4BU5A

Crystal structure of human tankyrase 2 in complex with 2-(4- hydroxyphenyl)-3,4-dihydroquinazolin-4-one
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
210
structure length
208
Chain Sequence
b'GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 69
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bu5A00
4U6AA 4J21A 4HLGA 4F1QA 4L6SA 4N3RA 3PAXA 3UH4A 4L0VA 3SE2A 5ADRA 4UVNA 4UVOA 4I9IA 4BUWA 4K4EA 5LXPA 4AVWA 4MT9A 4GV7A 4L7PA 4GV0A 5EBTA 4L7LA 4OQBC 1GS0A 4L0SA 4L32A 3L3MA 4L2GA 4L0IA 5AL5A 3KR7A 3W51A 4F1LA 4OQAC 4PNSA 4UVPA 4N4VA 4W5IA 5A00A 4PNTA 4PNRA 3MHJA 4BU3A 4TVJA 4GV4A 5AL3A 5AKWA 5C5PA 4TK0A 3CE0A 5C5QA 5LYHA 4UVZA 4L31A 4PMLA 2PAWA 3GN7A 4HMHA 5DCZA 4ZZXA 4BJ9A 3HKVA 4L34A 3MHKA 5LX6A 4XHUA 4BJCA 4R6EA 4HLMA 4L2FA 4TKIA 4BJBA 2PQFA 4PY4A 5AL2A 4UVVA 4BUEA 4L33A 4BUSA 4PJVA 4BUDA 4MSGA 4W5SA 4TK5A 4X52A 3U9HA 4BUIA 4L10A 2RF5A 4DVIA 4MSKA 4UVLA 4BUVA 4HLFA 4RV6A 4LI6A 4OPXC 3GOYA 4K4FA 3SMIA 4M7BA 4UI7A 3C4HA 4UFYA 3C49A 4KZLA 2X5YA 4HLKA 5ADQA 4GV2A 4BU9A 3UDDA 5AL4A 4UW1A 4F0EA 4J3LA 4PJTA 4PNNA 1WOKA 4UI5A 1A26A 4PAXA 4UI4A 4N4TA 4AVUA 4BU8A 5ADSA 4DQYC 4BUTA 4IUEA 4J1ZA 4UVSA 5FPGA 1EFYA 4KZQA 4UNDA 4TORA 4HKKA 4L7RA 4L7UA 3BLJA 5FPFA 4PNMA 4UFUA 4OA7A 2RCWA 3P0PA 4UI8A 4UVYA 4UHGA 5ADTA 2PAXA 3UA9A 3P0QA 4W6EA 4PNLA 4UVUA 3GJWA 4L70A 5AL1A 4HHYA 4UUHA 4TKGA 4UX4A 3KCZA 4BU7A 4HL5A 4UVXA 5ECEA 3L3LA 4BUXA 4J3MA 4PNQA 4L09A 4UVWA 4UVTA 4LI8A 4BU6A 5AEHA 3P0NA 4UI3A 3SMJA 4TJYA 3KR8A 4BUFA 5C5RA 4L7NA 4HYFA 5AKUA 4BU5A 4HHZA 4BS4A 4L0TA 1PAXA 3U9YA 4KZUA 4L0BA 4BUAA 4TJUA 4ZZZA 4L7OA 4TJWA 4TOSA 1UK0A 4KRSA 3KJDA 4J22A 4HKNA 4L6ZA 4BUYA 4L2KA 4ZZYA 4UXBA 3FHBA 4R5WA 4HKIA 5ETYA 2RD6A 4BFPA 1UK1A 4BUUA 3GEYA 4HLHA 4LI7A 4TKFA 3UH2A 4UI6A
chains in the Genus database with same CATH superfamily
2RK8A 4J21A 4U6AA 4HLGA 4F1QA 4L6SA 4N3RA 4WPUA 3PAXA 3UH4A 3DTBA 4L0VA 3SE2A 2QF1A 5FH0A 4UVNA 4UVOA 4I9IA 4BUWA 4K4EA 5ADRA 4R43A 4AVWA 5FH5A 2QEWA 4MT9A 4GV7A 4L7PA 4GV0A 1K3DA 5EBTA 4L7LA 1XKVA 4OQBC 1GS0A 4GNQA 4L0SA 4L32A 3L3MA 4L2GA 4L0IA 5AL5A 3KR7A 3W51A 4F1LA 4OQAC 4PNSA 4UVPA 4N4VA 2OLRA 4W5IA 1NHXA 5A00A 2RK7A 4PNTA 4PNRA 3MHJA 4YWDA 4BU3A 4TVJA 1J3BA 2RKDA 4GV4A 5AL3A 5AKWA 5C5PA 4TK0A 3CE0A 5C5QA 3DT7A 2ZCIA 5LYHA 4UVZA 4L31A 4PMLA 2PAWA 4YW9A 3GN7A 4GMWA 3MOHA 4HMHA 5DCZA 4ZZXA 4BJ9A 3HKVA 1YTMA 1YVYA 4L34A 4WL8A 3MHKA 5LX6A 4XHUA 4BJCA 4R6EA 4HLMA 4L2FA 4TKIA 4BJBA 1YGGA 1OS1A 2PQFA 4PY4A 5AL2A 4UVVA 4BUEA 4GNMA 4L33A 2PXZX 4BUSA 4PJVA 4BUDA 4MSGA 4YW8A 4OX2A 4TK5A 4W5SA 4X52A 1II2A 3DT2A 3U9HA 4L10A 2RF5A 4BUIA 4MSKA 2PC9A 4DVIA 4UVLA 4BUVA 4HLFA 2PY7X 4RV6A 5I67A 2RKAA 4LI6A 4WIEA 4OPXC 3GOYA 4K4FA 3SMIA 4M7BA 2FAHA 4UI7A 3C4HA 4UFYA 3C49A 2X5YA 4KZLA 1KHEA 4HLKA 5ADQA 4GV2A 2RKEA 4WIUA 4BU9A 4GNLA 3UDDA 5AL4A 4UW1A 4F0EA 4J3LA 4PJTA 4PNNA 2QF2A 3DT4A 1WOKA 3MOFA 4UI5A 1A26A 4PAXA 4UI4A 4N4TA 5FH1A 4AVUA 2QEYA 4BU8A 5ADSA 4BUTA 4DQYC 1AYLA 4IUEA 4J1ZA 4UVSA 5FPGA 1EFYA 4KZQA 4UNDA 4TORA 4HKKA 4L7RA 2FAFA 4GMZA 3BLJA 4L7UA 5FPFA 4PNMA 4YWBA 4UFUA 4OA7A 3P0PA 2RCWA 4UI8A 4UVYA 4UHGA 5ADTA 2PAXA 5FH3A 3UA9A 3P0QA 4W6EA 4PNLA 4UVUA 3GJWA 4L70A 5AL1A 2GMVA 4HHYA 4UUHA 1KHBA 4TKGA 4UX4A 4WPVA 3KCZA 4BU7A 4HL5A 2OLQA 4UVXA 5ECEA 3L3LA 4BUXA 4J3MA 4PNQA 4L09A 4UVWA 4UVTA 4LI8A 4BU6A 5AEHA 1KHGA 4WPTA 4GNPA 3P0NA 4UI3A 3SMJA 4TJYA 4RCGA 3KR8A 4BUFA 5C5RA 1AQ2A 4L7NA 4HYFA 5AKUA 4GMMA 5LXPA 5FH2A 4BU5A 4HHZA 4WOUA 4BS4A 2QZYA 1PAXA 4L0TA 3U9YA 4KZUA 4L0BA 4BUAA 4TJUA 4ZZZA 4L7OA 3MOEA 4TJWA 4TOSA 1M51A 1UK0A 4KRSA 5FH4A 3KJDA 1KHFA 4J22A 4HKNA 4L6ZA 4BUYA 4L2KA 1OENA 4GMUA 4ZZYA 1K3CA 3FHBA 4R5WA 4UXBA 4HKIA 1YLHA 2RD6A 5ETYA 1UK1A 4GNOA 3GEYA 4HLHA 4BFPA 4LI7A 4BUUA 4TKFA 3UH2A 4UI6A
chains in the Genus database with same CATH topology
2RK8A 4J21A 4U6AA 4HLGA 4F1QA 4L6SA 4N3RA 4WPUA 3PAXA 3UH4A 3DTBA 4L0VA 3SE2A 2QF1A 5FH0A 4UVNA 4UVOA 4I9IA 4BUWA 4K4EA 5ADRA 4R43A 4AVWA 5FH5A 2QEWA 4MT9A 4GV7A 4L7PA 4GV0A 1K3DA 5EBTA 4L7LA 1XKVA 4OQBC 1GS0A 4GNQA 4L0SA 4L32A 3L3MA 4L2GA 4L0IA 5AL5A 3KR7A 3W51A 4F1LA 4OQAC 4PNSA 4UVPA 4N4VA 2OLRA 4W5IA 1NHXA 5A00A 2RK7A 4PNTA 4PNRA 3MHJA 4YWDA 4BU3A 4TVJA 1J3BA 2RKDA 4GV4A 5AL3A 5AKWA 5C5PA 4TK0A 3CE0A 5C5QA 3DT7A 2ZCIA 5LYHA 4UVZA 4L31A 4PMLA 2PAWA 4YW9A 3GN7A 4GMWA 3MOHA 4HMHA 5DCZA 4ZZXA 4BJ9A 3HKVA 1YTMA 1YVYA 4L34A 4WL8A 3MHKA 5LX6A 4XHUA 4BJCA 4R6EA 4HLMA 4L2FA 4TKIA 4BJBA 1YGGA 1OS1A 2PQFA 4PY4A 5AL2A 4UVVA 4BUEA 4GNMA 4L33A 2PXZX 4BUSA 4PJVA 4BUDA 4MSGA 4YW8A 4OX2A 4TK5A 4W5SA 4X52A 1II2A 3DT2A 3U9HA 4L10A 2RF5A 4BUIA 4MSKA 2PC9A 4DVIA 4UVLA 4BUVA 4HLFA 2PY7X 4RV6A 5I67A 2RKAA 4LI6A 4WIEA 4OPXC 3GOYA 4K4FA 3SMIA 4M7BA 2FAHA 4UI7A 3C4HA 4UFYA 3C49A 2X5YA 4KZLA 1KHEA 4HLKA 5ADQA 4GV2A 2RKEA 4WIUA 4BU9A 4GNLA 3UDDA 5AL4A 4UW1A 4F0EA 4J3LA 4PJTA 4PNNA 2QF2A 3DT4A 1WOKA 3MOFA 4UI5A 1A26A 4PAXA 4UI4A 4N4TA 5FH1A 4AVUA 2QEYA 4BU8A 5ADSA 4BUTA 4DQYC 1AYLA 4IUEA 4J1ZA 4UVSA 5FPGA 1EFYA 4KZQA 4UNDA 4TORA 4HKKA 4L7RA 2FAFA 4GMZA 3BLJA 4L7UA 5FPFA 4PNMA 4YWBA 4UFUA 4OA7A 3P0PA 2RCWA 4UI8A 4UVYA 4UHGA 5ADTA 2PAXA 5FH3A 3UA9A 3P0QA 4W6EA 4PNLA 4UVUA 3GJWA 4L70A 5AL1A 2GMVA 4HHYA 4UUHA 1KHBA 4TKGA 4UX4A 4WPVA 3KCZA 4BU7A 4HL5A 2OLQA 4UVXA 5ECEA 3L3LA 4BUXA 4J3MA 4PNQA 4L09A 4UVWA 4UVTA 4LI8A 4BU6A 5AEHA 1KHGA 4WPTA 4GNPA 3P0NA 4UI3A 3SMJA 4TJYA 4RCGA 3KR8A 4BUFA 5C5RA 1AQ2A 4L7NA 4HYFA 5AKUA 4GMMA 5LXPA 5FH2A 4BU5A 4HHZA 4WOUA 4BS4A 2QZYA 1PAXA 4L0TA 3U9YA 4KZUA 4L0BA 4BUAA 4TJUA 4ZZZA 4L7OA 3MOEA 4TJWA 4TOSA 1M51A 1UK0A 4KRSA 5FH4A 3KJDA 1KHFA 4J22A 4HKNA 4L6ZA 4BUYA 4L2KA 1OENA 4GMUA 4ZZYA 1K3CA 3FHBA 4R5WA 4UXBA 4HKIA 1YLHA 2RD6A 5ETYA 1UK1A 4GNOA 3GEYA 4HLHA 4BFPA 4LI7A 4BUUA 4TKFA 3UH2A 4UI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6A A;  4J21 A;  4HLG A;  4F1Q A;  4L6S A;  4N3R A;  3PAX A;  3UH4 A;  4L0V A;  3SE2 A;  5ADR A;  4UVN A;  4UVO A;  4I9I A;  4BUW A;  4K4E A;  5LXP A;  4AVW A;  4MT9 A;  4GV7 A;  4L7P A;  4GV0 A;  5EBT A;  4L7L A;  4OQB C;  1GS0 A;  4L0S A;  4L32 A;  3L3M A;  4L2G A;  4L0I A;  5AL5 A;  3KR7 A;  3W51 A;  4F1L A;  4OQA C;  4PNS A;  4UVP A;  4N4V A;  4W5I A;  5A00 A;  4PNT A;  4PNR A;  3MHJ A;  4BU3 A;  4TVJ A;  4GV4 A;  5AL3 A;  5AKW A;  5C5P A;  4TK0 A;  3CE0 A;  5C5Q A;  5LYH A;  4UVZ A;  4L31 A;  4PML A;  2PAW A;  3GN7 A;  4HMH A;  5DCZ A;  4ZZX A;  4BJ9 A;  3HKV A;  4L34 A;  3MHK A;  5LX6 A;  4XHU A;  4BJC A;  4R6E A;  4HLM A;  4L2F A;  4TKI A;  4BJB A;  2PQF A;  4PY4 A;  5AL2 A;  4UVV A;  4BUE A;  4L33 A;  4BUS A;  4PJV A;  4BUD A;  4MSG A;  4W5S A;  4TK5 A;  4X52 A;  3U9H A;  4BUI A;  4L10 A;  2RF5 A;  4DVI A;  4MSK A;  4UVL A;  4BUV A;  4HLF A;  4RV6 A;  4LI6 A;  4OPX C;  3GOY A;  4K4F A;  3SMI A;  4M7B A;  4UI7 A;  3C4H A;  4UFY A;  3C49 A;  4KZL A;  2X5Y A;  4HLK A;  5ADQ A;  4GV2 A;  4BU9 A;  3UDD A;  5AL4 A;  4UW1 A;  4F0E A;  4J3L A;  4PJT A;  4PNN A;  1WOK A;  4UI5 A;  1A26 A;  4PAX A;  4UI4 A;  4N4T A;  4AVU A;  4BU8 A;  5ADS A;  4DQY C;  4BUT A;  4IUE A;  4J1Z A;  4UVS A;  5FPG A;  1EFY A;  4KZQ A;  4UND A;  4TOR A;  4HKK A;  4L7R A;  4L7U A;  3BLJ A;  5FPF A;  4PNM A;  4UFU A;  4OA7 A;  2RCW A;  3P0P A;  4UI8 A;  4UVY A;  4UHG A;  5ADT A;  2PAX A;  3UA9 A;  3P0Q A;  4W6E A;  4PNL A;  4UVU A;  3GJW A;  4L70 A;  5AL1 A;  4HHY A;  4UUH A;  4TKG A;  4UX4 A;  3KCZ A;  4BU7 A;  4HL5 A;  4UVX A;  5ECE A;  3L3L A;  4BUX A;  4J3M A;  4PNQ A;  4L09 A;  4UVW A;  4UVT A;  4LI8 A;  4BU6 A;  5AEH A;  3P0N A;  4UI3 A;  3SMJ A;  4TJY A;  3KR8 A;  4BUF A;  5C5R A;  4L7N A;  4HYF A;  5AKU A;  4BU5 A;  4HHZ A;  4BS4 A;  4L0T A;  1PAX A;  3U9Y A;  4KZU A;  4L0B A;  4BUA A;  4TJU A;  4ZZZ A;  4L7O A;  4TJW A;  4TOS A;  1UK0 A;  4KRS A;  3KJD A;  4J22 A;  4HKN A;  4L6Z A;  4BUY A;  4L2K A;  4ZZY A;  4UXB A;  3FHB A;  4R5W A;  4HKI A;  5ETY A;  2RD6 A;  4BFP A;  1UK1 A;  4BUU A;  3GEY A;  4HLH A;  4LI7 A;  4TKF A;  3UH2 A;  4UI6 A; 
#chains in the Genus database with same CATH topology
 2RK8 A;  4J21 A;  4U6A A;  4HLG A;  4F1Q A;  4L6S A;  4N3R A;  4WPU A;  3PAX A;  3UH4 A;  3DTB A;  4L0V A;  3SE2 A;  2QF1 A;  5FH0 A;  4UVN A;  4UVO A;  4I9I A;  4BUW A;  4K4E A;  5ADR A;  4R43 A;  4AVW A;  5FH5 A;  2QEW A;  4MT9 A;  4GV7 A;  4L7P A;  4GV0 A;  1K3D A;  5EBT A;  4L7L A;  1XKV A;  4OQB C;  1GS0 A;  4GNQ A;  4L0S A;  4L32 A;  3L3M A;  4L2G A;  4L0I A;  5AL5 A;  3KR7 A;  3W51 A;  4F1L A;  4OQA C;  4PNS A;  4UVP A;  4N4V A;  2OLR A;  4W5I A;  1NHX A;  5A00 A;  2RK7 A;  4PNT A;  4PNR A;  3MHJ A;  4YWD A;  4BU3 A;  4TVJ A;  1J3B A;  2RKD A;  4GV4 A;  5AL3 A;  5AKW A;  5C5P A;  4TK0 A;  3CE0 A;  5C5Q A;  3DT7 A;  2ZCI A;  5LYH A;  4UVZ A;  4L31 A;  4PML A;  2PAW A;  4YW9 A;  3GN7 A;  4GMW A;  3MOH A;  4HMH A;  5DCZ A;  4ZZX A;  4BJ9 A;  3HKV A;  1YTM A;  1YVY A;  4L34 A;  4WL8 A;  3MHK A;  5LX6 A;  4XHU A;  4BJC A;  4R6E A;  4HLM A;  4L2F A;  4TKI A;  4BJB A;  1YGG A;  1OS1 A;  2PQF A;  4PY4 A;  5AL2 A;  4UVV A;  4BUE A;  4GNM A;  4L33 A;  2PXZ X;  4BUS A;  4PJV A;  4BUD A;  4MSG A;  4YW8 A;  4OX2 A;  4TK5 A;  4W5S A;  4X52 A;  1II2 A;  3DT2 A;  3U9H A;  4L10 A;  2RF5 A;  4BUI A;  4MSK A;  2PC9 A;  4DVI A;  4UVL A;  4BUV A;  4HLF A;  2PY7 X;  4RV6 A;  5I67 A;  2RKA A;  4LI6 A;  4WIE A;  4OPX C;  3GOY A;  4K4F A;  3SMI A;  4M7B A;  2FAH A;  4UI7 A;  3C4H A;  4UFY A;  3C49 A;  2X5Y A;  4KZL A;  1KHE A;  4HLK A;  5ADQ A;  4GV2 A;  2RKE A;  4WIU A;  4BU9 A;  4GNL A;  3UDD A;  5AL4 A;  4UW1 A;  4F0E A;  4J3L A;  4PJT A;  4PNN A;  2QF2 A;  3DT4 A;  1WOK A;  3MOF A;  4UI5 A;  1A26 A;  4PAX A;  4UI4 A;  4N4T A;  5FH1 A;  4AVU A;  2QEY A;  4BU8 A;  5ADS A;  4BUT A;  4DQY C;  1AYL A;  4IUE A;  4J1Z A;  4UVS A;  5FPG A;  1EFY A;  4KZQ A;  4UND A;  4TOR A;  4HKK A;  4L7R A;  2FAF A;  4GMZ A;  3BLJ A;  4L7U A;  5FPF A;  4PNM A;  4YWB A;  4UFU A;  4OA7 A;  3P0P A;  2RCW A;  4UI8 A;  4UVY A;  4UHG A;  5ADT A;  2PAX A;  5FH3 A;  3UA9 A;  3P0Q A;  4W6E A;  4PNL A;  4UVU A;  3GJW A;  4L70 A;  5AL1 A;  2GMV A;  4HHY A;  4UUH A;  1KHB A;  4TKG A;  4UX4 A;  4WPV A;  3KCZ A;  4BU7 A;  4HL5 A;  2OLQ A;  4UVX A;  5ECE A;  3L3L A;  4BUX A;  4J3M A;  4PNQ A;  4L09 A;  4UVW A;  4UVT A;  4LI8 A;  4BU6 A;  5AEH A;  1KHG A;  4WPT A;  4GNP A;  3P0N A;  4UI3 A;  3SMJ A;  4TJY A;  4RCG A;  3KR8 A;  4BUF A;  5C5R A;  1AQ2 A;  4L7N A;  4HYF A;  5AKU A;  4GMM A;  5LXP A;  5FH2 A;  4BU5 A;  4HHZ A;  4WOU A;  4BS4 A;  2QZY A;  1PAX A;  4L0T A;  3U9Y A;  4KZU A;  4L0B A;  4BUA A;  4TJU A;  4ZZZ A;  4L7O A;  3MOE A;  4TJW A;  4TOS A;  1M51 A;  1UK0 A;  4KRS A;  5FH4 A;  3KJD A;  1KHF A;  4J22 A;  4HKN A;  4L6Z A;  4BUY A;  4L2K A;  1OEN A;  4GMU A;  4ZZY A;  1K3C A;  3FHB A;  4R5W A;  4UXB A;  4HKI A;  1YLH A;  2RD6 A;  5ETY A;  1UK1 A;  4GNO A;  3GEY A;  4HLH A;  4BFP A;  4LI7 A;  4BUU A;  4TKF A;  3UH2 A;  4UI6 A; 
#chains in the Genus database with same CATH homology
 2RK8 A;  4J21 A;  4U6A A;  4HLG A;  4F1Q A;  4L6S A;  4N3R A;  4WPU A;  3PAX A;  3UH4 A;  3DTB A;  4L0V A;  3SE2 A;  2QF1 A;  5FH0 A;  4UVN A;  4UVO A;  4I9I A;  4BUW A;  4K4E A;  5ADR A;  4R43 A;  4AVW A;  5FH5 A;  2QEW A;  4MT9 A;  4GV7 A;  4L7P A;  4GV0 A;  1K3D A;  5EBT A;  4L7L A;  1XKV A;  4OQB C;  1GS0 A;  4GNQ A;  4L0S A;  4L32 A;  3L3M A;  4L2G A;  4L0I A;  5AL5 A;  3KR7 A;  3W51 A;  4F1L A;  4OQA C;  4PNS A;  4UVP A;  4N4V A;  2OLR A;  4W5I A;  1NHX A;  5A00 A;  2RK7 A;  4PNT A;  4PNR A;  3MHJ A;  4YWD A;  4BU3 A;  4TVJ A;  1J3B A;  2RKD A;  4GV4 A;  5AL3 A;  5AKW A;  5C5P A;  4TK0 A;  3CE0 A;  5C5Q A;  3DT7 A;  2ZCI A;  5LYH A;  4UVZ A;  4L31 A;  4PML A;  2PAW A;  4YW9 A;  3GN7 A;  4GMW A;  3MOH A;  4HMH A;  5DCZ A;  4ZZX A;  4BJ9 A;  3HKV A;  1YTM A;  1YVY A;  4L34 A;  4WL8 A;  3MHK A;  5LX6 A;  4XHU A;  4BJC A;  4R6E A;  4HLM A;  4L2F A;  4TKI A;  4BJB A;  1YGG A;  1OS1 A;  2PQF A;  4PY4 A;  5AL2 A;  4UVV A;  4BUE A;  4GNM A;  4L33 A;  2PXZ X;  4BUS A;  4PJV A;  4BUD A;  4MSG A;  4YW8 A;  4OX2 A;  4TK5 A;  4W5S A;  4X52 A;  1II2 A;  3DT2 A;  3U9H A;  4L10 A;  2RF5 A;  4BUI A;  4MSK A;  2PC9 A;  4DVI A;  4UVL A;  4BUV A;  4HLF A;  2PY7 X;  4RV6 A;  5I67 A;  2RKA A;  4LI6 A;  4WIE A;  4OPX C;  3GOY A;  4K4F A;  3SMI A;  4M7B A;  2FAH A;  4UI7 A;  3C4H A;  4UFY A;  3C49 A;  2X5Y A;  4KZL A;  1KHE A;  4HLK A;  5ADQ A;  4GV2 A;  2RKE A;  4WIU A;  4BU9 A;  4GNL A;  3UDD A;  5AL4 A;  4UW1 A;  4F0E A;  4J3L A;  4PJT A;  4PNN A;  2QF2 A;  3DT4 A;  1WOK A;  3MOF A;  4UI5 A;  1A26 A;  4PAX A;  4UI4 A;  4N4T A;  5FH1 A;  4AVU A;  2QEY A;  4BU8 A;  5ADS A;  4BUT A;  4DQY C;  1AYL A;  4IUE A;  4J1Z A;  4UVS A;  5FPG A;  1EFY A;  4KZQ A;  4UND A;  4TOR A;  4HKK A;  4L7R A;  2FAF A;  4GMZ A;  3BLJ A;  4L7U A;  5FPF A;  4PNM A;  4YWB A;  4UFU A;  4OA7 A;  3P0P A;  2RCW A;  4UI8 A;  4UVY A;  4UHG A;  5ADT A;  2PAX A;  5FH3 A;  3UA9 A;  3P0Q A;  4W6E A;  4PNL A;  4UVU A;  3GJW A;  4L70 A;  5AL1 A;  2GMV A;  4HHY A;  4UUH A;  1KHB A;  4TKG A;  4UX4 A;  4WPV A;  3KCZ A;  4BU7 A;  4HL5 A;  2OLQ A;  4UVX A;  5ECE A;  3L3L A;  4BUX A;  4J3M A;  4PNQ A;  4L09 A;  4UVW A;  4UVT A;  4LI8 A;  4BU6 A;  5AEH A;  1KHG A;  4WPT A;  4GNP A;  3P0N A;  4UI3 A;  3SMJ A;  4TJY A;  4RCG A;  3KR8 A;  4BUF A;  5C5R A;  1AQ2 A;  4L7N A;  4HYF A;  5AKU A;  4GMM A;  5LXP A;  5FH2 A;  4BU5 A;  4HHZ A;  4WOU A;  4BS4 A;  2QZY A;  1PAX A;  4L0T A;  3U9Y A;  4KZU A;  4L0B A;  4BUA A;  4TJU A;  4ZZZ A;  4L7O A;  3MOE A;  4TJW A;  4TOS A;  1M51 A;  1UK0 A;  4KRS A;  5FH4 A;  3KJD A;  1KHF A;  4J22 A;  4HKN A;  4L6Z A;  4BUY A;  4L2K A;  1OEN A;  4GMU A;  4ZZY A;  1K3C A;  3FHB A;  4R5W A;  4UXB A;  4HKI A;  1YLH A;  2RD6 A;  5ETY A;  1UK1 A;  4GNO A;  3GEY A;  4HLH A;  4BFP A;  4LI7 A;  4BUU A;  4TKF A;  3UH2 A;  4UI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...