4BQTA

Aplysia californica achbp in complex with cytisine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
b'QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structural Characterization of Binding Mode of Smoking Cessation Drugs to Nicotinic Acetylcholine Receptors Through Study of Ligand Complexes with Acetylcholine-Binding Protein.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 48
structure length 206
sequence length 206
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4bqtA00
5AFNA 5J5FA 4WV9A 3IGQA 4TWFA 3WTOA 4X5TA 3U8LA 4UM1A 5HEOA 5AFKA 2XNTA 4ZR6A 1UX2A 3EHZA 3RQWA 4AFGA 3JAFA 4ZJTA 2X00A 3UU6A 5TVCA 3WTIA 5AFLA 2BR8A 2Y57A 2UZ6A 4IL4A 4HFBA 3UU5A 2WZYA 3ZKRA 5BW2A 3GUAA 4TNWA 5HCJA 5BRXA 4HQPA 4Z91A 5L47A 5BP0A 3WTKA 3P50A 2W8FA 2YKSA 3JAEA 5FJVA 5J5GA 2W8GA 2BYQA 4B5DA 4LMKA 4QACA 4ZZBA 3SIOA 2WN9A 5AFMB 4BFQA 2XZ6A 5JMEA 5HEUA 4ZK4A 5L4HA 3UQ7A 2BG9B 2XQ4A 2XQAA 4HFCA 2PH9A 3WTHA 2XYSA 2XQ6A 4PIRA 2Y54A 2YMEA 4ALXA 5IUXA 3RQUA 2XNVA 3UU3A 4ILBA 4QH5A 2BG9C 4XK9A 4UM3A 3RIFA 4DBMA 2BYPA 3SH1A 5J5HA 2Y7YA 3PMZA 2C9TA 2QC1B 3TLVA 4Z90A 2ZJUA 5AFJA 4AFHA 4QH4A 2WNCA 2VL0A 4QAAA 5AINA 3U8MA 2YN6A 5HEGA 3U8NA 2Y58A 4UM3S 4TWDA 4UM3P 3C79A 4UXUA 4HFEA 3UU4A 5AFMA 3T4MA 1UV6A 2BG9A 3LSVA 3UUBA 3WTNA 2WNJA 5SYOA 4LMJA 4A98A 3ZDGA 5HEHA 4AFTA 3WIPA 4HFHA 3UU8A 5AFHA 5KZUA 3U8JA 4EZ1A 5HEJA 3WTJA 5J5IA 3PEOA 3SQ9A 4ILAA 4D01A 3TLWA 4HFIA 2X00D 5LG3A 4TWHA 4NPPA 4QH1A 2XNUA 2PGZA 3U8KA 3JADA 4ZZCA 3TLUA 3TLTA 2XQ5A 2XQ8A 3WTMA 2WNLA 5KE4A 4ILCA 4ZRUA 2BJ0A 2BYNA 4ZJSA 3UQ4A 4HFDA 5CFBA 3EAMA 4QABA 3ZDHA 3TLSA 3RIAA 2XQ9A 4COFA 3RI5A 2BG9E 4UY2A 4FRRA 4NZBA 2BYSA 4TNVA 3P4WA 2BYRA 4IREA 2XQ3A 4IL9A 4LMLA 3WTLA 3SQ6A 4ZK1A 5CO5A 5HCMA 3EI0A 5LXBA 1UW6A 5J0ZA 2XYTA 2ZJVA 2YMDA 4A97A 4XHEA 5L4EA 2YOEA 3C84A 4BQTA 1I9BA 2XZ5A 2BR7A 3RHWA 2Y56A 4F8HA 2XQ7A
chains in the Genus database with same CATH superfamily
5AFNA 5J5FA 4WV9A 3IGQA 4TWFA 3WTOA 4X5TA 3U8LA 4UM1A 5HEOA 5AFKA 2XNTA 4ZR6A 1UX2A 3EHZA 3RQWA 4AFGA 3JAFA 4ZJTA 2X00A 3UU6A 5TVCA 3WTIA 5AFLA 2BR8A 2Y57A 2UZ6A 4IL4A 4HFBA 3UU5A 2WZYA 3ZKRA 5BW2A 3GUAA 4TNWA 5HCJA 5BRXA 4HQPA 4Z91A 5L47A 5BP0A 3WTKA 3P50A 2W8FA 2YKSA 3JAEA 5FJVA 5J5GA 2W8GA 2BYQA 4B5DA 4LMKA 4QACA 4ZZBA 3SIOA 2WN9A 5AFMB 4BFQA 2XZ6A 5JMEA 5HEUA 4ZK4A 5L4HA 3UQ7A 2BG9B 2XQ4A 2XQAA 4HFCA 2PH9A 3WTHA 2XYSA 2XQ6A 4PIRA 2Y54A 2YMEA 4ALXA 5IUXA 3RQUA 2XNVA 3UU3A 4ILBA 4QH5A 2BG9C 4XK9A 4UM3A 3RIFA 4DBMA 2BYPA 3SH1A 5J5HA 2Y7YA 3PMZA 2C9TA 2QC1B 3TLVA 4Z90A 2ZJUA 5AFJA 4AFHA 4QH4A 2WNCA 2VL0A 4QAAA 5AINA 3U8MA 2YN6A 5HEGA 3U8NA 2Y58A 4UM3S 4TWDA 4UM3P 3C79A 4UXUA 4HFEA 3UU4A 5AFMA 3T4MA 1UV6A 2BG9A 3LSVA 3UUBA 3WTNA 2WNJA 5SYOA 4LMJA 4A98A 3ZDGA 5HEHA 4AFTA 3WIPA 4HFHA 3UU8A 5AFHA 5KZUA 3U8JA 4EZ1A 5HEJA 3WTJA 5J5IA 3PEOA 3SQ9A 4ILAA 4D01A 3TLWA 4HFIA 2X00D 5LG3A 4TWHA 4NPPA 4QH1A 2XNUA 2PGZA 3U8KA 3JADA 4ZZCA 3TLUA 3TLTA 2XQ5A 2XQ8A 3WTMA 2WNLA 5KE4A 4ILCA 4ZRUA 2BJ0A 2BYNA 4ZJSA 3UQ4A 4HFDA 5CFBA 3EAMA 4QABA 3ZDHA 3TLSA 3RIAA 2XQ9A 4COFA 3RI5A 2BG9E 4UY2A 4FRRA 4NZBA 2BYSA 4TNVA 3P4WA 2BYRA 4IREA 2XQ3A 4IL9A 4LMLA 3WTLA 3SQ6A 4ZK1A 5CO5A 5HCMA 3EI0A 5LXBA 1UW6A 5J0ZA 2XYTA 2ZJVA 2YMDA 4A97A 4XHEA 5L4EA 2YOEA 3C84A 4BQTA 1I9BA 2XZ5A 2BR7A 3RHWA 2Y56A 4F8HA 2XQ7A
chains in the Genus database with same CATH topology
5AFNA 5J5FA 4WV9A 3IGQA 4TWFA 3WTOA 4X5TA 3U8LA 4UM1A 5HEOA 5AFKA 2XNTA 4ZR6A 1UX2A 3EHZA 3RQWA 4AFGA 3JAFA 4ZJTA 2X00A 3UU6A 5TVCA 3WTIA 5AFLA 2BR8A 2Y57A 2UZ6A 4IL4A 4HFBA 3UU5A 2WZYA 3ZKRA 5BW2A 3GUAA 4TNWA 5HCJA 5BRXA 4HQPA 4Z91A 5L47A 5BP0A 3WTKA 3P50A 2W8FA 2YKSA 3JAEA 5FJVA 5J5GA 2W8GA 2BYQA 4B5DA 4LMKA 4QACA 4ZZBA 3SIOA 2WN9A 5AFMB 4BFQA 2XZ6A 5JMEA 5HEUA 4ZK4A 5L4HA 3UQ7A 2BG9B 2XQ4A 2XQAA 4HFCA 2PH9A 3WTHA 2XYSA 2XQ6A 4PIRA 2Y54A 2YMEA 4ALXA 5IUXA 3RQUA 2XNVA 3UU3A 4ILBA 4QH5A 2BG9C 4XK9A 4UM3A 3RIFA 4DBMA 2BYPA 3SH1A 5J5HA 2Y7YA 3PMZA 2C9TA 2QC1B 3TLVA 4Z90A 2ZJUA 5AFJA 4AFHA 4QH4A 2WNCA 2VL0A 4QAAA 5AINA 3U8MA 2YN6A 5HEGA 3U8NA 2Y58A 4UM3S 4TWDA 4UM3P 3C79A 4UXUA 4HFEA 3UU4A 5AFMA 3T4MA 1UV6A 2BG9A 3LSVA 3UUBA 3WTNA 2WNJA 5SYOA 4LMJA 4A98A 3ZDGA 5HEHA 4AFTA 3WIPA 4HFHA 3UU8A 5AFHA 5KZUA 3U8JA 4EZ1A 5HEJA 3WTJA 5J5IA 3PEOA 3SQ9A 4ILAA 4D01A 3TLWA 4HFIA 2X00D 5LG3A 4TWHA 4NPPA 4QH1A 2XNUA 2PGZA 3U8KA 3JADA 4ZZCA 3TLUA 3TLTA 2XQ5A 2XQ8A 3WTMA 2WNLA 5KE4A 4ILCA 4ZRUA 2BJ0A 2BYNA 4ZJSA 3UQ4A 4HFDA 5CFBA 3EAMA 4QABA 3ZDHA 3TLSA 3RIAA 2XQ9A 4COFA 3RI5A 2BG9E 4UY2A 4FRRA 4NZBA 2BYSA 4TNVA 3P4WA 2BYRA 4IREA 2XQ3A 4IL9A 4LMLA 3WTLA 3SQ6A 4ZK1A 5CO5A 5HCMA 3EI0A 5LXBA 1UW6A 5J0ZA 2XYTA 2ZJVA 2YMDA 4A97A 4XHEA 5L4EA 2YOEA 3C84A 4BQTA 1I9BA 2XZ5A 2BR7A 3RHWA 2Y56A 4F8HA 2XQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFN A;  5J5F A;  4WV9 A;  3IGQ A;  4TWF A;  3WTO A;  4X5T A;  3U8L A;  4UM1 A;  5HEO A;  5AFK A;  2XNT A;  4ZR6 A;  1UX2 A;  3EHZ A;  3RQW A;  4AFG A;  3JAF A;  4ZJT A;  2X00 A;  3UU6 A;  5TVC A;  3WTI A;  5AFL A;  2BR8 A;  2Y57 A;  2UZ6 A;  4IL4 A;  4HFB A;  3UU5 A;  2WZY A;  3ZKR A;  5BW2 A;  3GUA A;  4TNW A;  5HCJ A;  5BRX A;  4HQP A;  4Z91 A;  5L47 A;  5BP0 A;  3WTK A;  3P50 A;  2W8F A;  2YKS A;  3JAE A;  5FJV A;  5J5G A;  2W8G A;  2BYQ A;  4B5D A;  4LMK A;  4QAC A;  4ZZB A;  3SIO A;  2WN9 A;  5AFM B;  4BFQ A;  2XZ6 A;  5JME A;  5HEU A;  4ZK4 A;  5L4H A;  3UQ7 A;  2BG9 B;  2XQ4 A;  2XQA A;  4HFC A;  2PH9 A;  3WTH A;  2XYS A;  2XQ6 A;  4PIR A;  2Y54 A;  2YME A;  4ALX A;  5IUX A;  3RQU A;  2XNV A;  3UU3 A;  4ILB A;  4QH5 A;  2BG9 C;  4XK9 A;  4UM3 A;  3RIF A;  4DBM A;  2BYP A;  3SH1 A;  5J5H A;  2Y7Y A;  3PMZ A;  2C9T A;  2QC1 B;  3TLV A;  4Z90 A;  2ZJU A;  5AFJ A;  4AFH A;  4QH4 A;  2WNC A;  2VL0 A;  4QAA A;  5AIN A;  3U8M A;  2YN6 A;  5HEG A;  3U8N A;  2Y58 A;  4UM3 S;  4TWD A;  4UM3 P;  3C79 A;  4UXU A;  4HFE A;  3UU4 A;  5AFM A;  3T4M A;  1UV6 A;  2BG9 A;  3LSV A;  3UUB A;  3WTN A;  2WNJ A;  5SYO A;  4LMJ A;  4A98 A;  3ZDG A;  5HEH A;  4AFT A;  3WIP A;  4HFH A;  3UU8 A;  5AFH A;  5KZU A;  3U8J A;  4EZ1 A;  5HEJ A;  3WTJ A;  5J5I A;  3PEO A;  3SQ9 A;  4ILA A;  4D01 A;  3TLW A;  4HFI A;  2X00 D;  5LG3 A;  4TWH A;  4NPP A;  4QH1 A;  2XNU A;  2PGZ A;  3U8K A;  3JAD A;  4ZZC A;  3TLU A;  3TLT A;  2XQ5 A;  2XQ8 A;  3WTM A;  2WNL A;  5KE4 A;  4ILC A;  4ZRU A;  2BJ0 A;  2BYN A;  4ZJS A;  3UQ4 A;  4HFD A;  5CFB A;  3EAM A;  4QAB A;  3ZDH A;  3TLS A;  3RIA A;  2XQ9 A;  4COF A;  3RI5 A;  2BG9 E;  4UY2 A;  4FRR A;  4NZB A;  2BYS A;  4TNV A;  3P4W A;  2BYR A;  4IRE A;  2XQ3 A;  4IL9 A;  4LML A;  3WTL A;  3SQ6 A;  4ZK1 A;  5CO5 A;  5HCM A;  3EI0 A;  5LXB A;  1UW6 A;  5J0Z A;  2XYT A;  2ZJV A;  2YMD A;  4A97 A;  4XHE A;  5L4E A;  2YOE A;  3C84 A;  4BQT A;  1I9B A;  2XZ5 A;  2BR7 A;  3RHW A;  2Y56 A;  4F8H A;  2XQ7 A; 
#chains in the Genus database with same CATH topology
 5AFN A;  5J5F A;  4WV9 A;  3IGQ A;  4TWF A;  3WTO A;  4X5T A;  3U8L A;  4UM1 A;  5HEO A;  5AFK A;  2XNT A;  4ZR6 A;  1UX2 A;  3EHZ A;  3RQW A;  4AFG A;  3JAF A;  4ZJT A;  2X00 A;  3UU6 A;  5TVC A;  3WTI A;  5AFL A;  2BR8 A;  2Y57 A;  2UZ6 A;  4IL4 A;  4HFB A;  3UU5 A;  2WZY A;  3ZKR A;  5BW2 A;  3GUA A;  4TNW A;  5HCJ A;  5BRX A;  4HQP A;  4Z91 A;  5L47 A;  5BP0 A;  3WTK A;  3P50 A;  2W8F A;  2YKS A;  3JAE A;  5FJV A;  5J5G A;  2W8G A;  2BYQ A;  4B5D A;  4LMK A;  4QAC A;  4ZZB A;  3SIO A;  2WN9 A;  5AFM B;  4BFQ A;  2XZ6 A;  5JME A;  5HEU A;  4ZK4 A;  5L4H A;  3UQ7 A;  2BG9 B;  2XQ4 A;  2XQA A;  4HFC A;  2PH9 A;  3WTH A;  2XYS A;  2XQ6 A;  4PIR A;  2Y54 A;  2YME A;  4ALX A;  5IUX A;  3RQU A;  2XNV A;  3UU3 A;  4ILB A;  4QH5 A;  2BG9 C;  4XK9 A;  4UM3 A;  3RIF A;  4DBM A;  2BYP A;  3SH1 A;  5J5H A;  2Y7Y A;  3PMZ A;  2C9T A;  2QC1 B;  3TLV A;  4Z90 A;  2ZJU A;  5AFJ A;  4AFH A;  4QH4 A;  2WNC A;  2VL0 A;  4QAA A;  5AIN A;  3U8M A;  2YN6 A;  5HEG A;  3U8N A;  2Y58 A;  4UM3 S;  4TWD A;  4UM3 P;  3C79 A;  4UXU A;  4HFE A;  3UU4 A;  5AFM A;  3T4M A;  1UV6 A;  2BG9 A;  3LSV A;  3UUB A;  3WTN A;  2WNJ A;  5SYO A;  4LMJ A;  4A98 A;  3ZDG A;  5HEH A;  4AFT A;  3WIP A;  4HFH A;  3UU8 A;  5AFH A;  5KZU A;  3U8J A;  4EZ1 A;  5HEJ A;  3WTJ A;  5J5I A;  3PEO A;  3SQ9 A;  4ILA A;  4D01 A;  3TLW A;  4HFI A;  2X00 D;  5LG3 A;  4TWH A;  4NPP A;  4QH1 A;  2XNU A;  2PGZ A;  3U8K A;  3JAD A;  4ZZC A;  3TLU A;  3TLT A;  2XQ5 A;  2XQ8 A;  3WTM A;  2WNL A;  5KE4 A;  4ILC A;  4ZRU A;  2BJ0 A;  2BYN A;  4ZJS A;  3UQ4 A;  4HFD A;  5CFB A;  3EAM A;  4QAB A;  3ZDH A;  3TLS A;  3RIA A;  2XQ9 A;  4COF A;  3RI5 A;  2BG9 E;  4UY2 A;  4FRR A;  4NZB A;  2BYS A;  4TNV A;  3P4W A;  2BYR A;  4IRE A;  2XQ3 A;  4IL9 A;  4LML A;  3WTL A;  3SQ6 A;  4ZK1 A;  5CO5 A;  5HCM A;  3EI0 A;  5LXB A;  1UW6 A;  5J0Z A;  2XYT A;  2ZJV A;  2YMD A;  4A97 A;  4XHE A;  5L4E A;  2YOE A;  3C84 A;  4BQT A;  1I9B A;  2XZ5 A;  2BR7 A;  3RHW A;  2Y56 A;  4F8H A;  2XQ7 A; 
#chains in the Genus database with same CATH homology
 5AFN A;  5J5F A;  4WV9 A;  3IGQ A;  4TWF A;  3WTO A;  4X5T A;  3U8L A;  4UM1 A;  5HEO A;  5AFK A;  2XNT A;  4ZR6 A;  1UX2 A;  3EHZ A;  3RQW A;  4AFG A;  3JAF A;  4ZJT A;  2X00 A;  3UU6 A;  5TVC A;  3WTI A;  5AFL A;  2BR8 A;  2Y57 A;  2UZ6 A;  4IL4 A;  4HFB A;  3UU5 A;  2WZY A;  3ZKR A;  5BW2 A;  3GUA A;  4TNW A;  5HCJ A;  5BRX A;  4HQP A;  4Z91 A;  5L47 A;  5BP0 A;  3WTK A;  3P50 A;  2W8F A;  2YKS A;  3JAE A;  5FJV A;  5J5G A;  2W8G A;  2BYQ A;  4B5D A;  4LMK A;  4QAC A;  4ZZB A;  3SIO A;  2WN9 A;  5AFM B;  4BFQ A;  2XZ6 A;  5JME A;  5HEU A;  4ZK4 A;  5L4H A;  3UQ7 A;  2BG9 B;  2XQ4 A;  2XQA A;  4HFC A;  2PH9 A;  3WTH A;  2XYS A;  2XQ6 A;  4PIR A;  2Y54 A;  2YME A;  4ALX A;  5IUX A;  3RQU A;  2XNV A;  3UU3 A;  4ILB A;  4QH5 A;  2BG9 C;  4XK9 A;  4UM3 A;  3RIF A;  4DBM A;  2BYP A;  3SH1 A;  5J5H A;  2Y7Y A;  3PMZ A;  2C9T A;  2QC1 B;  3TLV A;  4Z90 A;  2ZJU A;  5AFJ A;  4AFH A;  4QH4 A;  2WNC A;  2VL0 A;  4QAA A;  5AIN A;  3U8M A;  2YN6 A;  5HEG A;  3U8N A;  2Y58 A;  4UM3 S;  4TWD A;  4UM3 P;  3C79 A;  4UXU A;  4HFE A;  3UU4 A;  5AFM A;  3T4M A;  1UV6 A;  2BG9 A;  3LSV A;  3UUB A;  3WTN A;  2WNJ A;  5SYO A;  4LMJ A;  4A98 A;  3ZDG A;  5HEH A;  4AFT A;  3WIP A;  4HFH A;  3UU8 A;  5AFH A;  5KZU A;  3U8J A;  4EZ1 A;  5HEJ A;  3WTJ A;  5J5I A;  3PEO A;  3SQ9 A;  4ILA A;  4D01 A;  3TLW A;  4HFI A;  2X00 D;  5LG3 A;  4TWH A;  4NPP A;  4QH1 A;  2XNU A;  2PGZ A;  3U8K A;  3JAD A;  4ZZC A;  3TLU A;  3TLT A;  2XQ5 A;  2XQ8 A;  3WTM A;  2WNL A;  5KE4 A;  4ILC A;  4ZRU A;  2BJ0 A;  2BYN A;  4ZJS A;  3UQ4 A;  4HFD A;  5CFB A;  3EAM A;  4QAB A;  3ZDH A;  3TLS A;  3RIA A;  2XQ9 A;  4COF A;  3RI5 A;  2BG9 E;  4UY2 A;  4FRR A;  4NZB A;  2BYS A;  4TNV A;  3P4W A;  2BYR A;  4IRE A;  2XQ3 A;  4IL9 A;  4LML A;  3WTL A;  3SQ6 A;  4ZK1 A;  5CO5 A;  5HCM A;  3EI0 A;  5LXB A;  1UW6 A;  5J0Z A;  2XYT A;  2ZJV A;  2YMD A;  4A97 A;  4XHE A;  5L4E A;  2YOE A;  3C84 A;  4BQT A;  1I9B A;  2XZ5 A;  2BR7 A;  3RHW A;  2Y56 A;  4F8H A;  2XQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...