4C1YA

Crystal structure of fucose binding lectin from aspergillus fumigatus (afl) in complex with b-methylfucoside
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
314
structure length
313
Chain Sequence
STPGAQQVLFRTGIAAVNSTNHLRVYFQDVYGSIRESLYEGSWANGTEKNVIGNAKLGSPVAATSKELKHIRVYTLTEGNTLQEFAYDSGTGWYNGGLGGAKFQVAPYSCIAAVFLAGTDALQLRIYAQKPDNTIQEYMWNGDGWKEGTNLGGALPGTGIGATSFRYTDYNGPSIRIWFQTDDLKLVQRAYDPHKGWYPDLVTIFDRAPPRTAIAATSFGAGNSSIYMRIYFVNSDNTIWQVWDHGKGYHDKGTITPVIQGSEVAIISWGSFANNGPDLRLYFQNGTYISAVSEWVWNRAHGSQLGRSALPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Aspergillus Fumigatus Lectin Specificity: Afl Binding Sites are Functionally Non-Equivalent.
pubmed doi rcsb
molecule keywords FUCOSE-SPECIFIC LECTIN FLEA
molecule tags Sugar binding protein
source organism Aspergillus fumigatus
total genus 73
structure length 313
sequence length 314
ec nomenclature
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07938 Fungal_lectin Fungal fucose-specific lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.70 Mainly Beta 6 Propeller Neuraminidase Fucose-specific lectin 4c1yA00
4AGTA 4D52A 4AH4A 1IUBA 1IUCA 4D52C 4CSDA 4D52B 4UOUA 1OFZA 5EO8A 4AHAA 4C1YA 4C1YB 4D4UA 5H47A 5EO7A 4AGIA
chains in the Genus database with same CATH superfamily
1INXA 2FP8A 1W0OA 2HTUA 2AGSA 2DG0A 1W8OA 1INHA 1SLLA 2W20A 2VVZA 4YW1A 1POOA 2QWHA 4UF7A 2AH2A 3CL2A 2AEPA 3AMSA 4FQ4A 2ZW9A 3DR2A 1S0IA 2YDPA 2HT8A 4HZWA 1ZGKA 3PJQA 4WA4A 3K37A 1N6DA 1IJQA 2G8SA 4FOVA 3OPZA 4FZHA 4YZ3A 1MS9A 3VNGA 1S18A 2FPCA 3WWAA 2VW0A 1A4GA 1SLIA 4XHBA 1RWLA 4MWLA 3K38A 3DASA 4M4VA 2VK7A 3NN9A 4GDJA 4D8SA 4B7QA 2C4LA 1NNAA 1A14N 2GVWA 1F8CA 1WP5A 2DSOA 2H2NA 4KS1A 4C1YB 2QWEA 4PWZA 3A9HA 7NN9A 1V3EA 1NCAN 3TI8A 3G4EA 3T1EA 4BBWA 4QN7A 4QN4A 1X2JA 2CMLA 4WA3A 4KS3A 3ZGCA 4CHBA 4M4UA 4H52A 4ASCA 1MZ5A 2ZB5A 2FPBA 4B7NA 4NC5A 1V04A 1F8EA 1USRA 4MC7A 1E8UA 4X4AA 4X47A 2AEQA 3ADEA 2GHSA 3Q6PA 1U6DX 2IVZA 4XJQA 3Q6TA 4MX0A 3P5BL 4XJZA 3D12A 3JU4A 5B2CA 1N1SA 2HTWA 3HLIA 4MWYA 1N1TA 3KGGA 4HZVA 4X49A 4L7BA 3INBA 2IAQA 2B8HA 4QN3A 4GNBA 2XN4A 4FOWA 1V3DA 5H47A 4FPOB 4WA5A 4AGTA 4AHAA 5GX2A 4MWQA 3KYAA 3H6JA 1N7DA 2F27A 4IMBA 2V91A 4Q1UA 5CGJA 3ALWA 1IVCA 5FNQA 5GX3A 1EUUA 3SANA 1MWEA 4CPNA 1Z4WA 1NMCA 2VK6A 4MZAA 4K3YA 4CPOA 3E5ZA 4K1KA 2QWFA 5B2DA 4ZY3A 1C5KA 1N6FA 4HIZA 4MWRA 4YZ5A 1W20A 2XZIA 2VW1A 4CPMA 5GX4A 2ISMA 2P4OA 4HW6A 5FNTA 4FPFA 3LI3A 4K1HA 2VWDA 2RKCA 4XOGA 2QWJA 1IUCA 1NCDN 2F11A 4JF7A 1W21A 3ZGDA 1Z50A 1Z4ZA 1L7GA 2IATA 5FZJA 2YA6A 2QE8A 5D9CA 2IARA 3NO0A 4FPYA 4GZQA 1NSDA 5EO8A 1MS3A 4HZXA 4MWXA 4IYGA 4WEFA 5EX7A 2YA4A 4K1IA 3SOBB 4FPEA 1IUBA 4FP2A 2IAPA 4YY8A 3SRGA 4HZZA 4XMAA 2DG1A 4FP3A 3SLIA 3TI6A 1K32A 4MWJA 3S94A 4XJ8A 5HUNA 2IAWA 2YA5A 4KS2A 2W5OA 1IVFA 3CYEA 2FLUX 4N1BA 3O9KA 1V3BA 4MWVA 1QBIA 2F10A 4AGIA 1V0EA 2F12A 4FOQA 3FVZA 3SALA 2SILA 4QN5A 2ZZKA 1S0JA 4GJTA 4XMIA 2IAVA 5FWWA 4YW5A 4YZ4A 3A72A 4GNCA 3SILA 3B7EA 3LI4A 4YW4A 3U0SA 5FNRA 3H71A 2Z32A 1F8BA 4IFJA 2FHRA 3SOVA 1X2RA 4XJAA 2HQSA 4XJWA 4G3NA 5HUKA 4XE9A 3H73A 1QLGA 1XOEA 2GVVA 4XJUA 2H2UA 4NN9A 4XJRA 3K36A 1DILA 4B7JA 1MS0A 1CRZA 1NMBN 4QNPA 3TI5A 4XJ9A 4GN7A 4YZ2A 5GX1A 1MS4A 5F9TA 3TIAA 4GZPA 2QWDA 4XIKA 2X9MA 5FNUA 4GZWA 2GVUA 4HHQA 3WDZA 2SIMA 4GZSA 4D52B 4GNAA 4FPGA 1NN2A 1NSCA 4FOYA 2HTRA 2W8BA 1CVMA 1Z4VA 2VK5A 1Z4XA 1V0ZA 4DGRA 5HX0A 2HU4A 4CSDA 4C1YA 3TI3A 1E1AA 1N6EA 4H53A 1OFZA 4XYXA 4XILA 6NN9A 1C9UA 2F0ZA 3BYCA 1EUTA 5D9BA 3TC9A 1NSBA 2BF6A 3CKZA 3W09A 1PJXA 1V3CA 1EUSA 1INVA 2HTQA 3H72A 4A0PA 2ZB6A 1E8VA 5HUMA 2YA7A 3O4PA 1NCBN 5JYYA 2A75A 1NMAN 1USXA 2HTVA 4ZLRA 3L6VA 1A4QA 4CH9A 1NPEA 1NNCA 4IN4A 4GDIA 4J9TA 4MJVA 1V2IA 1MR5A 1IVDA 3TI4A 1MS8A 1W0PA 2FP9A 1CQ1A 5FZNA 4FPKA 1VCJA 4FJ6A 5F72C 3K3AA 2W38A 2QWAA 4GN8A 4YZ1A 1S1DA 1L7HA 4XIOA 1INWA 1RWIA 2VSMA 4WEGA 1IVBA 3WW9A 1WCQA 2QWKA 4GZTA 4B7RA 1VCUA 4CPZA 3GVJA 1WCSA 2YA8A 4Q6KA 5D9DA 4D52C 2ZWAA 3WN7A 2BZDA 4FPHA 1INFA 3O9JA 4KS4A 3NSSA 4NCSA 1BJIA 3A9GA 3VNHA 4JMLA 2QWIA 1IVGA 3LI5A 2F29A 1ZI0A 4SLIA 2IAUA 3UC1A 1IVEA 3HRPA 2C4AA 4GZOA 2HTYA 3S8ZA 2F13A 5M1ZA 2BATA 2VPJA 1N1VA 1Q7FA 4KS5A 4YW3A 2VW2A 2GVXA 4I00A 2XCYA 5FNSA 3S2KA 1KITA 1MS1A 2BERA 4MJUA 1MS5A 4FPJA 4MWUA 4FPCA 2W8BB 4D4UA 3AMRA 4L7DA 4IFLX 2HT5A 2F24A 4UOUA 1W8NA 4IFNX 3V1SA 3GVLA 2OJHA 3V65B 1N1YA 1H6LA 4FPLA 4HZYA 4R40A 4M3MA 3G4HA 2HT7A 3V64C 1SUUA 4GZXA 4B7MA 1XOGA 4M4NA 5NN9A 2VAQA 3CL0A 1MZ6A 1E8TA 3Q6KA 1NCCN 2SLIA 3ALXA 5HUGA 4ZGCA 4GB1A 4CPLA 1DIMA 4HHOA 4CPYA 1B9SA 2WOZA 2YDTA 4GEZA 3D11A 2IAXA 4GN9A 4MZEA 1B9TA 3HLHA 3BEQA 4IQKA 1INYA 2QWBA 1EURA 3TICA 2XZJA 4QN6A 3SOQA 3GVKA 1L7FA 4XMBA 4L7CA 2F26A 1Z4YA 2IASA 4K1JA 2F28A 4O5TA 3B69A 1B9VA 1W1XA 2IAOA 4XHXA 3IAXA 2HU0A 3II7A 3A71A 2W5NA 1V0FA 2F25A 2QWGA 3S8VA 1NNBA 2POOA 1SNTA 2VSKA 4MWWA 1CRUA 4AH4A 5GTQA 2DYHA 5EO7A 3I1CA 1INGA 4D52A 3K39A 1F8DA 2XZKA 3FW0A 1SO7A 2QWCA 3SREA 4FVKA 3TIBA 4X6KA 4DG6A 4YW2A 5GX5A 4O5SA 2JKBA
chains in the Genus database with same CATH topology
4AGTA 4D52A 4AH4A 1IUBA 1IUCA 4D52C 4CSDA 4D52B 4UOUA 1OFZA 5EO8A 4AHAA 4C1YA 4C1YB 4D4UA 5H47A 5EO7A 4AGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AGT A;  4D52 A;  4AH4 A;  1IUB A;  1IUC A;  4D52 C;  4CSD A;  4D52 B;  4UOU A;  1OFZ A;  5EO8 A;  4AHA A;  4C1Y A;  4C1Y B;  4D4U A;  5H47 A;  5EO7 A;  4AGI A; 
#chains in the Genus database with same CATH topology
 1INX A;  2FP8 A;  1W0O A;  2HTU A;  2AGS A;  2DG0 A;  1W8O A;  1INH A;  1SLL A;  2W20 A;  2VVZ A;  4YW1 A;  1POO A;  2QWH A;  4UF7 A;  2AH2 A;  3CL2 A;  2AEP A;  3AMS A;  4FQ4 A;  2ZW9 A;  3DR2 A;  1S0I A;  2YDP A;  2HT8 A;  4HZW A;  1ZGK A;  3PJQ A;  4WA4 A;  3K37 A;  1N6D A;  1IJQ A;  2G8S A;  4FOV A;  3OPZ A;  4FZH A;  4YZ3 A;  1MS9 A;  3VNG A;  1S18 A;  2FPC A;  3WWA A;  2VW0 A;  1A4G A;  1SLI A;  4XHB A;  1RWL A;  4MWL A;  3K38 A;  3DAS A;  4M4V A;  2VK7 A;  3NN9 A;  4GDJ A;  4D8S A;  4B7Q A;  2C4L A;  1NNA A;  1A14 N;  2GVW A;  1F8C A;  1WP5 A;  2DSO A;  2H2N A;  4KS1 A;  4C1Y B;  2QWE A;  4PWZ A;  3A9H A;  7NN9 A;  1V3E A;  1NCA N;  3TI8 A;  3G4E A;  3T1E A;  4BBW A;  4QN7 A;  4QN4 A;  1X2J A;  2CML A;  4WA3 A;  4KS3 A;  3ZGC A;  4CHB A;  4M4U A;  4H52 A;  4ASC A;  1MZ5 A;  2ZB5 A;  2FPB A;  4B7N A;  4NC5 A;  1V04 A;  1F8E A;  1USR A;  4MC7 A;  1E8U A;  4X4A A;  4X47 A;  2AEQ A;  3ADE A;  2GHS A;  3Q6P A;  1U6D X;  2IVZ A;  4XJQ A;  3Q6T A;  4MX0 A;  3P5B L;  4XJZ A;  3D12 A;  3JU4 A;  5B2C A;  1N1S A;  2HTW A;  3HLI A;  4MWY A;  1N1T A;  3KGG A;  4HZV A;  4X49 A;  4L7B A;  3INB A;  2IAQ A;  2B8H A;  4QN3 A;  4GNB A;  2XN4 A;  4FOW A;  1V3D A;  5H47 A;  4FPO B;  4WA5 A;  4AGT A;  4AHA A;  5GX2 A;  4MWQ A;  3KYA A;  3H6J A;  1N7D A;  2F27 A;  4IMB A;  2V91 A;  4Q1U A;  5CGJ A;  3ALW A;  1IVC A;  5FNQ A;  5GX3 A;  1EUU A;  3SAN A;  1MWE A;  4CPN A;  1Z4W A;  1NMC A;  2VK6 A;  4MZA A;  4K3Y A;  4CPO A;  3E5Z A;  4K1K A;  2QWF A;  5B2D A;  4ZY3 A;  1C5K A;  1N6F A;  4HIZ A;  4MWR A;  4YZ5 A;  1W20 A;  2XZI A;  2VW1 A;  4CPM A;  5GX4 A;  2ISM A;  2P4O A;  4HW6 A;  5FNT A;  4FPF A;  3LI3 A;  4K1H A;  2VWD A;  2RKC A;  4XOG A;  2QWJ A;  1IUC A;  1NCD N;  2F11 A;  4JF7 A;  1W21 A;  3ZGD A;  1Z50 A;  1Z4Z A;  1L7G A;  2IAT A;  5FZJ A;  2YA6 A;  2QE8 A;  5D9C A;  2IAR A;  3NO0 A;  4FPY A;  4GZQ A;  1NSD A;  5EO8 A;  1MS3 A;  4HZX A;  4MWX A;  4IYG A;  4WEF A;  5EX7 A;  2YA4 A;  4K1I A;  3SOB B;  4FPE A;  1IUB A;  4FP2 A;  2IAP A;  4YY8 A;  3SRG A;  4HZZ A;  4XMA A;  2DG1 A;  4FP3 A;  3SLI A;  3TI6 A;  1K32 A;  4MWJ A;  3S94 A;  4XJ8 A;  5HUN A;  2IAW A;  2YA5 A;  4KS2 A;  2W5O A;  1IVF A;  3CYE A;  2FLU X;  4N1B A;  3O9K A;  1V3B A;  4MWV A;  1QBI A;  2F10 A;  4AGI A;  1V0E A;  2F12 A;  4FOQ A;  3FVZ A;  3SAL A;  2SIL A;  4QN5 A;  2ZZK A;  1S0J A;  4GJT A;  4XMI A;  2IAV A;  5FWW A;  4YW5 A;  4YZ4 A;  3A72 A;  4GNC A;  3SIL A;  3B7E A;  3LI4 A;  4YW4 A;  3U0S A;  5FNR A;  3H71 A;  2Z32 A;  1F8B A;  4IFJ A;  2FHR A;  3SOV A;  1X2R A;  4XJA A;  2HQS A;  4XJW A;  4G3N A;  5HUK A;  4XE9 A;  3H73 A;  1QLG A;  1XOE A;  2GVV A;  4XJU A;  2H2U A;  4NN9 A;  4XJR A;  3K36 A;  1DIL A;  4B7J A;  1MS0 A;  1CRZ A;  1NMB N;  4QNP A;  3TI5 A;  4XJ9 A;  4GN7 A;  4YZ2 A;  5GX1 A;  1MS4 A;  5F9T A;  3TIA A;  4GZP A;  2QWD A;  4XIK A;  2X9M A;  5FNU A;  4GZW A;  2GVU A;  4HHQ A;  3WDZ A;  2SIM A;  4GZS A;  4D52 B;  4GNA A;  4FPG A;  1NN2 A;  1NSC A;  4FOY A;  2HTR A;  2W8B A;  1CVM A;  1Z4V A;  2VK5 A;  1Z4X A;  1V0Z A;  4DGR A;  5HX0 A;  2HU4 A;  4CSD A;  4C1Y A;  3TI3 A;  1E1A A;  1N6E A;  4H53 A;  1OFZ A;  4XYX A;  4XIL A;  6NN9 A;  1C9U A;  2F0Z A;  3BYC A;  1EUT A;  5D9B A;  3TC9 A;  1NSB A;  2BF6 A;  3CKZ A;  3W09 A;  1PJX A;  1V3C A;  1EUS A;  1INV A;  2HTQ A;  3H72 A;  4A0P A;  2ZB6 A;  1E8V A;  5HUM A;  2YA7 A;  3O4P A;  1NCB N;  5JYY A;  2A75 A;  1NMA N;  1USX A;  2HTV A;  4ZLR A;  3L6V A;  1A4Q A;  4CH9 A;  1NPE A;  1NNC A;  4IN4 A;  4GDI A;  4J9T A;  4MJV A;  1V2I A;  1MR5 A;  1IVD A;  3TI4 A;  1MS8 A;  1W0P A;  2FP9 A;  1CQ1 A;  5FZN A;  4FPK A;  1VCJ A;  4FJ6 A;  5F72 C;  3K3A A;  2W38 A;  2QWA A;  4GN8 A;  4YZ1 A;  1S1D A;  1L7H A;  4XIO A;  1INW A;  1RWI A;  2VSM A;  4WEG A;  1IVB A;  3WW9 A;  1WCQ A;  2QWK A;  4GZT A;  4B7R A;  1VCU A;  4CPZ A;  3GVJ A;  1WCS A;  2YA8 A;  4Q6K A;  5D9D A;  4D52 C;  2ZWA A;  3WN7 A;  2BZD A;  4FPH A;  1INF A;  3O9J A;  4KS4 A;  3NSS A;  4NCS A;  1BJI A;  3A9G A;  3VNH A;  4JML A;  2QWI A;  1IVG A;  3LI5 A;  2F29 A;  1ZI0 A;  4SLI A;  2IAU A;  3UC1 A;  1IVE A;  3HRP A;  2C4A A;  4GZO A;  2HTY A;  3S8Z A;  2F13 A;  5M1Z A;  2BAT A;  2VPJ A;  1N1V A;  1Q7F A;  4KS5 A;  4YW3 A;  2VW2 A;  2GVX A;  4I00 A;  2XCY A;  5FNS A;  3S2K A;  1KIT A;  1MS1 A;  2BER A;  4MJU A;  1MS5 A;  4FPJ A;  4MWU A;  4FPC A;  2W8B B;  4D4U A;  3AMR A;  4L7D A;  4IFL X;  2HT5 A;  2F24 A;  4UOU A;  1W8N A;  4IFN X;  3V1S A;  3GVL A;  2OJH A;  3V65 B;  1N1Y A;  1H6L A;  4FPL A;  4HZY A;  4R40 A;  4M3M A;  3G4H A;  2HT7 A;  3V64 C;  1SUU A;  4GZX A;  4B7M A;  1XOG A;  4M4N A;  5NN9 A;  2VAQ A;  3CL0 A;  1MZ6 A;  1E8T A;  3Q6K A;  1NCC N;  2SLI A;  3ALX A;  5HUG A;  4ZGC A;  4GB1 A;  4CPL A;  1DIM A;  4HHO A;  4CPY A;  1B9S A;  2WOZ A;  2YDT A;  4GEZ A;  3D11 A;  2IAX A;  4GN9 A;  4MZE A;  1B9T A;  3HLH A;  3BEQ A;  4IQK A;  1INY A;  2QWB A;  1EUR A;  3TIC A;  2XZJ A;  4QN6 A;  3SOQ A;  3GVK A;  1L7F A;  4XMB A;  4L7C A;  2F26 A;  1Z4Y A;  2IAS A;  4K1J A;  2F28 A;  4O5T A;  3B69 A;  1B9V A;  1W1X A;  2IAO A;  4XHX A;  3IAX A;  2HU0 A;  3II7 A;  3A71 A;  2W5N A;  1V0F A;  2F25 A;  2QWG A;  3S8V A;  1NNB A;  2POO A;  1SNT A;  2VSK A;  4MWW A;  1CRU A;  4AH4 A;  5GTQ A;  2DYH A;  5EO7 A;  3I1C A;  1ING A;  4D52 A;  3K39 A;  1F8D A;  2XZK A;  3FW0 A;  1SO7 A;  2QWC A;  3SRE A;  4FVK A;  3TIB A;  4X6K A;  4DG6 A;  4YW2 A;  5GX5 A;  4O5S A;  2JKB A; 
#chains in the Genus database with same CATH homology
 4AGT A;  4D52 A;  4AH4 A;  1IUB A;  1IUC A;  4D52 C;  4CSD A;  4D52 B;  4UOU A;  1OFZ A;  5EO8 A;  4AHA A;  4C1Y A;  4C1Y B;  4D4U A;  5H47 A;  5EO7 A;  4AGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...