4BY9D

The structure of the box cd enzyme reveals regulation of rrna methylation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
121
structure length
121
Chain Sequence
b'KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SSR26
publication title The Structure of the Box C/D Enzyme Reveals Regulation of RNA Methylation.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase/rna
total genus 36
structure length 121
sequence length 121
chains with identical sequence G, J, M
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 4by9D00
3CMAF 3CG6A 3LWRC 3CCMF 3CPQA 1W41A 1RLGA 1YJ9F 5EWRA 2OHWA 1QVGF 1VQ7F 5FJ4C 3AGKA 1GO0A 3CPWF 3ON1A 3J7AR 3CCRF 1W3EX 1YITF 2OTJF 2OTLF 1W40A 3PLAC 2QEXF 3E20B 2QA4F 4X3LA 2WALA 1VQNF 3SIUA 3JAMM 1ZWZA 1VQMF 3G6EF 3RA5A 1VQ8F 1IPAA 1VQOF 1Q86H 1K9MH 1VQKF 3CCQF 3NK6A 1SDSA 5GANK 3GYQA 1X7OA 3IR9A 3CCJF 3N4YA 1W2BF 1X7PA 1X52A 3HJWC 3CD6F 3CC7F 3VI6A 2KG4A 1VQ5F 4BY9D 2JNBA 1RA4A 2KTVA 3LWOC 2CZWA 5GIPC 1NJIH 1W42A 2OZBA 1XBIA 1N8RH 5GINC 1H7MA 1Q81H 2I6DA 3RA6A 2QI2A 3HAXD 3LFOA 2KTUA 1Q82H 1YHQF 1Q7YH 3OBYA 1YJNF 4NUTA 3WXMB 3CCSF 3J81M 1GO1A 5EO3A 3I56F 5G4UC 3CC2F 3CCLF 2LBWA 1NMUB 1S72F 1KQSF 3NMUC 2AIFA 1YI2F 3SIVA 3CCEF 4X3MA 1VQ4F 3LWVC 3I55F 3J80M 3G4SF 1VQ9F 1VQLF 3OW2F 5GAPK 3FFMA 1PXWA 4TZZA 3CC4F 3E1YA 3CCUF 3CXCF 3G71F 2ALEA 3JCMM 1VQ6F 3N4ZA 5FLXM 3MCAB 5GIOC 3CMEF 2FC3A 3CCVF 1QVFF 1YIJF 1KD1H 4LCKA 1GZ0A 3V7QA 4C4WC 1E7KA 1VQPF 1K8AH 5IT9M 3NVKE 1JJ2F 2VGNA 3VMFB 2HVYD 1DT9A 1KC8H 1T0KB 1CK2A 4BW0B 1K73H 3V7EA 1M1KH 2BO1A 3O85A 3OBWA 5DCVA 3LWQC 5G4VC 3NK7A 5A2QM 3PAFA 1CN7A 2VGMA 3LWPC 3NVIB 1YJWF 1M90H 2LBXA
chains in the Genus database with same CATH superfamily
3C9RA 3B6NA 3CG6A 1W41A 2Z1FA 3JAWB 3P10A 2CWJA 1RLGA 2OHWA 3AGKA 3ERNA 3C9SA 3TD4A 1W3EX 1YITF 4HNAB 1Z5WA 4TV9A 5EAZA 4E6EA 3HKDA 3KJKA 3DC2A 3ELCA 2WALA 3LYBA 2ZOVA 3SIUA 3QUWA 3FD5A 4HNAA 3WJPA 4O4HA 1UFYA 1VQOF 5EZYB 5HXZA 3CCQF 5EYPB 4M8IA 3NK6A 3LMEA 1W5EA 3I7TA 4BT4A 1W55A 1X25A 3MDOA 3N2GB 3N4YA 5EYPA 1W2BF 2GVIA 3TD3A 1W581 3GTZA 3MQWA 5FNVB 4R40B 5GONA 3VCZA 3CD6F 3VYUC 1Q8RA 2CVLA 2KTVA 3LWOC 2CZWA 5FNVA 1TUBB 3S03A 4BT7A 1N8RH 5GINC 1Q81H 2I6DA 2HS3A 1VH8A 3LFOA 2EWCA 1YHQF 1Q7YH 1YJNF 3CB2A 5HY2A 4O4IB 4YJ2B 2Q1XA 3I56F 5LOVB 3CC2F 4YJ3B 4DRXA 4B62A 4O4IA 1KQSF 4BT2A 3SIVA 1CLIA 4YJ2A 4X3MA 5JQGB 3IKFA 1VQ4F 5LOVA 1SA0B 4C81A 2MQEA 4LNUA 4B45A 4ZOLB 3F0EA 1DBFA 5JQGA 4TZZA 3CC4F 2N48A 4ZHWA 2Z1TA 3E1YA 5ITZB 2QTPA 3CXCF 4I55B 3M4SA 3JCMM 4O4JB 1VQ6F 4C8GA 2ZODA 1JY8A 5FLXM 3CCVF 3P0ZA 5ITZA 3M1XA 1GZ0A 4I55A 4RQOA 1E7KA 5B8FA 4O4JA 4XCQA 1XRGA 3C9TA 5EIBC 5JVDA 4G4XA 1XHOA 1JN1A 1QAHA 2PMPA 2VGNA 2KGWA 5AVMA 5CA1B 4EI9A 4ZHQA 1QD9A 2HVYD 1T0KB 1K73H 3VYTC 3HWUA 2GZLA 5HY4A 5CA1A 2VAMA 5HXUA 4NWOB 5A2QM 5CB4B 2LCAA 4RHAA 3JALA 3E22B 1CN7A 4ERHA 4X1IB 1M90H 3RYCB 3KIZA 2YXZA 3E22A 1W57A 1W59A 2HS4A 5KMGB 5EWRA 3Q8HA 4X1IA 3OONA 3CPWF 5CA0B 1TVKB 4DXDA 3GHZA 2OTLF 1W40A 5KMGA 3PLAC 3E20B 1W5AA 5CA0A 1TVKA 2UZHA 3JAMM 2GLZA 1ZWZA 1VQMF 3S0WA 3RYFA 3VOAA 5IT9M 3IEQA 1W5BA 4U3JB 3CYPB 1SDSA 2Z1EA 5GANK 2RHLA 1YQNA 2HP3A 3IR9A 1RLUA 2DYYA 4U3JA 1X7PA 4TV9B 3MCQA 3HJWC 3HKDB 2HRYA 2KG4A 3HKBB 4I4TB 1U3PA 1VQ5F 1UI9A 4O4HB 1NJIH 1XBIA 3HKBA 4I4TA 5J2UB 3WJQA 2ZAUA 3HAXD 2G9IA 5J2TB 2H6LA 3ZP4A 5BMVB 1Q82H 2YYEA 3WGJA 3JATA 3OBYA 5J2UA 4NUTA 3CCSF 3J81M 1R1MA 5EO3A 5J2TA 5GONB 5BMVA 3VYSC 3K12A 3VIUA 4IHJB 4FFBA 5IYZB 3P4EA 2W8BC 2IG8A 3LWVC 4IHJA 3I55F 3ZOPA 5IYZA 3J80M 5LP6C 3G4SF 1KNKA 4EI7A 4G4ZA 3HTNA 3CCUF 3F0FA 2ALEA 2CHSA 3C9UA 3IEWA 2H8CA 3RYIB 1NQ3A 3CMEF 4DRXB 4BT5A 4F6RB 1KD1H 3U0OA 4C4WC 2HRUA 3JAKA 5IJ0A 3D00A 3JARB 3RYIA 2H8EA 1FFXB 4F6RA 3TD5A 2Z1UA 2HS0A 4LNUB 3VMFB 4BVTA 5JH7B 3NVKE 1KC8H 1CK2A 4TUYB 1U3LA 3JARA 3V7EA 4B5CA 1T0AA 1RQ2A 1FFXA 5JCOC 3RYHB 5JH7A 3LWQC 3F0DA 4TUYA 2ZVYA 4U39A 3RYHA 3NVIB 2LBXA 3QTYA 3M84A 1OAPA 3CYQA 1SZQA 5JVDB 1YJ9F 1VQ7F 4ZHQB 2ZVZA 5FJ4C 1GO0A 4BVSA 3S0YA 3J7AR 3F0GA 2OTJF 2QEXF 5JCOA 4X3LA 3WPWA 1QU9A 3JALB 5EIBD 2OTMA 5EB0A 2PHNA 3RA5A 3V4DA 1VQ8F 4G4VA 1K9MH 1VQKF 3N2KB 2VXYA 3WGNA 1VK3A 3N2KA 3CCJF 4O4LB 4X1YB 2ZF8A 5C8YB 4BVRA 3WPXA 4BY9D 4O4LA 2JNBA 4X1YA 3RYFB 2AIZP 5HWEA 5C8YA 4TV8B 3S0HA 4X20A 3VTIC 2L26A 2VAPA 3RA6A 2QI2A 2BTOA 4TV8A 4KWEA 4BT6A 2BTUA 2UYPA 2I6RA 5MN5A 2VAWA 5LYJA 2IQQA 3WXMB 2BTQB 5G4UC 1IV2A 3KHNA 4X1KB 3K14A 4ZHYB 3CCLF 2LBWA 2CW4A 1YI2F 2V9YA 4X1KA 3ZO8A 3D54A 4C8IA 1VQLF 3HKCB 3VO8A 3OW2F 5GAPK 4NQ3A 3FFMA 1PXWA 1IV3A 3JATB 3UT5A 2NMUA 2Q1YA 2HP0B 3HKCA 1ODEA 3N4ZA 5HP8A 3LDTA 3JASA 3MCAB 5GIOC 1QVFF 2FC3A 2CSLA 2FGYA 4FFBB 4PWTA 1YIJF 4LCKA 2HP0A 3V7QA 1VQPF 2B33A 3JAWA 3I3FA 5EB1B 3D01A 5HY1A 4BW0B 2LBTA 3K2XA 1M1KH 3O85A 3OBWA 2RHOA 1VQVA 1U40A 5G4VC 4WBNB 3NK7A 1JD1A 1Z5VA 3PAFA 2R6R1 3VOBA 4BVQA 5IJ9B 2RHJA 4IIJB 1KNJA 4EI8A 1YJWF 4WBNA 3KE1A 3JAKB 5IJ0B 5MN6A 3CMAF 5EZYA 5IJ9A 3LWRC 3CCMF 3CPQA 3IKEA 3K0TA 4ZI7B 4IIJA 2UYJA 1QVGF 1J7HA 4ZHVA 3ON1A 5LP6B 3CCRF 4B46A 2P6YA 5LXTB 4BT3A 4ZI7A 1RQ7A 3N2GA 2RHHA 2QA4F 3S06A 5LP6A 5LXTA 1VQNF 3T80A 4I50B 3V3TA 1W5FA 3C8LA 3G6EF 1IPAA 1TUBA 4I50A 1IV1A 1Q86H 2Z01A 3QHDA 3L7QA 3GYQA 1X7OA 1FNKA 3ZP7A 3WGKA 3JVHA 1X52A 3DDNA 3WGMA 2F9ZC 3CC7F 3VI6A 4YJ3A 1U43A 1RA4A 2DT4A 2CHTA 5GIPC 3FD6A 1W42A 2OZBA 2R751 3BYQA 1SA0A 1PF5A 3HKEB 2IAFA 1H7MA 4ZOLA 1FSZA 2K1SA 3F6MA 2KTUA 5LA6B 3EORA 4C82A 1XV2A 3HKEA 3MBMA 1IV4A 1GO1A 2UYKA 5LA6A 1FNJA 3WGLA 5HP7A 1NMUB 1S72F 3R0PA 3NMUC 2AIFA 4G4YA 2HQSC 3CCEF 4X20B 2AMTA 3RE3A 5MN4A 1VQ9F 1GX1A 3KJJA 4G4WA 3ESJA 2HX0A 1OFUA 1YGYA 5LYJB 3G71F 1ONIA 5CB4A 4O2AB 3FPIA 1JFFB 1COMA 3WJRA 3RYCA 4O2AA 4G88A 1JFFA 1H47A 4ZK7A 1K8AH 2RB9A 4C8EA 1JJ2F 5KX5B 1VHAA 1DT9A 3S02A 3UT5B 1H48A 2BO1A 5DCVA 2UYNB 4O2BB 5KX5A 3IMPA 4EB6B 3JASB 2VGMA 3LWPC 2UYNA 4O2BA 3FBAA 5HY0A 4EB6A
chains in the Genus database with same CATH topology
3CMAF 3CG6A 3LWRC 3CCMF 3CPQA 1W41A 1RLGA 1YJ9F 5EWRA 2OHWA 1QVGF 1VQ7F 5FJ4C 3AGKA 1GO0A 4BVSA 3CPWF 3ON1A 3J7AR 3CCRF 1W3EX 1YITF 2OTJF 2OTLF 1W40A 3PLAC 2QEXF 3E20B 2QA4F 4X3LA 2WALA 1VQNF 3SIUA 3V3TA 3JAMM 2GLZA 1ZWZA 1VQMF 3G6EF 3RA5A 1VQ8F 1IPAA 1VQOF 5HXZA 1Q86H 1K9MH 1VQKF 3CCQF 3NK6A 1SDSA 5GANK 3GYQA 1X7OA 3IR9A 3CCJF 3N4YA 1W2BF 1X7PA 1X52A 3HJWC 4BVRA 3CD6F 2F9ZC 3CC7F 3VI6A 2KG4A 1VQ5F 4BY9D 2JNBA 1RA4A 2KTVA 5HWEA 3LWOC 2CZWA 5GIPC 1NJIH 1W42A 2OZBA 1XBIA 1N8RH 5GINC 1H7MA 1Q81H 2I6DA 3RA6A 2QI2A 3HAXD 3LFOA 2KTUA 1Q82H 1YHQF 1Q7YH 3OBYA 1YJNF 5HY2A 4NUTA 3WXMB 3CCSF 3J81M 1GO1A 5EO3A 3I56F 5G4UC 3CC2F 5HY0A 3CCLF 2LBWA 1NMUB 1S72F 1KQSF 3NMUC 2AIFA 1YI2F 3SIVA 3CCEF 4X3MA 1VQ4F 3LWVC 3I55F 3J80M 3G4SF 1VQ9F 1VQLF 3OW2F 4EI7A 4NQ3A 3FFMA 1PXWA 5GAPK 4TZZA 3CC4F 3E1YA 3CCUF 3CXCF 3G71F 2ALEA 3JCMM 1VQ6F 3N4ZA 5FLXM 3MCAB 5GIOC 3CMEF 2FC3A 2FGYA 3CCVF 1QVFF 1YIJF 1KD1H 4LCKA 1GZ0A 3V7QA 4C4WC 1E7KA 4XCQA 3D00A 1VQPF 1K8AH 5IT9M 4BVTA 1JJ2F 2VGNA 3VMFB 2HVYD 3NVKE 4EI9A 1DT9A 1KC8H 5HY1A 1T0KB 1CK2A 4BW0B 1K73H 3V7EA 1M1KH 2BO1A 3O85A 3OBWA 5DCVA 5HY4A 3LWQC 5HXUA 5G4VC 3NK7A 5A2QM 3PAFA 4BVQA 1CN7A 2VGMA 3LWPC 3NVIB 4EI8A 1YJWF 1M90H 2LBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA F;  3CG6 A;  3LWR C;  3CCM F;  3CPQ A;  1W41 A;  1RLG A;  1YJ9 F;  5EWR A;  2OHW A;  1QVG F;  1VQ7 F;  5FJ4 C;  3AGK A;  1GO0 A;  3CPW F;  3ON1 A;  3J7A R;  3CCR F;  1W3E X;  1YIT F;  2OTJ F;  2OTL F;  1W40 A;  3PLA C;  2QEX F;  3E20 B;  2QA4 F;  4X3L A;  2WAL A;  1VQN F;  3SIU A;  3JAM M;  1ZWZ A;  1VQM F;  3G6E F;  3RA5 A;  1VQ8 F;  1IPA A;  1VQO F;  1Q86 H;  1K9M H;  1VQK F;  3CCQ F;  3NK6 A;  1SDS A;  5GAN K;  3GYQ A;  1X7O A;  3IR9 A;  3CCJ F;  3N4Y A;  1W2B F;  1X7P A;  1X52 A;  3HJW C;  3CD6 F;  3CC7 F;  3VI6 A;  2KG4 A;  1VQ5 F;  4BY9 D;  2JNB A;  1RA4 A;  2KTV A;  3LWO C;  2CZW A;  5GIP C;  1NJI H;  1W42 A;  2OZB A;  1XBI A;  1N8R H;  5GIN C;  1H7M A;  1Q81 H;  2I6D A;  3RA6 A;  2QI2 A;  3HAX D;  3LFO A;  2KTU A;  1Q82 H;  1YHQ F;  1Q7Y H;  3OBY A;  1YJN F;  4NUT A;  3WXM B;  3CCS F;  3J81 M;  1GO1 A;  5EO3 A;  3I56 F;  5G4U C;  3CC2 F;  3CCL F;  2LBW A;  1NMU B;  1S72 F;  1KQS F;  3NMU C;  2AIF A;  1YI2 F;  3SIV A;  3CCE F;  4X3M A;  1VQ4 F;  3LWV C;  3I55 F;  3J80 M;  3G4S F;  1VQ9 F;  1VQL F;  3OW2 F;  5GAP K;  3FFM A;  1PXW A;  4TZZ A;  3CC4 F;  3E1Y A;  3CCU F;  3CXC F;  3G71 F;  2ALE A;  3JCM M;  1VQ6 F;  3N4Z A;  5FLX M;  3MCA B;  5GIO C;  3CME F;  2FC3 A;  3CCV F;  1QVF F;  1YIJ F;  1KD1 H;  4LCK A;  1GZ0 A;  3V7Q A;  4C4W C;  1E7K A;  1VQP F;  1K8A H;  5IT9 M;  3NVK E;  1JJ2 F;  2VGN A;  3VMF B;  2HVY D;  1DT9 A;  1KC8 H;  1T0K B;  1CK2 A;  4BW0 B;  1K73 H;  3V7E A;  1M1K H;  2BO1 A;  3O85 A;  3OBW A;  5DCV A;  3LWQ C;  5G4V C;  3NK7 A;  5A2Q M;  3PAF A;  1CN7 A;  2VGM A;  3LWP C;  3NVI B;  1YJW F;  1M90 H;  2LBX A; 
#chains in the Genus database with same CATH topology
 3C9R A;  3B6N A;  3CG6 A;  1W41 A;  2Z1F A;  3JAW B;  3P10 A;  2CWJ A;  1RLG A;  2OHW A;  3AGK A;  3ERN A;  3C9S A;  3TD4 A;  1W3E X;  1YIT F;  4HNA B;  1Z5W A;  4TV9 A;  5EAZ A;  4E6E A;  3HKD A;  3KJK A;  3DC2 A;  3ELC A;  2WAL A;  3LYB A;  2ZOV A;  3SIU A;  3QUW A;  3FD5 A;  4HNA A;  3WJP A;  4O4H A;  1UFY A;  1VQO F;  5EZY B;  5HXZ A;  3CCQ F;  5EYP B;  4M8I A;  3NK6 A;  3LME A;  1W5E A;  3I7T A;  4BT4 A;  1W55 A;  1X25 A;  3MDO A;  3N2G B;  3N4Y A;  5EYP A;  1W2B F;  2GVI A;  3TD3 A;  1W58 1;  3GTZ A;  3MQW A;  5FNV B;  4R40 B;  5GON A;  3VCZ A;  3CD6 F;  3VYU C;  1Q8R A;  2CVL A;  2KTV A;  3LWO C;  2CZW A;  5FNV A;  1TUB B;  3S03 A;  4BT7 A;  1N8R H;  5GIN C;  1Q81 H;  2I6D A;  2HS3 A;  1VH8 A;  3LFO A;  2EWC A;  1YHQ F;  1Q7Y H;  1YJN F;  3CB2 A;  5HY2 A;  4O4I B;  4YJ2 B;  2Q1X A;  3I56 F;  5LOV B;  3CC2 F;  4YJ3 B;  4DRX A;  4B62 A;  4O4I A;  1KQS F;  4BT2 A;  3SIV A;  1CLI A;  4YJ2 A;  4X3M A;  5JQG B;  3IKF A;  1VQ4 F;  5LOV A;  1SA0 B;  4C81 A;  2MQE A;  4LNU A;  4B45 A;  4ZOL B;  3F0E A;  1DBF A;  5JQG A;  4TZZ A;  3CC4 F;  2N48 A;  4ZHW A;  2Z1T A;  3E1Y A;  5ITZ B;  2QTP A;  3CXC F;  4I55 B;  3M4S A;  3JCM M;  4O4J B;  1VQ6 F;  4C8G A;  2ZOD A;  1JY8 A;  5FLX M;  3CCV F;  3P0Z A;  5ITZ A;  3M1X A;  1GZ0 A;  4I55 A;  4RQO A;  1E7K A;  5B8F A;  4O4J A;  4XCQ A;  1XRG A;  3C9T A;  5EIB C;  5JVD A;  4G4X A;  1XHO A;  1JN1 A;  1QAH A;  2PMP A;  2VGN A;  2KGW A;  5AVM A;  5CA1 B;  4EI9 A;  4ZHQ A;  1QD9 A;  2HVY D;  1T0K B;  1K73 H;  3VYT C;  3HWU A;  2GZL A;  5HY4 A;  5CA1 A;  2VAM A;  5HXU A;  4NWO B;  5A2Q M;  5CB4 B;  2LCA A;  4RHA A;  3JAL A;  3E22 B;  1CN7 A;  4ERH A;  4X1I B;  1M90 H;  3RYC B;  3KIZ A;  2YXZ A;  3E22 A;  1W57 A;  1W59 A;  2HS4 A;  5KMG B;  5EWR A;  3Q8H A;  4X1I A;  3OON A;  3CPW F;  5CA0 B;  1TVK B;  4DXD A;  3GHZ A;  2OTL F;  1W40 A;  5KMG A;  3PLA C;  3E20 B;  1W5A A;  5CA0 A;  1TVK A;  2UZH A;  3JAM M;  2GLZ A;  1ZWZ A;  1VQM F;  3S0W A;  3RYF A;  3VOA A;  5IT9 M;  3IEQ A;  1W5B A;  4U3J B;  3CYP B;  1SDS A;  2Z1E A;  5GAN K;  2RHL A;  1YQN A;  2HP3 A;  3IR9 A;  1RLU A;  2DYY A;  4U3J A;  1X7P A;  4TV9 B;  3MCQ A;  3HJW C;  3HKD B;  2HRY A;  2KG4 A;  3HKB B;  4I4T B;  1U3P A;  1VQ5 F;  1UI9 A;  4O4H B;  1NJI H;  1XBI A;  3HKB A;  4I4T A;  5J2U B;  3WJQ A;  2ZAU A;  3HAX D;  2G9I A;  5J2T B;  2H6L A;  3ZP4 A;  5BMV B;  1Q82 H;  2YYE A;  3WGJ A;  3JAT A;  3OBY A;  5J2U A;  4NUT A;  3CCS F;  3J81 M;  1R1M A;  5EO3 A;  5J2T A;  5GON B;  5BMV A;  3VYS C;  3K12 A;  3VIU A;  4IHJ B;  4FFB A;  5IYZ B;  3P4E A;  2W8B C;  2IG8 A;  3LWV C;  4IHJ A;  3I55 F;  3ZOP A;  5IYZ A;  3J80 M;  5LP6 C;  3G4S F;  1KNK A;  4EI7 A;  4G4Z A;  3HTN A;  3CCU F;  3F0F A;  2ALE A;  2CHS A;  3C9U A;  3IEW A;  2H8C A;  3RYI B;  1NQ3 A;  3CME F;  4DRX B;  4BT5 A;  4F6R B;  1KD1 H;  3U0O A;  4C4W C;  2HRU A;  3JAK A;  5IJ0 A;  3D00 A;  3JAR B;  3RYI A;  2H8E A;  1FFX B;  4F6R A;  3TD5 A;  2Z1U A;  2HS0 A;  4LNU B;  3VMF B;  4BVT A;  5JH7 B;  3NVK E;  1KC8 H;  1CK2 A;  4TUY B;  1U3L A;  3JAR A;  3V7E A;  4B5C A;  1T0A A;  1RQ2 A;  1FFX A;  5JCO C;  3RYH B;  5JH7 A;  3LWQ C;  3F0D A;  4TUY A;  2ZVY A;  4U39 A;  3RYH A;  3NVI B;  2LBX A;  3QTY A;  3M84 A;  1OAP A;  3CYQ A;  1SZQ A;  5JVD B;  1YJ9 F;  1VQ7 F;  4ZHQ B;  2ZVZ A;  5FJ4 C;  1GO0 A;  4BVS A;  3S0Y A;  3J7A R;  3F0G A;  2OTJ F;  2QEX F;  5JCO A;  4X3L A;  3WPW A;  1QU9 A;  3JAL B;  5EIB D;  2OTM A;  5EB0 A;  2PHN A;  3RA5 A;  3V4D A;  1VQ8 F;  4G4V A;  1K9M H;  1VQK F;  3N2K B;  2VXY A;  3WGN A;  1VK3 A;  3N2K A;  3CCJ F;  4O4L B;  4X1Y B;  2ZF8 A;  5C8Y B;  4BVR A;  3WPX A;  4BY9 D;  4O4L A;  2JNB A;  4X1Y A;  3RYF B;  2AIZ P;  5HWE A;  5C8Y A;  4TV8 B;  3S0H A;  4X20 A;  3VTI C;  2L26 A;  2VAP A;  3RA6 A;  2QI2 A;  2BTO A;  4TV8 A;  4KWE A;  4BT6 A;  2BTU A;  2UYP A;  2I6R A;  5MN5 A;  2VAW A;  5LYJ A;  2IQQ A;  3WXM B;  2BTQ B;  5G4U C;  1IV2 A;  3KHN A;  4X1K B;  3K14 A;  4ZHY B;  3CCL F;  2LBW A;  2CW4 A;  1YI2 F;  2V9Y A;  4X1K A;  3ZO8 A;  3D54 A;  4C8I A;  1VQL F;  3HKC B;  3VO8 A;  3OW2 F;  5GAP K;  4NQ3 A;  3FFM A;  1PXW A;  1IV3 A;  3JAT B;  3UT5 A;  2NMU A;  2Q1Y A;  2HP0 B;  3HKC A;  1ODE A;  3N4Z A;  5HP8 A;  3LDT A;  3JAS A;  3MCA B;  5GIO C;  1QVF F;  2FC3 A;  2CSL A;  2FGY A;  4FFB B;  4PWT A;  1YIJ F;  4LCK A;  2HP0 A;  3V7Q A;  1VQP F;  2B33 A;  3JAW A;  3I3F A;  5EB1 B;  3D01 A;  5HY1 A;  4BW0 B;  2LBT A;  3K2X A;  1M1K H;  3O85 A;  3OBW A;  2RHO A;  1VQV A;  1U40 A;  5G4V C;  4WBN B;  3NK7 A;  1JD1 A;  1Z5V A;  3PAF A;  2R6R 1;  3VOB A;  4BVQ A;  5IJ9 B;  2RHJ A;  4IIJ B;  1KNJ A;  4EI8 A;  1YJW F;  4WBN A;  3KE1 A;  3JAK B;  5IJ0 B;  5MN6 A;  3CMA F;  5EZY A;  5IJ9 A;  3LWR C;  3CCM F;  3CPQ A;  3IKE A;  3K0T A;  4ZI7 B;  4IIJ A;  2UYJ A;  1QVG F;  1J7H A;  4ZHV A;  3ON1 A;  5LP6 B;  3CCR F;  4B46 A;  2P6Y A;  5LXT B;  4BT3 A;  4ZI7 A;  1RQ7 A;  3N2G A;  2RHH A;  2QA4 F;  3S06 A;  5LP6 A;  5LXT A;  1VQN F;  3T80 A;  4I50 B;  3V3T A;  1W5F A;  3C8L A;  3G6E F;  1IPA A;  1TUB A;  4I50 A;  1IV1 A;  1Q86 H;  2Z01 A;  3QHD A;  3L7Q A;  3GYQ A;  1X7O A;  1FNK A;  3ZP7 A;  3WGK A;  3JVH A;  1X52 A;  3DDN A;  3WGM A;  2F9Z C;  3CC7 F;  3VI6 A;  4YJ3 A;  1U43 A;  1RA4 A;  2DT4 A;  2CHT A;  5GIP C;  3FD6 A;  1W42 A;  2OZB A;  2R75 1;  3BYQ A;  1SA0 A;  1PF5 A;  3HKE B;  2IAF A;  1H7M A;  4ZOL A;  1FSZ A;  2K1S A;  3F6M A;  2KTU A;  5LA6 B;  3EOR A;  4C82 A;  1XV2 A;  3HKE A;  3MBM A;  1IV4 A;  1GO1 A;  2UYK A;  5LA6 A;  1FNJ A;  3WGL A;  5HP7 A;  1NMU B;  1S72 F;  3R0P A;  3NMU C;  2AIF A;  4G4Y A;  2HQS C;  3CCE F;  4X20 B;  2AMT A;  3RE3 A;  5MN4 A;  1VQ9 F;  1GX1 A;  3KJJ A;  4G4W A;  3ESJ A;  2HX0 A;  1OFU A;  1YGY A;  5LYJ B;  3G71 F;  1ONI A;  5CB4 A;  4O2A B;  3FPI A;  1JFF B;  1COM A;  3WJR A;  3RYC A;  4O2A A;  4G88 A;  1JFF A;  1H47 A;  4ZK7 A;  1K8A H;  2RB9 A;  4C8E A;  1JJ2 F;  5KX5 B;  1VHA A;  1DT9 A;  3S02 A;  3UT5 B;  1H48 A;  2BO1 A;  5DCV A;  2UYN B;  4O2B B;  5KX5 A;  3IMP A;  4EB6 B;  3JAS B;  2VGM A;  3LWP C;  2UYN A;  4O2B A;  3FBA A;  5HY0 A;  4EB6 A; 
#chains in the Genus database with same CATH homology
 3CMA F;  3CG6 A;  3LWR C;  3CCM F;  3CPQ A;  1W41 A;  1RLG A;  1YJ9 F;  5EWR A;  2OHW A;  1QVG F;  1VQ7 F;  5FJ4 C;  3AGK A;  1GO0 A;  4BVS A;  3CPW F;  3ON1 A;  3J7A R;  3CCR F;  1W3E X;  1YIT F;  2OTJ F;  2OTL F;  1W40 A;  3PLA C;  2QEX F;  3E20 B;  2QA4 F;  4X3L A;  2WAL A;  1VQN F;  3SIU A;  3V3T A;  3JAM M;  2GLZ A;  1ZWZ A;  1VQM F;  3G6E F;  3RA5 A;  1VQ8 F;  1IPA A;  1VQO F;  5HXZ A;  1Q86 H;  1K9M H;  1VQK F;  3CCQ F;  3NK6 A;  1SDS A;  5GAN K;  3GYQ A;  1X7O A;  3IR9 A;  3CCJ F;  3N4Y A;  1W2B F;  1X7P A;  1X52 A;  3HJW C;  4BVR A;  3CD6 F;  2F9Z C;  3CC7 F;  3VI6 A;  2KG4 A;  1VQ5 F;  4BY9 D;  2JNB A;  1RA4 A;  2KTV A;  5HWE A;  3LWO C;  2CZW A;  5GIP C;  1NJI H;  1W42 A;  2OZB A;  1XBI A;  1N8R H;  5GIN C;  1H7M A;  1Q81 H;  2I6D A;  3RA6 A;  2QI2 A;  3HAX D;  3LFO A;  2KTU A;  1Q82 H;  1YHQ F;  1Q7Y H;  3OBY A;  1YJN F;  5HY2 A;  4NUT A;  3WXM B;  3CCS F;  3J81 M;  1GO1 A;  5EO3 A;  3I56 F;  5G4U C;  3CC2 F;  5HY0 A;  3CCL F;  2LBW A;  1NMU B;  1S72 F;  1KQS F;  3NMU C;  2AIF A;  1YI2 F;  3SIV A;  3CCE F;  4X3M A;  1VQ4 F;  3LWV C;  3I55 F;  3J80 M;  3G4S F;  1VQ9 F;  1VQL F;  3OW2 F;  4EI7 A;  4NQ3 A;  3FFM A;  1PXW A;  5GAP K;  4TZZ A;  3CC4 F;  3E1Y A;  3CCU F;  3CXC F;  3G71 F;  2ALE A;  3JCM M;  1VQ6 F;  3N4Z A;  5FLX M;  3MCA B;  5GIO C;  3CME F;  2FC3 A;  2FGY A;  3CCV F;  1QVF F;  1YIJ F;  1KD1 H;  4LCK A;  1GZ0 A;  3V7Q A;  4C4W C;  1E7K A;  4XCQ A;  3D00 A;  1VQP F;  1K8A H;  5IT9 M;  4BVT A;  1JJ2 F;  2VGN A;  3VMF B;  2HVY D;  3NVK E;  4EI9 A;  1DT9 A;  1KC8 H;  5HY1 A;  1T0K B;  1CK2 A;  4BW0 B;  1K73 H;  3V7E A;  1M1K H;  2BO1 A;  3O85 A;  3OBW A;  5DCV A;  5HY4 A;  3LWQ C;  5HXU A;  5G4V C;  3NK7 A;  5A2Q M;  3PAF A;  4BVQ A;  1CN7 A;  2VGM A;  3LWP C;  3NVI B;  4EI8 A;  1YJW F;  1M90 H;  2LBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...