4BQTA

Aplysia californica achbp in complex with cytisine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Binding Mode of Smoking Cessation Drugs to Nicotinic Acetylcholine Receptors Through Study of Ligand Complexes with Acetylcholine-Binding Protein.
pubmed doi rcsb
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
molecule tags Receptor
source organism Aplysia californica
total genus 48
structure length 206
sequence length 206
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4bqtA00
4LMJA 1UV6A 5LG3A 2XNUA 4AFGA 4ZZCA 3P50A 2XYTA 3WTHA 2BR8A 3ZKRA 2BYQA 4QH4A 5J5IA 3GUAA 4ZK1A 2UZ6A 2YMDA 3EHZA 4UM3A 5HEUA 2WNJA 4HFHA 3WTLA 3WTIA 4UM3P 4IREA 4TWFA 4ILCA 4A97A 3RIAA 5L4HA 2BYRA 4NZBA 3UU6A 3SQ9A 2XQ4A 5HEHA 2YMEA 2Y7YA 3U8KA 4AFTA 5AFNA 5BW2A 5AFMB 3WTKA 3ZDHA 2WNCA 2XNTA 3EI0A 4UY2A 4F8HA 2X00A 4A98A 2PGZA 5HEOA 5J5GA 5KE4A 3RIFA 3UU4A 4ILAA 4QAAA 4HFCA 3UU5A 4Z90A 1UW6A 4EZ1A 4HQPA 5CFBA 5L4EA 5HCJA 4FRRA 4Z91A 5AFMA 4QACA 2C9TA 2BYSA 4HFBA 2BYNA 4IL4A 2BG9B 3T4MA 4UM3S 5HEGA 3TLTA 4UXUA 2X00D 4ZZBA 5SYOA 3JADA 3U8JA 2Y54A 3UQ7A 2Y56A 3UUBA 3C84A 4TWDA 4XK9A 4LMLA 2BG9C 2ZJUA 1I9BA 3JAFA 4ILBA 3UU8A 3TLWA 5AFJA 2BJ0A 2BR7A 3RQUA 5AFHA 2BG9A 5TVCA 3JAEA 3SH1A 4BFQA 4COFA 5L47A 2XZ6A 4BQTA 4WV9A 5FJVA 3EAMA 5KZUA 4HFIA 5AINA 3IGQA 5J5HA 1UX2A 3TLVA 3PMZA 5HCMA 2XNVA 2XQ8A 3RHWA 2VL0A 2XQ5A 3U8LA 4ZJTA 5BRXA 5CO5A 4B5DA 2WZYA 5BP0A 2QC1B 2W8FA 2XQAA 4ZK4A 4TNWA 2XQ7A 4UM1A 2BG9E 5LXBA 3LSVA 3P4WA 4ZR6A 3TLUA 4ZRUA 3RQWA 3WTJA 2XQ9A 2XZ5A 4LMKA 4QABA 2Y57A 3U8MA 3UU3A 3WIPA 2YKSA 3WTOA 5J5FA 5HEJA 4ZJSA 2YOEA 2XQ3A 4AFHA 2XYSA 4NPPA 3U8NA 3WTNA 5AFLA 5AFKA 2XQ6A 2Y58A 3PEOA 3TLSA 2W8GA 3SQ6A 4QH5A 3RI5A 2BYPA 4ALXA 3C79A 2PH9A 4HFEA 5J0ZA 3ZDGA 4QH1A 5JMEA 3WTMA 3SIOA 2ZJVA 4TNVA 4XHEA 2YN6A 2WN9A 2WNLA 4X5TA 3UQ4A 4IL9A 4TWHA 4D01A 4HFDA 5IUXA 4DBMA 4PIRA
chains in the Genus database with same CATH superfamily
4LMJA 1UV6A 5LG3A 2XNUA 4AFGA 4ZZCA 3P50A 2XYTA 3WTHA 2BR8A 3ZKRA 2BYQA 4QH4A 5J5IA 3GUAA 4ZK1A 2UZ6A 2YMDA 3EHZA 4UM3A 5HEUA 2WNJA 4HFHA 3WTLA 3WTIA 4UM3P 4IREA 4TWFA 4ILCA 4A97A 3RIAA 5L4HA 2BYRA 4NZBA 3UU6A 3SQ9A 2XQ4A 5HEHA 2YMEA 2Y7YA 3U8KA 4AFTA 5AFNA 5BW2A 5AFMB 3WTKA 3ZDHA 2WNCA 2XNTA 3EI0A 4UY2A 4F8HA 2X00A 4A98A 2PGZA 5HEOA 5J5GA 5KE4A 3RIFA 3UU4A 4ILAA 4QAAA 4HFCA 3UU5A 4Z90A 1UW6A 4EZ1A 4HQPA 5CFBA 5L4EA 5HCJA 4FRRA 4Z91A 5AFMA 4QACA 2C9TA 2BYSA 4HFBA 2BYNA 4IL4A 2BG9B 3T4MA 4UM3S 5HEGA 3TLTA 4UXUA 2X00D 4ZZBA 5SYOA 3JADA 3U8JA 2Y54A 3UQ7A 2Y56A 3UUBA 3C84A 4TWDA 4XK9A 4LMLA 2BG9C 2ZJUA 1I9BA 3JAFA 4ILBA 3UU8A 3TLWA 5AFJA 2BJ0A 2BR7A 3RQUA 5AFHA 2BG9A 5TVCA 3JAEA 3SH1A 4BFQA 4COFA 5L47A 2XZ6A 4BQTA 4WV9A 5FJVA 3EAMA 5KZUA 4HFIA 5AINA 3IGQA 5J5HA 1UX2A 3TLVA 3PMZA 5HCMA 2XNVA 2XQ8A 3RHWA 2VL0A 2XQ5A 3U8LA 4ZJTA 5BRXA 5CO5A 4B5DA 2WZYA 5BP0A 2QC1B 2W8FA 2XQAA 4ZK4A 4TNWA 2XQ7A 4UM1A 2BG9E 5LXBA 3LSVA 3P4WA 4ZR6A 3TLUA 4ZRUA 3RQWA 3WTJA 2XQ9A 2XZ5A 4LMKA 4QABA 2Y57A 3U8MA 3UU3A 3WIPA 2YKSA 3WTOA 5J5FA 5HEJA 4ZJSA 2YOEA 2XQ3A 4AFHA 2XYSA 4NPPA 3U8NA 3WTNA 5AFLA 5AFKA 2XQ6A 2Y58A 3PEOA 3TLSA 2W8GA 3SQ6A 4QH5A 3RI5A 2BYPA 4ALXA 3C79A 2PH9A 4HFEA 5J0ZA 3ZDGA 4QH1A 5JMEA 3WTMA 3SIOA 2ZJVA 4TNVA 4XHEA 2YN6A 2WN9A 2WNLA 4X5TA 3UQ4A 4IL9A 4TWHA 4D01A 4HFDA 5IUXA 4DBMA 4PIRA
chains in the Genus database with same CATH topology
4LMJA 1UV6A 5LG3A 2XNUA 4AFGA 4ZZCA 3P50A 2XYTA 3WTHA 2BR8A 3ZKRA 2BYQA 4QH4A 5J5IA 3GUAA 4ZK1A 2UZ6A 2YMDA 3EHZA 4UM3A 5HEUA 2WNJA 4HFHA 3WTLA 3WTIA 4UM3P 4IREA 4TWFA 4ILCA 4A97A 3RIAA 5L4HA 2BYRA 4NZBA 3UU6A 3SQ9A 2XQ4A 5HEHA 2YMEA 2Y7YA 3U8KA 4AFTA 5AFNA 5BW2A 5AFMB 3WTKA 3ZDHA 2WNCA 2XNTA 3EI0A 4UY2A 4F8HA 2X00A 4A98A 2PGZA 5HEOA 5J5GA 5KE4A 3RIFA 3UU4A 4ILAA 4QAAA 4HFCA 3UU5A 4Z90A 1UW6A 4EZ1A 4HQPA 5CFBA 5L4EA 5HCJA 4FRRA 4Z91A 5AFMA 4QACA 2C9TA 2BYSA 4HFBA 2BYNA 4IL4A 2BG9B 3T4MA 4UM3S 5HEGA 3TLTA 4UXUA 2X00D 4ZZBA 5SYOA 3JADA 3U8JA 2Y54A 3UQ7A 2Y56A 3UUBA 3C84A 4TWDA 4XK9A 4LMLA 2BG9C 2ZJUA 1I9BA 3JAFA 4ILBA 3UU8A 3TLWA 5AFJA 2BJ0A 2BR7A 3RQUA 5AFHA 2BG9A 5TVCA 3JAEA 3SH1A 4BFQA 4COFA 5L47A 2XZ6A 4BQTA 4WV9A 5FJVA 3EAMA 5KZUA 4HFIA 5AINA 3IGQA 5J5HA 1UX2A 3TLVA 3PMZA 5HCMA 2XNVA 2XQ8A 3RHWA 2VL0A 2XQ5A 3U8LA 4ZJTA 5BRXA 5CO5A 4B5DA 2WZYA 5BP0A 2QC1B 2W8FA 2XQAA 4ZK4A 4TNWA 2XQ7A 4UM1A 2BG9E 5LXBA 3LSVA 3P4WA 4ZR6A 3TLUA 4ZRUA 3RQWA 3WTJA 2XQ9A 2XZ5A 4LMKA 4QABA 2Y57A 3U8MA 3UU3A 3WIPA 2YKSA 3WTOA 5J5FA 5HEJA 4ZJSA 2YOEA 2XQ3A 4AFHA 2XYSA 4NPPA 3U8NA 3WTNA 5AFLA 5AFKA 2XQ6A 2Y58A 3PEOA 3TLSA 2W8GA 3SQ6A 4QH5A 3RI5A 2BYPA 4ALXA 3C79A 2PH9A 4HFEA 5J0ZA 3ZDGA 4QH1A 5JMEA 3WTMA 3SIOA 2ZJVA 4TNVA 4XHEA 2YN6A 2WN9A 2WNLA 4X5TA 3UQ4A 4IL9A 4TWHA 4D01A 4HFDA 5IUXA 4DBMA 4PIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMJ A;  1UV6 A;  5LG3 A;  2XNU A;  4AFG A;  4ZZC A;  3P50 A;  2XYT A;  3WTH A;  2BR8 A;  3ZKR A;  2BYQ A;  4QH4 A;  5J5I A;  3GUA A;  4ZK1 A;  2UZ6 A;  2YMD A;  3EHZ A;  4UM3 A;  5HEU A;  2WNJ A;  4HFH A;  3WTL A;  3WTI A;  4UM3 P;  4IRE A;  4TWF A;  4ILC A;  4A97 A;  3RIA A;  5L4H A;  2BYR A;  4NZB A;  3UU6 A;  3SQ9 A;  2XQ4 A;  5HEH A;  2YME A;  2Y7Y A;  3U8K A;  4AFT A;  5AFN A;  5BW2 A;  5AFM B;  3WTK A;  3ZDH A;  2WNC A;  2XNT A;  3EI0 A;  4UY2 A;  4F8H A;  2X00 A;  4A98 A;  2PGZ A;  5HEO A;  5J5G A;  5KE4 A;  3RIF A;  3UU4 A;  4ILA A;  4QAA A;  4HFC A;  3UU5 A;  4Z90 A;  1UW6 A;  4EZ1 A;  4HQP A;  5CFB A;  5L4E A;  5HCJ A;  4FRR A;  4Z91 A;  5AFM A;  4QAC A;  2C9T A;  2BYS A;  4HFB A;  2BYN A;  4IL4 A;  2BG9 B;  3T4M A;  4UM3 S;  5HEG A;  3TLT A;  4UXU A;  2X00 D;  4ZZB A;  5SYO A;  3JAD A;  3U8J A;  2Y54 A;  3UQ7 A;  2Y56 A;  3UUB A;  3C84 A;  4TWD A;  4XK9 A;  4LML A;  2BG9 C;  2ZJU A;  1I9B A;  3JAF A;  4ILB A;  3UU8 A;  3TLW A;  5AFJ A;  2BJ0 A;  2BR7 A;  3RQU A;  5AFH A;  2BG9 A;  5TVC A;  3JAE A;  3SH1 A;  4BFQ A;  4COF A;  5L47 A;  2XZ6 A;  4BQT A;  4WV9 A;  5FJV A;  3EAM A;  5KZU A;  4HFI A;  5AIN A;  3IGQ A;  5J5H A;  1UX2 A;  3TLV A;  3PMZ A;  5HCM A;  2XNV A;  2XQ8 A;  3RHW A;  2VL0 A;  2XQ5 A;  3U8L A;  4ZJT A;  5BRX A;  5CO5 A;  4B5D A;  2WZY A;  5BP0 A;  2QC1 B;  2W8F A;  2XQA A;  4ZK4 A;  4TNW A;  2XQ7 A;  4UM1 A;  2BG9 E;  5LXB A;  3LSV A;  3P4W A;  4ZR6 A;  3TLU A;  4ZRU A;  3RQW A;  3WTJ A;  2XQ9 A;  2XZ5 A;  4LMK A;  4QAB A;  2Y57 A;  3U8M A;  3UU3 A;  3WIP A;  2YKS A;  3WTO A;  5J5F A;  5HEJ A;  4ZJS A;  2YOE A;  2XQ3 A;  4AFH A;  2XYS A;  4NPP A;  3U8N A;  3WTN A;  5AFL A;  5AFK A;  2XQ6 A;  2Y58 A;  3PEO A;  3TLS A;  2W8G A;  3SQ6 A;  4QH5 A;  3RI5 A;  2BYP A;  4ALX A;  3C79 A;  2PH9 A;  4HFE A;  5J0Z A;  3ZDG A;  4QH1 A;  5JME A;  3WTM A;  3SIO A;  2ZJV A;  4TNV A;  4XHE A;  2YN6 A;  2WN9 A;  2WNL A;  4X5T A;  3UQ4 A;  4IL9 A;  4TWH A;  4D01 A;  4HFD A;  5IUX A;  4DBM A;  4PIR A; 
#chains in the Genus database with same CATH topology
 4LMJ A;  1UV6 A;  5LG3 A;  2XNU A;  4AFG A;  4ZZC A;  3P50 A;  2XYT A;  3WTH A;  2BR8 A;  3ZKR A;  2BYQ A;  4QH4 A;  5J5I A;  3GUA A;  4ZK1 A;  2UZ6 A;  2YMD A;  3EHZ A;  4UM3 A;  5HEU A;  2WNJ A;  4HFH A;  3WTL A;  3WTI A;  4UM3 P;  4IRE A;  4TWF A;  4ILC A;  4A97 A;  3RIA A;  5L4H A;  2BYR A;  4NZB A;  3UU6 A;  3SQ9 A;  2XQ4 A;  5HEH A;  2YME A;  2Y7Y A;  3U8K A;  4AFT A;  5AFN A;  5BW2 A;  5AFM B;  3WTK A;  3ZDH A;  2WNC A;  2XNT A;  3EI0 A;  4UY2 A;  4F8H A;  2X00 A;  4A98 A;  2PGZ A;  5HEO A;  5J5G A;  5KE4 A;  3RIF A;  3UU4 A;  4ILA A;  4QAA A;  4HFC A;  3UU5 A;  4Z90 A;  1UW6 A;  4EZ1 A;  4HQP A;  5CFB A;  5L4E A;  5HCJ A;  4FRR A;  4Z91 A;  5AFM A;  4QAC A;  2C9T A;  2BYS A;  4HFB A;  2BYN A;  4IL4 A;  2BG9 B;  3T4M A;  4UM3 S;  5HEG A;  3TLT A;  4UXU A;  2X00 D;  4ZZB A;  5SYO A;  3JAD A;  3U8J A;  2Y54 A;  3UQ7 A;  2Y56 A;  3UUB A;  3C84 A;  4TWD A;  4XK9 A;  4LML A;  2BG9 C;  2ZJU A;  1I9B A;  3JAF A;  4ILB A;  3UU8 A;  3TLW A;  5AFJ A;  2BJ0 A;  2BR7 A;  3RQU A;  5AFH A;  2BG9 A;  5TVC A;  3JAE A;  3SH1 A;  4BFQ A;  4COF A;  5L47 A;  2XZ6 A;  4BQT A;  4WV9 A;  5FJV A;  3EAM A;  5KZU A;  4HFI A;  5AIN A;  3IGQ A;  5J5H A;  1UX2 A;  3TLV A;  3PMZ A;  5HCM A;  2XNV A;  2XQ8 A;  3RHW A;  2VL0 A;  2XQ5 A;  3U8L A;  4ZJT A;  5BRX A;  5CO5 A;  4B5D A;  2WZY A;  5BP0 A;  2QC1 B;  2W8F A;  2XQA A;  4ZK4 A;  4TNW A;  2XQ7 A;  4UM1 A;  2BG9 E;  5LXB A;  3LSV A;  3P4W A;  4ZR6 A;  3TLU A;  4ZRU A;  3RQW A;  3WTJ A;  2XQ9 A;  2XZ5 A;  4LMK A;  4QAB A;  2Y57 A;  3U8M A;  3UU3 A;  3WIP A;  2YKS A;  3WTO A;  5J5F A;  5HEJ A;  4ZJS A;  2YOE A;  2XQ3 A;  4AFH A;  2XYS A;  4NPP A;  3U8N A;  3WTN A;  5AFL A;  5AFK A;  2XQ6 A;  2Y58 A;  3PEO A;  3TLS A;  2W8G A;  3SQ6 A;  4QH5 A;  3RI5 A;  2BYP A;  4ALX A;  3C79 A;  2PH9 A;  4HFE A;  5J0Z A;  3ZDG A;  4QH1 A;  5JME A;  3WTM A;  3SIO A;  2ZJV A;  4TNV A;  4XHE A;  2YN6 A;  2WN9 A;  2WNL A;  4X5T A;  3UQ4 A;  4IL9 A;  4TWH A;  4D01 A;  4HFD A;  5IUX A;  4DBM A;  4PIR A; 
#chains in the Genus database with same CATH homology
 4LMJ A;  1UV6 A;  5LG3 A;  2XNU A;  4AFG A;  4ZZC A;  3P50 A;  2XYT A;  3WTH A;  2BR8 A;  3ZKR A;  2BYQ A;  4QH4 A;  5J5I A;  3GUA A;  4ZK1 A;  2UZ6 A;  2YMD A;  3EHZ A;  4UM3 A;  5HEU A;  2WNJ A;  4HFH A;  3WTL A;  3WTI A;  4UM3 P;  4IRE A;  4TWF A;  4ILC A;  4A97 A;  3RIA A;  5L4H A;  2BYR A;  4NZB A;  3UU6 A;  3SQ9 A;  2XQ4 A;  5HEH A;  2YME A;  2Y7Y A;  3U8K A;  4AFT A;  5AFN A;  5BW2 A;  5AFM B;  3WTK A;  3ZDH A;  2WNC A;  2XNT A;  3EI0 A;  4UY2 A;  4F8H A;  2X00 A;  4A98 A;  2PGZ A;  5HEO A;  5J5G A;  5KE4 A;  3RIF A;  3UU4 A;  4ILA A;  4QAA A;  4HFC A;  3UU5 A;  4Z90 A;  1UW6 A;  4EZ1 A;  4HQP A;  5CFB A;  5L4E A;  5HCJ A;  4FRR A;  4Z91 A;  5AFM A;  4QAC A;  2C9T A;  2BYS A;  4HFB A;  2BYN A;  4IL4 A;  2BG9 B;  3T4M A;  4UM3 S;  5HEG A;  3TLT A;  4UXU A;  2X00 D;  4ZZB A;  5SYO A;  3JAD A;  3U8J A;  2Y54 A;  3UQ7 A;  2Y56 A;  3UUB A;  3C84 A;  4TWD A;  4XK9 A;  4LML A;  2BG9 C;  2ZJU A;  1I9B A;  3JAF A;  4ILB A;  3UU8 A;  3TLW A;  5AFJ A;  2BJ0 A;  2BR7 A;  3RQU A;  5AFH A;  2BG9 A;  5TVC A;  3JAE A;  3SH1 A;  4BFQ A;  4COF A;  5L47 A;  2XZ6 A;  4BQT A;  4WV9 A;  5FJV A;  3EAM A;  5KZU A;  4HFI A;  5AIN A;  3IGQ A;  5J5H A;  1UX2 A;  3TLV A;  3PMZ A;  5HCM A;  2XNV A;  2XQ8 A;  3RHW A;  2VL0 A;  2XQ5 A;  3U8L A;  4ZJT A;  5BRX A;  5CO5 A;  4B5D A;  2WZY A;  5BP0 A;  2QC1 B;  2W8F A;  2XQA A;  4ZK4 A;  4TNW A;  2XQ7 A;  4UM1 A;  2BG9 E;  5LXB A;  3LSV A;  3P4W A;  4ZR6 A;  3TLU A;  4ZRU A;  3RQW A;  3WTJ A;  2XQ9 A;  2XZ5 A;  4LMK A;  4QAB A;  2Y57 A;  3U8M A;  3UU3 A;  3WIP A;  2YKS A;  3WTO A;  5J5F A;  5HEJ A;  4ZJS A;  2YOE A;  2XQ3 A;  4AFH A;  2XYS A;  4NPP A;  3U8N A;  3WTN A;  5AFL A;  5AFK A;  2XQ6 A;  2Y58 A;  3PEO A;  3TLS A;  2W8G A;  3SQ6 A;  4QH5 A;  3RI5 A;  2BYP A;  4ALX A;  3C79 A;  2PH9 A;  4HFE A;  5J0Z A;  3ZDG A;  4QH1 A;  5JME A;  3WTM A;  3SIO A;  2ZJV A;  4TNV A;  4XHE A;  2YN6 A;  2WN9 A;  2WNL A;  4X5T A;  3UQ4 A;  4IL9 A;  4TWH A;  4D01 A;  4HFD A;  5IUX A;  4DBM A;  4PIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...