A;  1U2J A;  1H5C A;  4A71 A;  1AC8 A;  5SYJ A;  1H5D A;  1BEQ A;  4JZA A;  3FM6 A;  2VCS A;  5SX0 A;  2EUU A;  5SX1 A;  5JHY A;  4ATJ A;  5SYL A;  1BVA A;  1AEF A;  4A7M A;  4JM8 A;  4USC A;  1AES A;  3CCX A;  5ALA A;  2AS4 A;  3M8M A;  1AET A;  2VNZ X;  1H55 A;  4NVG B;  4U7U B;  3EXB A;  1CCI A;  1YYD A;  2RBV X;  4CZQ A;  1YYG A;  5FNE A;  5AL9 A;  2Y5A A;  5SX0 B;  1LYK A;  2B10 A;  1CYF A;  1CCL A;  4NVK B;  1KXM A;  5SYH A;  5KSK A;  1FHF A;  2V2E A;  1ML2 A;  2XJ6 A;  5KQ3 A;  4NVD A;  3CCP A;  6ATJ A;  1SDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...