4BXXI

Arrested rna polymerase ii-bye1 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 17
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4bxxI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4bxxI02
2E2II 2NVQI 1YUAA 4QTUA 3S14I 3S17I 2PK7A 3HOZI 2DE6A 3S2HI 4NB8A 2JA5I 3GTJI 3GKQA 1WW9A 3Q87A 1USPB 3H0GI 1TWHI 5C44I 5C4XI 4QTTA 4A3DI 3I4NI 1USPA 1NUIA 2KPIA 3GTGI 4A3GI 1VLAA 5FLMI 3FKII 3PO2I 2JS4A 1QYPA 3PO3S 2F4OA 4MH4A 1PFTA 1DL6A 4A3II 2NVXI 3GTMS 1K83I 4NBBA 4NOZA 4BY7I 5C4JI 1Y1VS 1Y1WI 3I4MI 4NBFA 1L1OC 3EERA 5C3EI 3GCFA 4A3LI 1TFIA 3HOYI 3ESWA 4XX2A 3HOVI 3GTKI 4NBGA 2E2HI 4Y7NI 4NBHA 3CQZI 2R7ZI 2F4MA 1TWFI 1TWCI 3VMIA 2R92I 4NBEA 3S1RI 2R93I 2JA7I 2B63I 2JNYA 1RO4A 1R9TI 2VUMI 3M3YI 3S16I 4Y52I 4NBDA 1I3QI 3LUSA 1X3ZA 4NBAA 2YU9I 2DE7A 1ML8A 3GTPI 3PO3I 2NVTI 4BXXI 3I07A 1X3WA 2K5RA 1Y1VI 4A3JI 3S1QI 3S2DI 4A93I 3S15I 3GTOI 1WCMI 2P3YA 3VMGA 4BBSI 1N2FA 2JA8I 3RZOI 3H3VJ 4A3FI 3HOUI 2NVYI 2AKLA 2JA6I 3HOXI 1I50I 4X6AI 4BY1I 5IP7I 3GTLI 1LQLA 1ZB9A 3RZDI 2E2JI 3VMHA 4A3MI 2HF1A 3HOWI 5CM2M 3GTMI 4NB9A 3D6WA 1SFOI 2J6AA 3K7AI 2BJOA 1ZB8A 3GTQI 4A3EI 2DE5A 5IP9I 1RLYA 4NBCA 3M4OI 1TWAI 3S1MI 3U50C 4A3BI 2RBLA 4A3CI 4BBRI 1I6HI 2JR6A 4A3KI 3VB9A 1TWGI 3S1NI
chains in the Genus database with same CATH superfamily
3CPWY 2QR1B 2QRCB 3S17I 2ZAEB 5A2Qb 5D1OB 2NAPA 1YIJZ 2OOXB 2OTL1 5C44I 1YJN1 3I4NI 1USPA 1NUIA 3IR7A 1VQMZ 1Q861 1VLAA 2JIQA 3PO2I 3PO3S 2F4OA 4MH4A 1S7MA 2V3VA 4NOZA 4BY7I 5C4JI 1RQFA 3F3FC 4E33A 3I56Z 2JIOA 3CCEZ 2P28A 3J81b 1M1K2 4NBFA 1L1OC 1NJI2 3HOYI 2IV2X 4XX2A 1YHQZ 1KQSZ 4NBGA 4RV9A 2K3RA 5IT9f 4MD9A 3CD6Z 3KIHA 2HU9A 1X0TA 3S1RI 3G71Z 2JNYA 1VQOZ 1VQ5Z 3M3YI 1I3QI 1VQ81 3T4NB 2DE7A 4MD8A 3JAMf 3PO3I 5T67A 2VPZA 2K5RA 1Y1VI 2E7ZA 3S15I 1NP6A 1YJWZ 2JIPA 3OW2Y 1W2BY 2NVYI 4E2YA 1I50I 3IX0A 4BY1I 4HH4A 3P5JB 3G6E1 3J80b 1VQ4Z 1WZNA 1AA6A 1K8A2 3CCV1 4RVDA 1Q822 3D6WA 1SFOI 3K7AI 2BJOA 3GTQI 3CPWZ 4A3EI 2DE5A 5IP9I 1RLYA 3CCQ1 2KI7B 3CC2Z 4NBCA 3S1MI 3U50C 3IFUA 4BBRI 1S72Z 2RT9A 2JIMA 2JR6A 2JIRA 2W03A 2QRDB 4QTUA 3S14I 3CCM1 2DE6A 3S2HI 1RO0A 2PM9A 2G2KA 3GTJI 3CCMZ 3H0GI 1N8R1 1TWHI 3CCUZ 4MXUA 3I561 4QTTA 4AYBA 4A3DI 3GTGI 4HGYA 5FLMI 2JUBA 1S721 2JS4A 2QREB 3CC71 4DK1A 2W04A 1PFTA 2NVXI 3CCQZ 1QVGY 2LEXA 3GTMS 1Q7Y1 3D2LA 2QLVB 2E9HA 5D1PA 3CCJ1 3I4MI 1VQ9Z 3GCFA 1VQ41 3G6EZ 2WAQA 3ESWA 1P9NA 1KRLA 3GTKI 1FDOA 3HOVI 3CCLZ 4NBHA 3IF8A 2H85A 4E2ZA 4E2XA 5FLXf 3CME1 1QXFA 2VPXA 4MONA 1YI21 3J7A4 3CCS1 2JA7I 3NFZA 1RO4A 1VQPZ 1VQL1 1R9TI 4NBDA 4RS4A 4NBAA 2YU9I 2IZ3A 3CC4Z 4A3JI 3G711 3S1QI 3S2DI 5A2Qf 1WCMI 3VMGA 3NDIA 3CXCY 2JA8I 2AYDA 3OW2Z 1W2BZ 3CCSZ 2AKLA 4HGZA 1QF8A 2VPWA 3CXCZ 2OZKA 3CCE1 5CM2M 1NJI1 3CCJZ 2I3CA 1VQ61 1Z03A 4A3BI 2PMZA 4NH1C 1YUKA 2RIQA 1YJ9Z 4A3CI 1YIT1 2QEX1 3VB9A 3S1NI 4E32A 1VQM1 4MRIA 2E2II 2NVQI 1YUAA 5D1OA 2OTLZ 1YIJ1 3CCR1 2GTHA 2IZ4A 2M6NA 3GKQA 1WW9A 3Q87A 3I55Z 2LIYA 3CCU1 5C4XI 4RVFA 3FQMA 2OOYB 3FKII 3BG0B 4NFRA 4A3II 1K83I 3NH4A 4NBBA 2JMOA 1Y1VS 3CC21 1KC82 4E31A 1Y1WI 2RHBA 4DGLA 1JJ2Z 3D9XA 1RO2A 4A3LI 1M902 3CC41 2YADA 3F3PC 3CCVZ 1KD12 3CQZI 2R7ZI 2F4MA 1K732 1Z01A 4DQYB 4MD7A 2R92I 4NBEA 2R93I 1SIWA 2R6MA 1YJW1 2B63I 3FQQA 3NH5A 3NH8A 3KIFA 1QVFZ 2VUMI 3S16I 2VF1A 1VQN1 3LUSA 1X3ZA 3MONA 3TDHB 1VQ91 3I07A 1VQKZ 4CL1A 1VQ8Z 4E2WA 1VQ51 3BG1B 2WB1A 4BBSI 1RNIA 3J81f 3CMA1 3VTNA 4A3FI 1KD11 3HOUI 2JA6I 3HOXI 3CD61 2VPYA 3CC7Z 4X6AI 5IP7I 4S1TA 3GTLI 1LQLA 1ZB9A 5IT9b 2E2JI 1YHQ1 4A3MI 1M1K1 2HF1A 3HOWI 2J6AA 1ZB8A 3G4S1 5LL6f 4RVHA 5T64A 1I6HI 1FDIA 1Q862 3JAMb 1VQ71 2Y0SA 2O4HA 2PK7A 3HOZI 5FLXb 2VUGA 1Q812 4NB8A 2JA5I 1YJNZ 1Q16A 1Z02A 1USPB 2QKDA 1VQ7Z 2KPIA 1Q811 4A3GI 1Q7Y2 3MZKB 3TE5B 1QYPA 2GU2A 2Q4ZA 3J80f 1QVGZ 1DL6A 3MZLB 2LFUA 2V8JA 3G4SZ 1QVFY 4EWCA 1JWHC 2V8IA 3I551 2O53A 3QWUA 3EERA 3CCRZ 5C3EI 1Q821 1TFIA 2E2HI 4Y7NI 1K8A1 1WJ2A 2QEXZ 1K9M2 2V8KA 1YITZ 1YJ91 1VQO1 3CMAZ 1TWFI 1TWCI 3VMIA 1VQ6Z 3EEDA 4TNUA 2QA4Z 1VQK1 2EGTA 4Y52I 3HKZA 4RVGA 1VQNZ 1ML8A 3GTPI 2NVTI 4BXXI 1X3WA 1WIIA 4A93I 3GTOI 1JJ2Y 2P3YA 2QA41 1N2FA 3RZOI 1K9M1 3H3VJ 1K731 1ZH1A 4E30A 3RZDI 3VMHA 1N8R2 2M48A 2V45A 1VQP1 1VQLZ 4NB9A 1Y8CA 1M901 3GTMI 5AN9F 1KQSY 3NDJA 1KC81 1YI2Z 3M4OI 1TWAI 3CMEZ 2RBLA 5T6BA 2Q51A 2RPRA 2OTJZ 2GTIA 4A3KI 1TWGI 3CCL1 2OTJ1
chains in the Genus database with same CATH topology
3CPWY 2QR1B 2QRCB 3S17I 2ZAEB 5A2Qb 5D1OB 1YIJZ 2OOXB 2OTL1 5C44I 1YJN1 3I4NI 1USPA 1NUIA 1VQMZ 1Q861 1VLAA 3PO2I 3PO3S 2F4OA 4MH4A 1S7MA 4NOZA 4BY7I 5C4JI 1RQFA 3F3FC 4E33A 3I56Z 3CCEZ 2P28A 3J81b 1M1K2 4NBFA 1L1OC 1NJI2 3HOYI 4XX2A 1YHQZ 1KQSZ 4NBGA 4RV9A 2K3RA 5IT9f 4MD9A 3CD6Z 3KIHA 2HU9A 1X0TA 3S1RI 3G71Z 2JNYA 1VQOZ 1VQ5Z 3M3YI 1I3QI 1VQ81 3T4NB 2DE7A 4MD8A 3JAMf 3PO3I 5T67A 2K5RA 1Y1VI 3S15I 1NP6A 1YJWZ 3OW2Y 1W2BY 2NVYI 4E2YA 1I50I 3IX0A 4BY1I 4HH4A 3P5JB 3G6E1 3J80b 1VQ4Z 1K8A2 3CCV1 4RVDA 1Q822 3D6WA 1SFOI 3K7AI 2BJOA 3GTQI 3CPWZ 4A3EI 2DE5A 5IP9I 1RLYA 3CCQ1 2KI7B 3CC2Z 4NBCA 3S1MI 3U50C 3IFUA 4BBRI 1S72Z 2RT9A 2JR6A 2W03A 2QRDB 4QTUA 3S14I 3CCM1 2DE6A 3S2HI 1RO0A 2PM9A 2G2KA 3GTJI 3CCMZ 3H0GI 1N8R1 1TWHI 3CCUZ 4MXUA 3I561 4QTTA 4AYBA 4A3DI 3GTGI 4HGYA 5FLMI 2JUBA 1S721 2JS4A 2QREB 3CC71 4DK1A 2W04A 1PFTA 2NVXI 3CCQZ 1QVGY 3GTMS 1Q7Y1 2QLVB 2E9HA 5D1PA 3CCJ1 3I4MI 1VQ9Z 3GCFA 1VQ41 3G6EZ 2WAQA 3ESWA 1P9NA 1KRLA 3GTKI 3HOVI 3CCLZ 4NBHA 3IF8A 2H85A 4E2ZA 4E2XA 5FLXf 3CME1 4MONA 1YI21 3J7A4 3CCS1 2JA7I 3NFZA 1RO4A 1VQPZ 1VQL1 1R9TI 4NBDA 4RS4A 4NBAA 2YU9I 2IZ3A 3CC4Z 4A3JI 3G711 3S1QI 3S2DI 5A2Qf 1WCMI 3VMGA 3NDIA 3CXCY 2JA8I 3OW2Z 1W2BZ 3CCSZ 2AKLA 4HGZA 1QF8A 3CXCZ 2OZKA 3CCE1 5CM2M 1NJI1 3CCJZ 2I3CA 1VQ61 1Z03A 4A3BI 2PMZA 4NH1C 1YUKA 2RIQA 1YJ9Z 4A3CI 1YIT1 2QEX1 3VB9A 3S1NI 4E32A 1VQM1 4MRIA 2E2II 2NVQI 1YUAA 5D1OA 2OTLZ 1YIJ1 3CCR1 2GTHA 2IZ4A 2M6NA 3GKQA 1WW9A 3Q87A 3I55Z 2LIYA 3CCU1 5C4XI 4RVFA 3FQMA 2OOYB 3FKII 3BG0B 4NFRA 4A3II 1K83I 3NH4A 4NBBA 2JMOA 1Y1VS 3CC21 1KC82 4E31A 1Y1WI 2RHBA 4DGLA 1JJ2Z 3D9XA 1RO2A 4A3LI 1M902 3CC41 2YADA 3F3PC 3CCVZ 1KD12 3CQZI 2R7ZI 2F4MA 1K732 1Z01A 4DQYB 4MD7A 2R92I 4NBEA 2R93I 2R6MA 1YJW1 2B63I 3FQQA 3NH5A 3NH8A 3KIFA 1QVFZ 2VUMI 3S16I 2VF1A 1VQN1 3LUSA 1X3ZA 3MONA 3TDHB 1VQ91 3I07A 1VQKZ 4CL1A 1VQ8Z 4E2WA 1VQ51 3BG1B 2WB1A 4BBSI 1RNIA 3J81f 3CMA1 3VTNA 4A3FI 1KD11 3HOUI 2JA6I 3HOXI 3CD61 3CC7Z 4X6AI 5IP7I 4S1TA 3GTLI 1LQLA 1ZB9A 5IT9b 2E2JI 1YHQ1 4A3MI 1M1K1 2HF1A 3HOWI 2J6AA 1ZB8A 3G4S1 5LL6f 4RVHA 5T64A 1I6HI 1Q862 3JAMb 1VQ71 2Y0SA 2O4HA 2PK7A 3HOZI 5FLXb 2VUGA 1Q812 4NB8A 2JA5I 1YJNZ 1Z02A 1USPB 2QKDA 1VQ7Z 2KPIA 1Q811 4A3GI 1Q7Y2 3MZKB 3TE5B 1QYPA 2GU2A 2Q4ZA 3J80f 1QVGZ 1DL6A 3MZLB 2LFUA 2V8JA 3G4SZ 1QVFY 4EWCA 1JWHC 2V8IA 3I551 2O53A 3QWUA 3EERA 3CCRZ 5C3EI 1Q821 1TFIA 2E2HI 4Y7NI 1K8A1 2QEXZ 1K9M2 2V8KA 1YITZ 1YJ91 1VQO1 3CMAZ 1TWFI 1TWCI 3VMIA 1VQ6Z 3EEDA 4TNUA 2QA4Z 1VQK1 2EGTA 4Y52I 3HKZA 4RVGA 1VQNZ 1ML8A 3GTPI 2NVTI 4BXXI 1X3WA 1WIIA 4A93I 3GTOI 1JJ2Y 2P3YA 2QA41 1N2FA 3RZOI 1K9M1 3H3VJ 1K731 1ZH1A 4E30A 3RZDI 3VMHA 1N8R2 2M48A 1VQP1 1VQLZ 1M901 4NB9A 3GTMI 5AN9F 1KQSY 3NDJA 1KC81 1YI2Z 3M4OI 1TWAI 3CMEZ 2RBLA 5T6BA 2Q51A 2RPRA 2OTJZ 2GTIA 4A3KI 1TWGI 3CCL1 2OTJ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2I I;  2NVQ I;  1YUA A;  4QTU A;  3S14 I;  3S17 I;  2PK7 A;  3HOZ I;  2DE6 A;  3S2H I;  4NB8 A;  2JA5 I;  3GTJ I;  3GKQ A;  1WW9 A;  3Q87 A;  1USP B;  3H0G I;  1TWH I;  5C44 I;  5C4X I;  4QTT A;  4A3D I;  3I4N I;  1USP A;  1NUI A;  2KPI A;  3GTG I;  4A3G I;  1VLA A;  5FLM I;  3FKI I;  3PO2 I;  2JS4 A;  1QYP A;  3PO3 S;  2F4O A;  4MH4 A;  1PFT A;  1DL6 A;  4A3I I;  2NVX I;  3GTM S;  1K83 I;  4NBB A;  4NOZ A;  4BY7 I;  5C4J I;  1Y1V S;  1Y1W I;  3I4M I;  4NBF A;  1L1O C;  3EER A;  5C3E I;  3GCF A;  4A3L I;  1TFI A;  3HOY I;  3ESW A;  4XX2 A;  3HOV I;  3GTK I;  4NBG A;  2E2H I;  4Y7N I;  4NBH A;  3CQZ I;  2R7Z I;  2F4M A;  1TWF I;  1TWC I;  3VMI A;  2R92 I;  4NBE A;  3S1R I;  2R93 I;  2JA7 I;  2B63 I;  2JNY A;  1RO4 A;  1R9T I;  2VUM I;  3M3Y I;  3S16 I;  4Y52 I;  4NBD A;  1I3Q I;  3LUS A;  1X3Z A;  4NBA A;  2YU9 I;  2DE7 A;  1ML8 A;  3GTP I;  3PO3 I;  2NVT I;  4BXX I;  3I07 A;  1X3W A;  2K5R A;  1Y1V I;  4A3J I;  3S1Q I;  3S2D I;  4A93 I;  3S15 I;  3GTO I;  1WCM I;  2P3Y A;  3VMG A;  4BBS I;  1N2F A;  2JA8 I;  3RZO I;  3H3V J;  4A3F I;  3HOU I;  2NVY I;  2AKL A;  2JA6 I;  3HOX I;  1I50 I;  4X6A I;  4BY1 I;  5IP7 I;  3GTL I;  1LQL A;  1ZB9 A;  3RZD I;  2E2J I;  3VMH A;  4A3M I;  2HF1 A;  3HOW I;  5CM2 M;  3GTM I;  4NB9 A;  3D6W A;  1SFO I;  2J6A A;  3K7A I;  2BJO A;  1ZB8 A;  3GTQ I;  4A3E I;  2DE5 A;  5IP9 I;  1RLY A;  4NBC A;  3M4O I;  1TWA I;  3S1M I;  3U50 C;  4A3B I;  2RBL A;  4A3C I;  4BBR I;  1I6H I;  2JR6 A;  4A3K I;  3VB9 A;  1TWG I;  3S1N I; 
#chains in the Genus database with same CATH topology
 3CPW Y;  2QR1 B;  2QRC B;  3S17 I;  2ZAE B;  5A2Q b;  5D1O B;  2NAP A;  1YIJ Z;  2OOX B;  2OTL 1;  5C44 I;  1YJN 1;  3I4N I;  1USP A;  1NUI A;  3IR7 A;  1VQM Z;  1Q86 1;  1VLA A;  2JIQ A;  3PO2 I;  3PO3 S;  2F4O A;  4MH4 A;  1S7M A;  2V3V A;  4NOZ A;  4BY7 I;  5C4J I;  1RQF A;  3F3F C;  4E33 A;  3I56 Z;  2JIO A;  3CCE Z;  2P28 A;  3J81 b;  1M1K 2;  4NBF A;  1L1O C;  1NJI 2;  3HOY I;  2IV2 X;  4XX2 A;  1YHQ Z;  1KQS Z;  4NBG A;  4RV9 A;  2K3R A;  5IT9 f;  4MD9 A;  3CD6 Z;  3KIH A;  2HU9 A;  1X0T A;  3S1R I;  3G71 Z;  2JNY A;  1VQO Z;  1VQ5 Z;  3M3Y I;  1I3Q I;  1VQ8 1;  3T4N B;  2DE7 A;  4MD8 A;  3JAM f;  3PO3 I;  5T67 A;  2VPZ A;  2K5R A;  1Y1V I;  2E7Z A;  3S15 I;  1NP6 A;  1YJW Z;  2JIP A;  3OW2 Y;  1W2B Y;  2NVY I;  4E2Y A;  1I50 I;  3IX0 A;  4BY1 I;  4HH4 A;  3P5J B;  3G6E 1;  3J80 b;  1VQ4 Z;  1WZN A;  1AA6 A;  1K8A 2;  3CCV 1;  4RVD A;  1Q82 2;  3D6W A;  1SFO I;  3K7A I;  2BJO A;  3GTQ I;  3CPW Z;  4A3E I;  2DE5 A;  5IP9 I;  1RLY A;  3CCQ 1;  2KI7 B;  3CC2 Z;  4NBC A;  3S1M I;  3U50 C;  3IFU A;  4BBR I;  1S72 Z;  2RT9 A;  2JIM A;  2JR6 A;  2JIR A;  2W03 A;  2QRD B;  4QTU A;  3S14 I;  3CCM 1;  2DE6 A;  3S2H I;  1RO0 A;  2PM9 A;  2G2K A;  3GTJ I;  3CCM Z;  3H0G I;  1N8R 1;  1TWH I;  3CCU Z;  4MXU A;  3I56 1;  4QTT A;  4AYB A;  4A3D I;  3GTG I;  4HGY A;  5FLM I;  2JUB A;  1S72 1;  2JS4 A;  2QRE B;  3CC7 1;  4DK1 A;  2W04 A;  1PFT A;  2NVX I;  3CCQ Z;  1QVG Y;  2LEX A;  3GTM S;  1Q7Y 1;  3D2L A;  2QLV B;  2E9H A;  5D1P A;  3CCJ 1;  3I4M I;  1VQ9 Z;  3GCF A;  1VQ4 1;  3G6E Z;  2WAQ A;  3ESW A;  1P9N A;  1KRL A;  3GTK I;  1FDO A;  3HOV I;  3CCL Z;  4NBH A;  3IF8 A;  2H85 A;  4E2Z A;  4E2X A;  5FLX f;  3CME 1;  1QXF A;  2VPX A;  4MON A;  1YI2 1;  3J7A 4;  3CCS 1;  2JA7 I;  3NFZ A;  1RO4 A;  1VQP Z;  1VQL 1;  1R9T I;  4NBD A;  4RS4 A;  4NBA A;  2YU9 I;  2IZ3 A;  3CC4 Z;  4A3J I;  3G71 1;  3S1Q I;  3S2D I;  5A2Q f;  1WCM I;  3VMG A;  3NDI A;  3CXC Y;  2JA8 I;  2AYD A;  3OW2 Z;  1W2B Z;  3CCS Z;  2AKL A;  4HGZ A;  1QF8 A;  2VPW A;  3CXC Z;  2OZK A;  3CCE 1;  5CM2 M;  1NJI 1;  3CCJ Z;  2I3C A;  1VQ6 1;  1Z03 A;  4A3B I;  2PMZ A;  4NH1 C;  1YUK A;  2RIQ A;  1YJ9 Z;  4A3C I;  1YIT 1;  2QEX 1;  3VB9 A;  3S1N I;  4E32 A;  1VQM 1;  4MRI A;  2E2I I;  2NVQ I;  1YUA A;  5D1O A;  2OTL Z;  1YIJ 1;  3CCR 1;  2GTH A;  2IZ4 A;  2M6N A;  3GKQ A;  1WW9 A;  3Q87 A;  3I55 Z;  2LIY A;  3CCU 1;  5C4X I;  4RVF A;  3FQM A;  2OOY B;  3FKI I;  3BG0 B;  4NFR A;  4A3I I;  1K83 I;  3NH4 A;  4NBB A;  2JMO A;  1Y1V S;  3CC2 1;  1KC8 2;  4E31 A;  1Y1W I;  2RHB A;  4DGL A;  1JJ2 Z;  3D9X A;  1RO2 A;  4A3L I;  1M90 2;  3CC4 1;  2YAD A;  3F3P C;  3CCV Z;  1KD1 2;  3CQZ I;  2R7Z I;  2F4M A;  1K73 2;  1Z01 A;  4DQY B;  4MD7 A;  2R92 I;  4NBE A;  2R93 I;  1SIW A;  2R6M A;  1YJW 1;  2B63 I;  3FQQ A;  3NH5 A;  3NH8 A;  3KIF A;  1QVF Z;  2VUM I;  3S16 I;  2VF1 A;  1VQN 1;  3LUS A;  1X3Z A;  3MON A;  3TDH B;  1VQ9 1;  3I07 A;  1VQK Z;  4CL1 A;  1VQ8 Z;  4E2W A;  1VQ5 1;  3BG1 B;  2WB1 A;  4BBS I;  1RNI A;  3J81 f;  3CMA 1;  3VTN A;  4A3F I;  1KD1 1;  3HOU I;  2JA6 I;  3HOX I;  3CD6 1;  2VPY A;  3CC7 Z;  4X6A I;  5IP7 I;  4S1T A;  3GTL I;  1LQL A;  1ZB9 A;  5IT9 b;  2E2J I;  1YHQ 1;  4A3M I;  1M1K 1;  2HF1 A;  3HOW I;  2J6A A;  1ZB8 A;  3G4S 1;  5LL6 f;  4RVH A;  5T64 A;  1I6H I;  1FDI A;  1Q86 2;  3JAM b;  1VQ7 1;  2Y0S A;  2O4H A;  2PK7 A;  3HOZ I;  5FLX b;  2VUG A;  1Q81 2;  4NB8 A;  2JA5 I;  1YJN Z;  1Q16 A;  1Z02 A;  1USP B;  2QKD A;  1VQ7 Z;  2KPI A;  1Q81 1;  4A3G I;  1Q7Y 2;  3MZK B;  3TE5 B;  1QYP A;  2GU2 A;  2Q4Z A;  3J80 f;  1QVG Z;  1DL6 A;  3MZL B;  2LFU A;  2V8J A;  3G4S Z;  1QVF Y;  4EWC A;  1JWH C;  2V8I A;  3I55 1;  2O53 A;  3QWU A;  3EER A;  3CCR Z;  5C3E I;  1Q82 1;  1TFI A;  2E2H I;  4Y7N I;  1K8A 1;  1WJ2 A;  2QEX Z;  1K9M 2;  2V8K A;  1YIT Z;  1YJ9 1;  1VQO 1;  3CMA Z;  1TWF I;  1TWC I;  3VMI A;  1VQ6 Z;  3EED A;  4TNU A;  2QA4 Z;  1VQK 1;  2EGT A;  4Y52 I;  3HKZ A;  4RVG A;  1VQN Z;  1ML8 A;  3GTP I;  2NVT I;  4BXX I;  1X3W A;  1WII A;  4A93 I;  3GTO I;  1JJ2 Y;  2P3Y A;  2QA4 1;  1N2F A;  3RZO I;  1K9M 1;  3H3V J;  1K73 1;  1ZH1 A;  4E30 A;  3RZD I;  3VMH A;  1N8R 2;  2M48 A;  2V45 A;  1VQP 1;  1VQL Z;  4NB9 A;  1Y8C A;  1M90 1;  3GTM I;  5AN9 F;  1KQS Y;  3NDJ A;  1KC8 1;  1YI2 Z;  3M4O I;  1TWA I;  3CME Z;  2RBL A;  5T6B A;  2Q51 A;  2RPR A;  2OTJ Z;  2GTI A;  4A3K I;  1TWG I;  3CCL 1;  2OTJ 1; 
#chains in the Genus database with same CATH homology
 3CPW Y;  2QR1 B;  2QRC B;  3S17 I;  2ZAE B;  5A2Q b;  5D1O B;  1YIJ Z;  2OOX B;  2OTL 1;  5C44 I;  1YJN 1;  3I4N I;  1USP A;  1NUI A;  1VQM Z;  1Q86 1;  1VLA A;  3PO2 I;  3PO3 S;  2F4O A;  4MH4 A;  1S7M A;  4NOZ A;  4BY7 I;  5C4J I;  1RQF A;  3F3F C;  4E33 A;  3I56 Z;  3CCE Z;  2P28 A;  3J81 b;  1M1K 2;  4NBF A;  1L1O C;  1NJI 2;  3HOY I;  4XX2 A;  1YHQ Z;  1KQS Z;  4NBG A;  4RV9 A;  2K3R A;  5IT9 f;  4MD9 A;  3CD6 Z;  3KIH A;  2HU9 A;  1X0T A;  3S1R I;  3G71 Z;  2JNY A;  1VQO Z;  1VQ5 Z;  3M3Y I;  1I3Q I;  1VQ8 1;  3T4N B;  2DE7 A;  4MD8 A;  3JAM f;  3PO3 I;  5T67 A;  2K5R A;  1Y1V I;  3S15 I;  1NP6 A;  1YJW Z;  3OW2 Y;  1W2B Y;  2NVY I;  4E2Y A;  1I50 I;  3IX0 A;  4BY1 I;  4HH4 A;  3P5J B;  3G6E 1;  3J80 b;  1VQ4 Z;  1K8A 2;  3CCV 1;  4RVD A;  1Q82 2;  3D6W A;  1SFO I;  3K7A I;  2BJO A;  3GTQ I;  3CPW Z;  4A3E I;  2DE5 A;  5IP9 I;  1RLY A;  3CCQ 1;  2KI7 B;  3CC2 Z;  4NBC A;  3S1M I;  3U50 C;  3IFU A;  4BBR I;  1S72 Z;  2RT9 A;  2JR6 A;  2W03 A;  2QRD B;  4QTU A;  3S14 I;  3CCM 1;  2DE6 A;  3S2H I;  1RO0 A;  2PM9 A;  2G2K A;  3GTJ I;  3CCM Z;  3H0G I;  1N8R 1;  1TWH I;  3CCU Z;  4MXU A;  3I56 1;  4QTT A;  4AYB A;  4A3D I;  3GTG I;  4HGY A;  5FLM I;  2JUB A;  1S72 1;  2JS4 A;  2QRE B;  3CC7 1;  4DK1 A;  2W04 A;  1PFT A;  2NVX I;  3CCQ Z;  1QVG Y;  3GTM S;  1Q7Y 1;  2QLV B;  2E9H A;  5D1P A;  3CCJ 1;  3I4M I;  1VQ9 Z;  3GCF A;  1VQ4 1;  3G6E Z;  2WAQ A;  3ESW A;  1P9N A;  1KRL A;  3GTK I;  3HOV I;  3CCL Z;  4NBH A;  3IF8 A;  2H85 A;  4E2Z A;  4E2X A;  5FLX f;  3CME 1;  4MON A;  1YI2 1;  3J7A 4;  3CCS 1;  2JA7 I;  3NFZ A;  1RO4 A;  1VQP Z;  1VQL 1;  1R9T I;  4NBD A;  4RS4 A;  4NBA A;  2YU9 I;  2IZ3 A;  3CC4 Z;  4A3J I;  3G71 1;  3S1Q I;  3S2D I;  5A2Q f;  1WCM I;  3VMG A;  3NDI A;  3CXC Y;  2JA8 I;  3OW2 Z;  1W2B Z;  3CCS Z;  2AKL A;  4HGZ A;  1QF8 A;  3CXC Z;  2OZK A;  3CCE 1;  5CM2 M;  1NJI 1;  3CCJ Z;  2I3C A;  1VQ6 1;  1Z03 A;  4A3B I;  2PMZ A;  4NH1 C;  1YUK A;  2RIQ A;  1YJ9 Z;  4A3C I;  1YIT 1;  2QEX 1;  3VB9 A;  3S1N I;  4E32 A;  1VQM 1;  4MRI A;  2E2I I;  2NVQ I;  1YUA A;  5D1O A;  2OTL Z;  1YIJ 1;  3CCR 1;  2GTH A;  2IZ4 A;  2M6N A;  3GKQ A;  1WW9 A;  3Q87 A;  3I55 Z;  2LIY A;  3CCU 1;  5C4X I;  4RVF A;  3FQM A;  2OOY B;  3FKI I;  3BG0 B;  4NFR A;  4A3I I;  1K83 I;  3NH4 A;  4NBB A;  2JMO A;  1Y1V S;  3CC2 1;  1KC8 2;  4E31 A;  1Y1W I;  2RHB A;  4DGL A;  1JJ2 Z;  3D9X A;  1RO2 A;  4A3L I;  1M90 2;  3CC4 1;  2YAD A;  3F3P C;  3CCV Z;  1KD1 2;  3CQZ I;  2R7Z I;  2F4M A;  1K73 2;  1Z01 A;  4DQY B;  4MD7 A;  2R92 I;  4NBE A;  2R93 I;  2R6M A;  1YJW 1;  2B63 I;  3FQQ A;  3NH5 A;  3NH8 A;  3KIF A;  1QVF Z;  2VUM I;  3S16 I;  2VF1 A;  1VQN 1;  3LUS A;  1X3Z A;  3MON A;  3TDH B;  1VQ9 1;  3I07 A;  1VQK Z;  4CL1 A;  1VQ8 Z;  4E2W A;  1VQ5 1;  3BG1 B;  2WB1 A;  4BBS I;  1RNI A;  3J81 f;  3CMA 1;  3VTN A;  4A3F I;  1KD1 1;  3HOU I;  2JA6 I;  3HOX I;  3CD6 1;  3CC7 Z;  4X6A I;  5IP7 I;  4S1T A;  3GTL I;  1LQL A;  1ZB9 A;  5IT9 b;  2E2J I;  1YHQ 1;  4A3M I;  1M1K 1;  2HF1 A;  3HOW I;  2J6A A;  1ZB8 A;  3G4S 1;  5LL6 f;  4RVH A;  5T64 A;  1I6H I;  1Q86 2;  3JAM b;  1VQ7 1;  2Y0S A;  2O4H A;  2PK7 A;  3HOZ I;  5FLX b;  2VUG A;  1Q81 2;  4NB8 A;  2JA5 I;  1YJN Z;  1Z02 A;  1USP B;  2QKD A;  1VQ7 Z;  2KPI A;  1Q81 1;  4A3G I;  1Q7Y 2;  3MZK B;  3TE5 B;  1QYP A;  2GU2 A;  2Q4Z A;  3J80 f;  1QVG Z;  1DL6 A;  3MZL B;  2LFU A;  2V8J A;  3G4S Z;  1QVF Y;  4EWC A;  1JWH C;  2V8I A;  3I55 1;  2O53 A;  3QWU A;  3EER A;  3CCR Z;  5C3E I;  1Q82 1;  1TFI A;  2E2H I;  4Y7N I;  1K8A 1;  2QEX Z;  1K9M 2;  2V8K A;  1YIT Z;  1YJ9 1;  1VQO 1;  3CMA Z;  1TWF I;  1TWC I;  3VMI A;  1VQ6 Z;  3EED A;  4TNU A;  2QA4 Z;  1VQK 1;  2EGT A;  4Y52 I;  3HKZ A;  4RVG A;  1VQN Z;  1ML8 A;  3GTP I;  2NVT I;  4BXX I;  1X3W A;  1WII A;  4A93 I;  3GTO I;  1JJ2 Y;  2P3Y A;  2QA4 1;  1N2F A;  3RZO I;  1K9M 1;  3H3V J;  1K73 1;  1ZH1 A;  4E30 A;  3RZD I;  3VMH A;  1N8R 2;  2M48 A;  1VQP 1;  1VQL Z;  1M90 1;  4NB9 A;  3GTM I;  5AN9 F;  1KQS Y;  3NDJ A;  1KC8 1;  1YI2 Z;  3M4O I;  1TWA I;  3CME Z;  2RBL A;  5T6B A;  2Q51 A;  2RPR A;  2OTJ Z;  2GTI A;  4A3K I;  1TWG I;  3CCL 1;  2OTJ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...