4BU6A

Crystal structure of human tankyrase 2 in complex with 2-(4- aminophenyl)-3,4-dihydroquinazolin-4-one
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
210
structure length
208
Chain Sequence
b'GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 69
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bu6A00
4UVNA 3UDDA 4L7UA 4L0IA 4I9IA 4U6AA 4R5WA 4TJUA 4L2KA 5ADSA 4MSGA 4L0BA 5ADQA 4UVPA 4PNLA 4HLGA 4TKIA 4F0EA 4UVTA 5ADRA 4HL5A 4PAXA 4N3RA 4L34A 4GV0A 1UK0A 4UVUA 4HYFA 4UVXA 4BUXA 2RD6A 3C49A 4HHZA 4BUFA 4F1LA 4OPXC 2PQFA 5AKWA 4HMHA 4BUSA 4TJYA 4BU3A 4BUYA 4L7NA 4UXBA 4TKFA 4UW1A 4W5IA 4BUIA 5FPFA 4M7BA 4L2FA 4TVJA 3FHBA 4L2GA 4L10A 4PNSA 4BU5A 2RCWA 4N4VA 4UUHA 5AL5A 4UVWA 4BU6A 4KRSA 4TK0A 3GN7A 4GV2A 3P0NA 5EBTA 4R6EA 4L0VA 3P0QA 3P0PA 4L7OA 4L7LA 4ZZXA 4J3LA 4K4FA 4L6SA 1PAXA 3C4HA 3GJWA 2RF5A 4BJBA 4L7RA 4L6ZA 4PJTA 4RV6A 4UI5A 2PAWA 5AL4A 4BUUA 4HLMA 4MSKA 4IUEA 3UH2A 4BU7A 4W5SA 4UVOA 4UI3A 5AL1A 4UNDA 3KJDA 4PNTA 4BUEA 4UVVA 4UVYA 1A26A 5AKUA 3W51A 4PNRA 3UA9A 2PAXA 4L32A 5LYHA 4BFPA 4HLHA 4LI7A 4TK5A 4UFUA 4PNQA 4UVZA 3HKVA 4L0TA 3CE0A 5AEHA 3U9HA 3MHJA 4HLKA 5LX6A 4L09A 4J22A 4F1QA 3L3MA 4KZUA 4OA7A 4OQBC 4L0SA 4XHUA 4BJ9A 4OQAC 4X52A 1GS0A 3GOYA 5C5RA 4GV7A 4N4TA 4BUAA 3KR7A 5AL2A 4TORA 4UVSA 4PJVA 2X5YA 5C5QA 4AVWA 4BUVA 4BUTA 3KCZA 4J21A 5ECEA 4W6EA 4BU9A 4BUDA 4ZZZA 1UK1A 5A00A 5ADTA 4TJWA 5FPGA 3PAXA 4BS4A 4J1ZA 4BU8A 4HKKA 4UI6A 5ETYA 4LI6A 3U9YA 4BJCA 4DVIA 4PMLA 4K4EA 1WOKA 5AL3A 3MHKA 4LI8A 4HLFA 4PNNA 3SMIA 4HKNA 4HKIA 4UHGA 3SMJA 4UI7A 4UFYA 4HHYA 4ZZYA 3BLJA 3KR8A 4GV4A 5DCZA 4AVUA 4DQYC 4L70A 4UVLA 5C5PA 4TKGA 4UI4A 4L33A 4TOSA 4KZLA 4PY4A 3L3LA 4KZQA 4J3MA 4MT9A 4BUWA 3SE2A 3UH4A 4PNMA 4L7PA 1EFYA 3GEYA 4L31A 5LXPA 4UI8A 4UX4A
chains in the Genus database with same CATH superfamily
4UVNA 4GMWA 3UDDA 4L7UA 4L0IA 1KHGA 4GNQA 4I9IA 4U6AA 4R5WA 4TJUA 4L2KA 4WPVA 4R43A 2PC9A 4WPTA 5ADSA 4YWDA 4MSGA 5FH3A 4L0BA 5ADQA 4UVPA 4PNLA 2RKAA 4RCGA 4HLGA 4TKIA 4F0EA 1AYLA 4UVTA 5ADRA 4HL5A 2QF1A 2PY7X 4PAXA 4N3RA 1YTMA 4L34A 4GV0A 1UK0A 4UVUA 4HYFA 4UVXA 4BUXA 2RD6A 3C49A 4HHZA 4BUFA 4F1LA 4OPXC 2PQFA 5AKWA 4HMHA 4BUSA 4TJYA 1XKVA 4BU3A 4L7NA 4BUYA 4GMMA 4TKFA 4UXBA 4UW1A 4W5IA 4BUIA 4M7BA 2FAFA 4L2FA 5FPFA 4TVJA 3FHBA 4L2GA 4L10A 4PNSA 4BU5A 2FAHA 2RCWA 4N4VA 4UUHA 5AL5A 4UVWA 3MOEA 4YWBA 4BU6A 1KHEA 4KRSA 4TK0A 3GN7A 3P0NA 4GV2A 1AQ2A 5EBTA 3DT7A 3DT4A 4R6EA 4L0VA 3P0QA 3P0PA 4L7OA 4L7LA 2ZCIA 2QZYA 4WPUA 4ZZXA 3DT2A 4J3LA 4K4FA 4L6SA 1PAXA 2QEWA 3C4HA 3GJWA 4WIEA 2RF5A 4BJBA 4L7RA 4GNLA 4L6ZA 4PJTA 4RV6A 4UI5A 2PAWA 4WL8A 5AL4A 1K3CA 4BUUA 2RKDA 4GNMA 4HLMA 2OLRA 1YLHA 4MSKA 4IUEA 2RK8A 3UH2A 4BU7A 5FH5A 4W5SA 4UVOA 4UI3A 5AL1A 4UNDA 3KJDA 4PNTA 4BUEA 4UVVA 4UVYA 1A26A 5AKUA 1II2A 2OLQA 4PNRA 3UA9A 3W51A 5FH2A 2PAXA 4L32A 4GMUA 5LYHA 4BFPA 4HLHA 4LI7A 4TK5A 1M51A 4UFUA 4PNQA 4UVZA 3HKVA 3DTBA 4L0TA 3CE0A 5AEHA 1OS1A 4YW9A 2PXZX 5I67A 3U9HA 3MHJA 4HLKA 5LX6A 4L09A 5FH0A 1OENA 4J22A 4F1QA 3L3MA 4KZUA 4OA7A 2GMVA 4OQBC 4L0SA 4XHUA 5FH4A 4BJ9A 4X52A 4OQAC 1GS0A 3GOYA 5C5RA 4GV7A 4GMZA 4N4TA 4BUAA 3MOHA 3MOFA 3KR7A 5AL2A 4TORA 4UVSA 4PJVA 1J3BA 2X5YA 5C5QA 4AVWA 2RKEA 4BUVA 4BUTA 4WOUA 3KCZA 2QF2A 4J21A 5ECEA 4W6EA 4GNOA 4BU9A 4BUDA 4ZZZA 1UK1A 4GNPA 5A00A 5ADTA 4TJWA 5FPGA 3PAXA 4BS4A 4J1ZA 4BU8A 4HKKA 4UI6A 5ETYA 4LI6A 5FH1A 2QEYA 3U9YA 4BJCA 4DVIA 1YGGA 4PMLA 4K4EA 1WOKA 5AL3A 1NHXA 3MHKA 1KHBA 4LI8A 4HLFA 4PNNA 3SMIA 4HKNA 4HKIA 4UHGA 3SMJA 4UI7A 4UFYA 4HHYA 4ZZYA 3BLJA 3KR8A 4GV4A 5DCZA 4AVUA 4DQYC 4L70A 1K3DA 4UVLA 1KHFA 5C5PA 4TKGA 4UI4A 4L33A 4TOSA 4KZLA 4PY4A 4WIUA 3L3LA 4KZQA 4J3MA 4MT9A 2RK7A 4BUWA 3SE2A 4YW8A 3UH4A 4PNMA 4L7PA 4OX2A 1EFYA 3GEYA 4L31A 5LXPA 4UI8A 1YVYA 4UX4A
chains in the Genus database with same CATH topology
4UVNA 4GMWA 3UDDA 4L7UA 4L0IA 1KHGA 4GNQA 4I9IA 4U6AA 4R5WA 4TJUA 4L2KA 4WPVA 4R43A 2PC9A 4WPTA 5ADSA 4YWDA 4MSGA 5FH3A 4L0BA 5ADQA 4UVPA 4PNLA 2RKAA 4RCGA 4HLGA 4TKIA 4F0EA 1AYLA 4UVTA 5ADRA 4HL5A 2QF1A 2PY7X 4PAXA 4N3RA 1YTMA 4L34A 4GV0A 1UK0A 4UVUA 4HYFA 4UVXA 4BUXA 2RD6A 3C49A 4HHZA 4BUFA 4F1LA 4OPXC 2PQFA 5AKWA 4HMHA 4BUSA 4TJYA 1XKVA 4BU3A 4L7NA 4BUYA 4GMMA 4TKFA 4UXBA 4UW1A 4W5IA 4BUIA 4M7BA 2FAFA 4L2FA 5FPFA 4TVJA 3FHBA 4L2GA 4L10A 4PNSA 4BU5A 2FAHA 2RCWA 4N4VA 4UUHA 5AL5A 4UVWA 3MOEA 4YWBA 4BU6A 1KHEA 4KRSA 4TK0A 3GN7A 3P0NA 4GV2A 1AQ2A 5EBTA 3DT7A 3DT4A 4R6EA 4L0VA 3P0QA 3P0PA 4L7OA 4L7LA 2ZCIA 2QZYA 4WPUA 4ZZXA 3DT2A 4J3LA 4K4FA 4L6SA 1PAXA 2QEWA 3C4HA 3GJWA 4WIEA 2RF5A 4BJBA 4L7RA 4GNLA 4L6ZA 4PJTA 4RV6A 4UI5A 2PAWA 4WL8A 5AL4A 1K3CA 4BUUA 2RKDA 4GNMA 4HLMA 2OLRA 1YLHA 4MSKA 4IUEA 2RK8A 3UH2A 4BU7A 5FH5A 4W5SA 4UVOA 4UI3A 5AL1A 4UNDA 3KJDA 4PNTA 4BUEA 4UVVA 4UVYA 1A26A 5AKUA 1II2A 2OLQA 4PNRA 3UA9A 3W51A 5FH2A 2PAXA 4L32A 4GMUA 5LYHA 4BFPA 4HLHA 4LI7A 4TK5A 1M51A 4UFUA 4PNQA 4UVZA 3HKVA 3DTBA 4L0TA 3CE0A 5AEHA 1OS1A 4YW9A 2PXZX 5I67A 3U9HA 3MHJA 4HLKA 5LX6A 4L09A 5FH0A 1OENA 4J22A 4F1QA 3L3MA 4KZUA 4OA7A 2GMVA 4OQBC 4L0SA 4XHUA 5FH4A 4BJ9A 4X52A 4OQAC 1GS0A 3GOYA 5C5RA 4GV7A 4GMZA 4N4TA 4BUAA 3MOHA 3MOFA 3KR7A 5AL2A 4TORA 4UVSA 4PJVA 1J3BA 2X5YA 5C5QA 4AVWA 2RKEA 4BUVA 4BUTA 4WOUA 3KCZA 2QF2A 4J21A 5ECEA 4W6EA 4GNOA 4BU9A 4BUDA 4ZZZA 1UK1A 4GNPA 5A00A 5ADTA 4TJWA 5FPGA 3PAXA 4BS4A 4J1ZA 4BU8A 4HKKA 4UI6A 5ETYA 4LI6A 5FH1A 2QEYA 3U9YA 4BJCA 4DVIA 1YGGA 4PMLA 4K4EA 1WOKA 5AL3A 1NHXA 3MHKA 1KHBA 4LI8A 4HLFA 4PNNA 3SMIA 4HKNA 4HKIA 4UHGA 3SMJA 4UI7A 4UFYA 4HHYA 4ZZYA 3BLJA 3KR8A 4GV4A 5DCZA 4AVUA 4DQYC 4L70A 1K3DA 4UVLA 1KHFA 5C5PA 4TKGA 4UI4A 4L33A 4TOSA 4KZLA 4PY4A 4WIUA 3L3LA 4KZQA 4J3MA 4MT9A 2RK7A 4BUWA 3SE2A 4YW8A 3UH4A 4PNMA 4L7PA 4OX2A 1EFYA 3GEYA 4L31A 5LXPA 4UI8A 1YVYA 4UX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UVN A;  3UDD A;  4L7U A;  4L0I A;  4I9I A;  4U6A A;  4R5W A;  4TJU A;  4L2K A;  5ADS A;  4MSG A;  4L0B A;  5ADQ A;  4UVP A;  4PNL A;  4HLG A;  4TKI A;  4F0E A;  4UVT A;  5ADR A;  4HL5 A;  4PAX A;  4N3R A;  4L34 A;  4GV0 A;  1UK0 A;  4UVU A;  4HYF A;  4UVX A;  4BUX A;  2RD6 A;  3C49 A;  4HHZ A;  4BUF A;  4F1L A;  4OPX C;  2PQF A;  5AKW A;  4HMH A;  4BUS A;  4TJY A;  4BU3 A;  4BUY A;  4L7N A;  4UXB A;  4TKF A;  4UW1 A;  4W5I A;  4BUI A;  5FPF A;  4M7B A;  4L2F A;  4TVJ A;  3FHB A;  4L2G A;  4L10 A;  4PNS A;  4BU5 A;  2RCW A;  4N4V A;  4UUH A;  5AL5 A;  4UVW A;  4BU6 A;  4KRS A;  4TK0 A;  3GN7 A;  4GV2 A;  3P0N A;  5EBT A;  4R6E A;  4L0V A;  3P0Q A;  3P0P A;  4L7O A;  4L7L A;  4ZZX A;  4J3L A;  4K4F A;  4L6S A;  1PAX A;  3C4H A;  3GJW A;  2RF5 A;  4BJB A;  4L7R A;  4L6Z A;  4PJT A;  4RV6 A;  4UI5 A;  2PAW A;  5AL4 A;  4BUU A;  4HLM A;  4MSK A;  4IUE A;  3UH2 A;  4BU7 A;  4W5S A;  4UVO A;  4UI3 A;  5AL1 A;  4UND A;  3KJD A;  4PNT A;  4BUE A;  4UVV A;  4UVY A;  1A26 A;  5AKU A;  3W51 A;  4PNR A;  3UA9 A;  2PAX A;  4L32 A;  5LYH A;  4BFP A;  4HLH A;  4LI7 A;  4TK5 A;  4UFU A;  4PNQ A;  4UVZ A;  3HKV A;  4L0T A;  3CE0 A;  5AEH A;  3U9H A;  3MHJ A;  4HLK A;  5LX6 A;  4L09 A;  4J22 A;  4F1Q A;  3L3M A;  4KZU A;  4OA7 A;  4OQB C;  4L0S A;  4XHU A;  4BJ9 A;  4OQA C;  4X52 A;  1GS0 A;  3GOY A;  5C5R A;  4GV7 A;  4N4T A;  4BUA A;  3KR7 A;  5AL2 A;  4TOR A;  4UVS A;  4PJV A;  2X5Y A;  5C5Q A;  4AVW A;  4BUV A;  4BUT A;  3KCZ A;  4J21 A;  5ECE A;  4W6E A;  4BU9 A;  4BUD A;  4ZZZ A;  1UK1 A;  5A00 A;  5ADT A;  4TJW A;  5FPG A;  3PAX A;  4BS4 A;  4J1Z A;  4BU8 A;  4HKK A;  4UI6 A;  5ETY A;  4LI6 A;  3U9Y A;  4BJC A;  4DVI A;  4PML A;  4K4E A;  1WOK A;  5AL3 A;  3MHK A;  4LI8 A;  4HLF A;  4PNN A;  3SMI A;  4HKN A;  4HKI A;  4UHG A;  3SMJ A;  4UI7 A;  4UFY A;  4HHY A;  4ZZY A;  3BLJ A;  3KR8 A;  4GV4 A;  5DCZ A;  4AVU A;  4DQY C;  4L70 A;  4UVL A;  5C5P A;  4TKG A;  4UI4 A;  4L33 A;  4TOS A;  4KZL A;  4PY4 A;  3L3L A;  4KZQ A;  4J3M A;  4MT9 A;  4BUW A;  3SE2 A;  3UH4 A;  4PNM A;  4L7P A;  1EFY A;  3GEY A;  4L31 A;  5LXP A;  4UI8 A;  4UX4 A; 
#chains in the Genus database with same CATH topology
 4UVN A;  4GMW A;  3UDD A;  4L7U A;  4L0I A;  1KHG A;  4GNQ A;  4I9I A;  4U6A A;  4R5W A;  4TJU A;  4L2K A;  4WPV A;  4R43 A;  2PC9 A;  4WPT A;  5ADS A;  4YWD A;  4MSG A;  5FH3 A;  4L0B A;  5ADQ A;  4UVP A;  4PNL A;  2RKA A;  4RCG A;  4HLG A;  4TKI A;  4F0E A;  1AYL A;  4UVT A;  5ADR A;  4HL5 A;  2QF1 A;  2PY7 X;  4PAX A;  4N3R A;  1YTM A;  4L34 A;  4GV0 A;  1UK0 A;  4UVU A;  4HYF A;  4UVX A;  4BUX A;  2RD6 A;  3C49 A;  4HHZ A;  4BUF A;  4F1L A;  4OPX C;  2PQF A;  5AKW A;  4HMH A;  4BUS A;  4TJY A;  1XKV A;  4BU3 A;  4L7N A;  4BUY A;  4GMM A;  4TKF A;  4UXB A;  4UW1 A;  4W5I A;  4BUI A;  4M7B A;  2FAF A;  4L2F A;  5FPF A;  4TVJ A;  3FHB A;  4L2G A;  4L10 A;  4PNS A;  4BU5 A;  2FAH A;  2RCW A;  4N4V A;  4UUH A;  5AL5 A;  4UVW A;  3MOE A;  4YWB A;  4BU6 A;  1KHE A;  4KRS A;  4TK0 A;  3GN7 A;  3P0N A;  4GV2 A;  1AQ2 A;  5EBT A;  3DT7 A;  3DT4 A;  4R6E A;  4L0V A;  3P0Q A;  3P0P A;  4L7O A;  4L7L A;  2ZCI A;  2QZY A;  4WPU A;  4ZZX A;  3DT2 A;  4J3L A;  4K4F A;  4L6S A;  1PAX A;  2QEW A;  3C4H A;  3GJW A;  4WIE A;  2RF5 A;  4BJB A;  4L7R A;  4GNL A;  4L6Z A;  4PJT A;  4RV6 A;  4UI5 A;  2PAW A;  4WL8 A;  5AL4 A;  1K3C A;  4BUU A;  2RKD A;  4GNM A;  4HLM A;  2OLR A;  1YLH A;  4MSK A;  4IUE A;  2RK8 A;  3UH2 A;  4BU7 A;  5FH5 A;  4W5S A;  4UVO A;  4UI3 A;  5AL1 A;  4UND A;  3KJD A;  4PNT A;  4BUE A;  4UVV A;  4UVY A;  1A26 A;  5AKU A;  1II2 A;  2OLQ A;  4PNR A;  3UA9 A;  3W51 A;  5FH2 A;  2PAX A;  4L32 A;  4GMU A;  5LYH A;  4BFP A;  4HLH A;  4LI7 A;  4TK5 A;  1M51 A;  4UFU A;  4PNQ A;  4UVZ A;  3HKV A;  3DTB A;  4L0T A;  3CE0 A;  5AEH A;  1OS1 A;  4YW9 A;  2PXZ X;  5I67 A;  3U9H A;  3MHJ A;  4HLK A;  5LX6 A;  4L09 A;  5FH0 A;  1OEN A;  4J22 A;  4F1Q A;  3L3M A;  4KZU A;  4OA7 A;  2GMV A;  4OQB C;  4L0S A;  4XHU A;  5FH4 A;  4BJ9 A;  4X52 A;  4OQA C;  1GS0 A;  3GOY A;  5C5R A;  4GV7 A;  4GMZ A;  4N4T A;  4BUA A;  3MOH A;  3MOF A;  3KR7 A;  5AL2 A;  4TOR A;  4UVS A;  4PJV A;  1J3B A;  2X5Y A;  5C5Q A;  4AVW A;  2RKE A;  4BUV A;  4BUT A;  4WOU A;  3KCZ A;  2QF2 A;  4J21 A;  5ECE A;  4W6E A;  4GNO A;  4BU9 A;  4BUD A;  4ZZZ A;  1UK1 A;  4GNP A;  5A00 A;  5ADT A;  4TJW A;  5FPG A;  3PAX A;  4BS4 A;  4J1Z A;  4BU8 A;  4HKK A;  4UI6 A;  5ETY A;  4LI6 A;  5FH1 A;  2QEY A;  3U9Y A;  4BJC A;  4DVI A;  1YGG A;  4PML A;  4K4E A;  1WOK A;  5AL3 A;  1NHX A;  3MHK A;  1KHB A;  4LI8 A;  4HLF A;  4PNN A;  3SMI A;  4HKN A;  4HKI A;  4UHG A;  3SMJ A;  4UI7 A;  4UFY A;  4HHY A;  4ZZY A;  3BLJ A;  3KR8 A;  4GV4 A;  5DCZ A;  4AVU A;  4DQY C;  4L70 A;  1K3D A;  4UVL A;  1KHF A;  5C5P A;  4TKG A;  4UI4 A;  4L33 A;  4TOS A;  4KZL A;  4PY4 A;  4WIU A;  3L3L A;  4KZQ A;  4J3M A;  4MT9 A;  2RK7 A;  4BUW A;  3SE2 A;  4YW8 A;  3UH4 A;  4PNM A;  4L7P A;  4OX2 A;  1EFY A;  3GEY A;  4L31 A;  5LXP A;  4UI8 A;  1YVY A;  4UX4 A; 
#chains in the Genus database with same CATH homology
 4UVN A;  4GMW A;  3UDD A;  4L7U A;  4L0I A;  1KHG A;  4GNQ A;  4I9I A;  4U6A A;  4R5W A;  4TJU A;  4L2K A;  4WPV A;  4R43 A;  2PC9 A;  4WPT A;  5ADS A;  4YWD A;  4MSG A;  5FH3 A;  4L0B A;  5ADQ A;  4UVP A;  4PNL A;  2RKA A;  4RCG A;  4HLG A;  4TKI A;  4F0E A;  1AYL A;  4UVT A;  5ADR A;  4HL5 A;  2QF1 A;  2PY7 X;  4PAX A;  4N3R A;  1YTM A;  4L34 A;  4GV0 A;  1UK0 A;  4UVU A;  4HYF A;  4UVX A;  4BUX A;  2RD6 A;  3C49 A;  4HHZ A;  4BUF A;  4F1L A;  4OPX C;  2PQF A;  5AKW A;  4HMH A;  4BUS A;  4TJY A;  1XKV A;  4BU3 A;  4L7N A;  4BUY A;  4GMM A;  4TKF A;  4UXB A;  4UW1 A;  4W5I A;  4BUI A;  4M7B A;  2FAF A;  4L2F A;  5FPF A;  4TVJ A;  3FHB A;  4L2G A;  4L10 A;  4PNS A;  4BU5 A;  2FAH A;  2RCW A;  4N4V A;  4UUH A;  5AL5 A;  4UVW A;  3MOE A;  4YWB A;  4BU6 A;  1KHE A;  4KRS A;  4TK0 A;  3GN7 A;  3P0N A;  4GV2 A;  1AQ2 A;  5EBT A;  3DT7 A;  3DT4 A;  4R6E A;  4L0V A;  3P0Q A;  3P0P A;  4L7O A;  4L7L A;  2ZCI A;  2QZY A;  4WPU A;  4ZZX A;  3DT2 A;  4J3L A;  4K4F A;  4L6S A;  1PAX A;  2QEW A;  3C4H A;  3GJW A;  4WIE A;  2RF5 A;  4BJB A;  4L7R A;  4GNL A;  4L6Z A;  4PJT A;  4RV6 A;  4UI5 A;  2PAW A;  4WL8 A;  5AL4 A;  1K3C A;  4BUU A;  2RKD A;  4GNM A;  4HLM A;  2OLR A;  1YLH A;  4MSK A;  4IUE A;  2RK8 A;  3UH2 A;  4BU7 A;  5FH5 A;  4W5S A;  4UVO A;  4UI3 A;  5AL1 A;  4UND A;  3KJD A;  4PNT A;  4BUE A;  4UVV A;  4UVY A;  1A26 A;  5AKU A;  1II2 A;  2OLQ A;  4PNR A;  3UA9 A;  3W51 A;  5FH2 A;  2PAX A;  4L32 A;  4GMU A;  5LYH A;  4BFP A;  4HLH A;  4LI7 A;  4TK5 A;  1M51 A;  4UFU A;  4PNQ A;  4UVZ A;  3HKV A;  3DTB A;  4L0T A;  3CE0 A;  5AEH A;  1OS1 A;  4YW9 A;  2PXZ X;  5I67 A;  3U9H A;  3MHJ A;  4HLK A;  5LX6 A;  4L09 A;  5FH0 A;  1OEN A;  4J22 A;  4F1Q A;  3L3M A;  4KZU A;  4OA7 A;  2GMV A;  4OQB C;  4L0S A;  4XHU A;  5FH4 A;  4BJ9 A;  4X52 A;  4OQA C;  1GS0 A;  3GOY A;  5C5R A;  4GV7 A;  4GMZ A;  4N4T A;  4BUA A;  3MOH A;  3MOF A;  3KR7 A;  5AL2 A;  4TOR A;  4UVS A;  4PJV A;  1J3B A;  2X5Y A;  5C5Q A;  4AVW A;  2RKE A;  4BUV A;  4BUT A;  4WOU A;  3KCZ A;  2QF2 A;  4J21 A;  5ECE A;  4W6E A;  4GNO A;  4BU9 A;  4BUD A;  4ZZZ A;  1UK1 A;  4GNP A;  5A00 A;  5ADT A;  4TJW A;  5FPG A;  3PAX A;  4BS4 A;  4J1Z A;  4BU8 A;  4HKK A;  4UI6 A;  5ETY A;  4LI6 A;  5FH1 A;  2QEY A;  3U9Y A;  4BJC A;  4DVI A;  1YGG A;  4PML A;  4K4E A;  1WOK A;  5AL3 A;  1NHX A;  3MHK A;  1KHB A;  4LI8 A;  4HLF A;  4PNN A;  3SMI A;  4HKN A;  4HKI A;  4UHG A;  3SMJ A;  4UI7 A;  4UFY A;  4HHY A;  4ZZY A;  3BLJ A;  3KR8 A;  4GV4 A;  5DCZ A;  4AVU A;  4DQY C;  4L70 A;  1K3D A;  4UVL A;  1KHF A;  5C5P A;  4TKG A;  4UI4 A;  4L33 A;  4TOS A;  4KZL A;  4PY4 A;  4WIU A;  3L3L A;  4KZQ A;  4J3M A;  4MT9 A;  2RK7 A;  4BUW A;  3SE2 A;  4YW8 A;  3UH4 A;  4PNM A;  4L7P A;  4OX2 A;  1EFY A;  3GEY A;  4L31 A;  5LXP A;  4UI8 A;  1YVY A;  4UX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...