4C1YB

Crystal structure of fucose binding lectin from aspergillus fumigatus (afl) in complex with b-methylfucoside
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
314
structure length
314
Chain Sequence
STPGAQQVLFRTGIAAVNSTNHLRVYFQDVYGSIRESLYEGSWANGTEKNVIGNAKLGSPVAATSKELKHIRVYTLTEGNTLQEFAYDSGTGWYNGGLGGAKFQVAPYSCIAAVFLAGTDALQLRIYAQKPDNTIQEYMWNGDGWKEGTNLGGALPGTGIGATSFRYTDYNGPSIRIWFQTDDLKLVQRAYDPHKGWYPDLVTIFDRAPPRTAIAATSFGAGNSSIYMRIYFVNSDNTIWQVCWDHGKGYHDKGTITPVIQGSEVAIISWGSFANNGPDLRLYFQNGTYISAVSEWVWNRAHGSQLGRSALPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Aspergillus Fumigatus Lectin Specificity: Afl Binding Sites are Functionally Non-Equivalent.
pubmed doi rcsb
molecule keywords FUCOSE-SPECIFIC LECTIN FLEA
molecule tags Sugar binding protein
source organism Aspergillus fumigatus
total genus 72
structure length 314
sequence length 314
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07938 Fungal_lectin Fungal fucose-specific lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.70 Mainly Beta 6 Propeller Neuraminidase Fucose-specific lectin 4c1yB00
5H47A 4D52A 5EO8A 5EO7A 4C1YA 4UOUA 4AGTA 4D52C 4D52B 4C1YB 4CSDA 4AH4A 1OFZA 1IUCA 4AGIA 1IUBA 4D4UA 4AHAA
chains in the Genus database with same CATH superfamily
4MJUA 4WA3A 3V65B 4J9TA 4Q1UA 4FOQA 4XHXA 1MS4A 2ZW9A 1Z50A 3GVLA 4FPJA 4X6KA 3BEQA 7NN9A 2IASA 1N1VA 1NNAA 1K32A 1VCUA 2W5OA 1W0OA 2W8BB 4MWWA 3E5ZA 1SO7A 4Q6KA 4HZXA 4QN6A 1S0JA 3INBA 4D52B 1VCJA 2F25A 4MWUA 2HT5A 2FP9A 4N1BA 3S8VA 3SANA 1MS0A 2IAQA 2F29A 1MS1A 4FP2A 4B7JA 4WEFA 2IATA 4FPCA 4UOUA 4FPEA 4YZ5A 2B8HA 4M4UA 3ALXA 4B7MA 5FNRA 3PJQA 5HUNA 1WP5A 4GDIA 4MWRA 4C1YA 1V3EA 4MWQA 3U0SA 2F11A 3A9GA 3DR2A 2SLIA 1MS5A 5HUMA 4X47A 3WWAA 4XJUA 1W8NA 3ZGDA 4IFLX 4XMIA 1OFZA 2VW1A 1F8BA 5EX7A 3T1EA 1A14N 4WA5A 3II7A 1E8UA 4CH9A 1W0PA 2XCYA 4FPLA 2ISMA 4MX0A 1S0IA 3S8ZA 2RKCA 2QWFA 1IVDA 1ZGKA 2IAOA 2VSKA 4ZLRA 1NMAN 3FW0A 2ZWAA 4YW1A 1B9TA 3ALWA 5D9DA 2XZJA 1IVBA 2F28A 4FOYA 5M1ZA 5FNSA 2SILA 1MZ6A 2XN4A 1INWA 3IAXA 4XOGA 2YA8A 2FPCA 4HHQA 3SRGA 3TIAA 1X2JA 4GZSA 1S18A 3TI6A 5F72C 5FWWA 4GJTA 3VNGA 1NNBA 3JU4A 4YZ4A 4IFNX 4GEZA 2A75A 5FZNA 1MS9A 3HRPA 4L7BA 4IMBA 2F12A 3TI3A 2HTUA 1N1TA 1V0FA 1C5KA 4K1JA 4M4VA 3A71A 1L7HA 4AHAA 4FOWA 4HW6A 4XYXA 3O4PA 4NC5A 1EURA 3KGGA 3SREA 4SLIA 4XJ8A 2POOA 4GB1A 2QWIA 4B7QA 1IUCA 3K36A 4XIOA 1L7FA 2G8SA 3P5BL 2QE8A 1Z4VA 4C1YB 3UC1A 1NSBA 1NN2A 2IAPA 1SLLA 2FP8A 5EO7A 4KS1A 4HZYA 4GNCA 2QWAA 2QWJA 2VK5A 1INGA 4YZ1A 5HX0A 4H53A 1DIMA 3W09A 4FPFA 1N1SA 4QN7A 4ASCA 4L7CA 1Z4YA 2IARA 3VNHA 4D8SA 1INXA 2GHSA 1SUUA 2ZB5A 4M4NA 4YW2A 1EUSA 1S1DA 3V1SA 1WCSA 3O9JA 3O9KA 2BZDA 3S94A 5GX1A 4XJRA 2F0ZA 3B69A 5FZJA 4K1KA 4O5SA 2DG1A 4XIKA 1V3CA 3KYAA 1NCDN 1V3DA 2F27A 4GZXA 1N1YA 1W8OA 3K38A 5F9TA 4MWJA 4ZGCA 1SNTA 2HTWA 2Z32A 1H6LA 4MWVA 4AGIA 5GTQA 4GDJA 4FOVA 2QWDA 4FPYA 3A9HA 4IFJA 2ZZKA 4ZY3A 4GZQA 4JF7A 3ZGCA 2FLUX 2WOZA 2SIMA 2W38A 3FVZA 5CGJA 1INHA 1NCCN 4H52A 4R40A 3AMSA 1EUUA 1USRA 4CPOA 4B7RA 4YZ2A 1USXA 1F8EA 4JMLA 1RWIA 2FHRA 1V0EA 2IVZA 3TI8A 4GZPA 1W20A 2HTRA 3OPZA 4I00A 2QWCA 3SOQA 3TI4A 4YW3A 4X4AA 3WN7A 4GNAA 3TIBA 4GZWA 2VK7A 5D9BA 2FPBA 4WEGA 4YY8A 5EO8A 3GVJA 3SALA 4AGTA 5GX2A 4HIZA 2QWKA 4CHBA 1B9SA 2QWEA 5NN9A 4MWYA 2VK6A 4FPOB 2H2NA 4XJWA 2HTYA 4A0PA 1MR5A 5GX4A 1DILA 2AGSA 1IVCA 4IYGA 3HLIA 2VW2A 3V64C 1NPEA 1V3BA 3H73A 4FJ6A 4FPHA 4CPZA 4XMBA 1CRZA 2F26A 1EUTA 1WCQA 3SILA 3TI5A 3Q6TA 2YA4A 1N6DA 1IVFA 4MZEA 4QNPA 1SLIA 4FZHA 2HTVA 3K3AA 2AEPA 4DGRA 2C4AA 2W5NA 2CMLA 3SLIA 2VW0A 4IN4A 4GZTA 3L6VA 2HU4A 4QN3A 4XMAA 4O5TA 4MC7A 3LI5A 1ZI0A 5GX5A 3B7EA 1Z4ZA 3S2KA 1NMCA 4CPMA 4NN9A 1KITA 4MWXA 2YA6A 4WA4A 1PJXA 1QBIA 2BF6A 3TICA 4CPLA 4UF7A 1QLGA 2ZB6A 4K1HA 4XJAA 4FPKA 2HU0A 4CPNA 4KS4A 4HHOA 1E8TA 5JYYA 1NNCA 2H2UA 2VAQA 1Z4XA 4YZ3A 3SOVA 1INYA 1V2IA 2QWHA 2W20A 1N7DA 4YW5A 1CVMA 4FQ4A 3WW9A 1IUBA 4D4UA 4XJ9A 3WDZA 2P4OA 1MZ5A 1MS3A 2QWGA 4IQKA 1E8VA 2X9MA 3BYCA 1X2RA 3Q6KA 1C9UA 1F8CA 4FVKA 1Z4WA 3AMRA 1NMBN 1NSCA 3H6JA 1W21A 2BATA 3H71A 5HUKA 3K39A 2YA7A 4XJZA 5FNUA 2F24A 1XOEA 2GVWA 4QN5A 2YDTA 6NN9A 2IAVA 2V91A 1U6DX 2IAWA 4GN8A 4HZVA 3LI3A 1IJQA 3D12A 1NCBN 1B9VA 2IAXA 3I1CA 3H72A 2JKBA 4X49A 1POOA 2HTQA 2W8BA 4QN4A 3CL0A 4HZZA 3Q6PA 1A4QA 1Q7FA 2GVXA 2QWBA 4G3NA 4MWLA 4MZAA 3ADEA 1CQ1A 5GX3A 3TC9A 3SOBB 4D52A 5D9CA 3DASA 4L7DA 4GN9A 1F8DA 1MWEA 4KS5A 4GZOA 1A4GA 2VWDA 4BBWA 3HLHA 3G4EA 1INVA 2C4LA 5FNTA 5H47A 4MJVA 5B2DA 5B2CA 3NO0A 2HT8A 2DSOA 4CPYA 2YDPA 2IAUA 3LI4A 2F13A 1NSDA 4XILA 4XHBA 1N6EA 4M3MA 3CKZA 3NSSA 2HT7A 1RWLA 3K37A 1INFA 4DG6A 3NN9A 4FP3A 3A72A 4YW4A 2XZIA 1W1XA 5HUGA 3CL2A 4KS3A 1IVGA 2DYHA 1MS8A 4K1IA 3D11A 1CRUA 3G4HA 4NCSA 2GVUA 2OJHA 1BJIA 2HQSA 4CSDA 4AH4A 4GNBA 3GVKA 4GN7A 4XE9A 2GVVA 5FNQA 4D52C 4K3YA 4KS2A 2VVZA 1N6FA 2YA5A 4B7NA 4PWZA 4HZWA 1XOGA 2VPJA 4FPGA 4XJQA 2DG0A 1NCAN 2XZKA 1E1AA 2AEQA 3CYEA 2VSMA 2BERA 1IVEA 1V04A 2F10A 1L7GA 2AH2A 1V0ZA
chains in the Genus database with same CATH topology
5H47A 4D52A 5EO8A 5EO7A 4C1YA 4UOUA 4AGTA 4D52C 4D52B 4C1YB 4CSDA 4AH4A 1OFZA 1IUCA 4AGIA 1IUBA 4D4UA 4AHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H47 A;  4D52 A;  5EO8 A;  5EO7 A;  4C1Y A;  4UOU A;  4AGT A;  4D52 C;  4D52 B;  4C1Y B;  4CSD A;  4AH4 A;  1OFZ A;  1IUC A;  4AGI A;  1IUB A;  4D4U A;  4AHA A; 
#chains in the Genus database with same CATH topology
 4MJU A;  4WA3 A;  3V65 B;  4J9T A;  4Q1U A;  4FOQ A;  4XHX A;  1MS4 A;  2ZW9 A;  1Z50 A;  3GVL A;  4FPJ A;  4X6K A;  3BEQ A;  7NN9 A;  2IAS A;  1N1V A;  1NNA A;  1K32 A;  1VCU A;  2W5O A;  1W0O A;  2W8B B;  4MWW A;  3E5Z A;  1SO7 A;  4Q6K A;  4HZX A;  4QN6 A;  1S0J A;  3INB A;  4D52 B;  1VCJ A;  2F25 A;  4MWU A;  2HT5 A;  2FP9 A;  4N1B A;  3S8V A;  3SAN A;  1MS0 A;  2IAQ A;  2F29 A;  1MS1 A;  4FP2 A;  4B7J A;  4WEF A;  2IAT A;  4FPC A;  4UOU A;  4FPE A;  4YZ5 A;  2B8H A;  4M4U A;  3ALX A;  4B7M A;  5FNR A;  3PJQ A;  5HUN A;  1WP5 A;  4GDI A;  4MWR A;  4C1Y A;  1V3E A;  4MWQ A;  3U0S A;  2F11 A;  3A9G A;  3DR2 A;  2SLI A;  1MS5 A;  5HUM A;  4X47 A;  3WWA A;  4XJU A;  1W8N A;  3ZGD A;  4IFL X;  4XMI A;  1OFZ A;  2VW1 A;  1F8B A;  5EX7 A;  3T1E A;  1A14 N;  4WA5 A;  3II7 A;  1E8U A;  4CH9 A;  1W0P A;  2XCY A;  4FPL A;  2ISM A;  4MX0 A;  1S0I A;  3S8Z A;  2RKC A;  2QWF A;  1IVD A;  1ZGK A;  2IAO A;  2VSK A;  4ZLR A;  1NMA N;  3FW0 A;  2ZWA A;  4YW1 A;  1B9T A;  3ALW A;  5D9D A;  2XZJ A;  1IVB A;  2F28 A;  4FOY A;  5M1Z A;  5FNS A;  2SIL A;  1MZ6 A;  2XN4 A;  1INW A;  3IAX A;  4XOG A;  2YA8 A;  2FPC A;  4HHQ A;  3SRG A;  3TIA A;  1X2J A;  4GZS A;  1S18 A;  3TI6 A;  5F72 C;  5FWW A;  4GJT A;  3VNG A;  1NNB A;  3JU4 A;  4YZ4 A;  4IFN X;  4GEZ A;  2A75 A;  5FZN A;  1MS9 A;  3HRP A;  4L7B A;  4IMB A;  2F12 A;  3TI3 A;  2HTU A;  1N1T A;  1V0F A;  1C5K A;  4K1J A;  4M4V A;  3A71 A;  1L7H A;  4AHA A;  4FOW A;  4HW6 A;  4XYX A;  3O4P A;  4NC5 A;  1EUR A;  3KGG A;  3SRE A;  4SLI A;  4XJ8 A;  2POO A;  4GB1 A;  2QWI A;  4B7Q A;  1IUC A;  3K36 A;  4XIO A;  1L7F A;  2G8S A;  3P5B L;  2QE8 A;  1Z4V A;  4C1Y B;  3UC1 A;  1NSB A;  1NN2 A;  2IAP A;  1SLL A;  2FP8 A;  5EO7 A;  4KS1 A;  4HZY A;  4GNC A;  2QWA A;  2QWJ A;  2VK5 A;  1ING A;  4YZ1 A;  5HX0 A;  4H53 A;  1DIM A;  3W09 A;  4FPF A;  1N1S A;  4QN7 A;  4ASC A;  4L7C A;  1Z4Y A;  2IAR A;  3VNH A;  4D8S A;  1INX A;  2GHS A;  1SUU A;  2ZB5 A;  4M4N A;  4YW2 A;  1EUS A;  1S1D A;  3V1S A;  1WCS A;  3O9J A;  3O9K A;  2BZD A;  3S94 A;  5GX1 A;  4XJR A;  2F0Z A;  3B69 A;  5FZJ A;  4K1K A;  4O5S A;  2DG1 A;  4XIK A;  1V3C A;  3KYA A;  1NCD N;  1V3D A;  2F27 A;  4GZX A;  1N1Y A;  1W8O A;  3K38 A;  5F9T A;  4MWJ A;  4ZGC A;  1SNT A;  2HTW A;  2Z32 A;  1H6L A;  4MWV A;  4AGI A;  5GTQ A;  4GDJ A;  4FOV A;  2QWD A;  4FPY A;  3A9H A;  4IFJ A;  2ZZK A;  4ZY3 A;  4GZQ A;  4JF7 A;  3ZGC A;  2FLU X;  2WOZ A;  2SIM A;  2W38 A;  3FVZ A;  5CGJ A;  1INH A;  1NCC N;  4H52 A;  4R40 A;  3AMS A;  1EUU A;  1USR A;  4CPO A;  4B7R A;  4YZ2 A;  1USX A;  1F8E A;  4JML A;  1RWI A;  2FHR A;  1V0E A;  2IVZ A;  3TI8 A;  4GZP A;  1W20 A;  2HTR A;  3OPZ A;  4I00 A;  2QWC A;  3SOQ A;  3TI4 A;  4YW3 A;  4X4A A;  3WN7 A;  4GNA A;  3TIB A;  4GZW A;  2VK7 A;  5D9B A;  2FPB A;  4WEG A;  4YY8 A;  5EO8 A;  3GVJ A;  3SAL A;  4AGT A;  5GX2 A;  4HIZ A;  2QWK A;  4CHB A;  1B9S A;  2QWE A;  5NN9 A;  4MWY A;  2VK6 A;  4FPO B;  2H2N A;  4XJW A;  2HTY A;  4A0P A;  1MR5 A;  5GX4 A;  1DIL A;  2AGS A;  1IVC A;  4IYG A;  3HLI A;  2VW2 A;  3V64 C;  1NPE A;  1V3B A;  3H73 A;  4FJ6 A;  4FPH A;  4CPZ A;  4XMB A;  1CRZ A;  2F26 A;  1EUT A;  1WCQ A;  3SIL A;  3TI5 A;  3Q6T A;  2YA4 A;  1N6D A;  1IVF A;  4MZE A;  4QNP A;  1SLI A;  4FZH A;  2HTV A;  3K3A A;  2AEP A;  4DGR A;  2C4A A;  2W5N A;  2CML A;  3SLI A;  2VW0 A;  4IN4 A;  4GZT A;  3L6V A;  2HU4 A;  4QN3 A;  4XMA A;  4O5T A;  4MC7 A;  3LI5 A;  1ZI0 A;  5GX5 A;  3B7E A;  1Z4Z A;  3S2K A;  1NMC A;  4CPM A;  4NN9 A;  1KIT A;  4MWX A;  2YA6 A;  4WA4 A;  1PJX A;  1QBI A;  2BF6 A;  3TIC A;  4CPL A;  4UF7 A;  1QLG A;  2ZB6 A;  4K1H A;  4XJA A;  4FPK A;  2HU0 A;  4CPN A;  4KS4 A;  4HHO A;  1E8T A;  5JYY A;  1NNC A;  2H2U A;  2VAQ A;  1Z4X A;  4YZ3 A;  3SOV A;  1INY A;  1V2I A;  2QWH A;  2W20 A;  1N7D A;  4YW5 A;  1CVM A;  4FQ4 A;  3WW9 A;  1IUB A;  4D4U A;  4XJ9 A;  3WDZ A;  2P4O A;  1MZ5 A;  1MS3 A;  2QWG A;  4IQK A;  1E8V A;  2X9M A;  3BYC A;  1X2R A;  3Q6K A;  1C9U A;  1F8C A;  4FVK A;  1Z4W A;  3AMR A;  1NMB N;  1NSC A;  3H6J A;  1W21 A;  2BAT A;  3H71 A;  5HUK A;  3K39 A;  2YA7 A;  4XJZ A;  5FNU A;  2F24 A;  1XOE A;  2GVW A;  4QN5 A;  2YDT A;  6NN9 A;  2IAV A;  2V91 A;  1U6D X;  2IAW A;  4GN8 A;  4HZV A;  3LI3 A;  1IJQ A;  3D12 A;  1NCB N;  1B9V A;  2IAX A;  3I1C A;  3H72 A;  2JKB A;  4X49 A;  1POO A;  2HTQ A;  2W8B A;  4QN4 A;  3CL0 A;  4HZZ A;  3Q6P A;  1A4Q A;  1Q7F A;  2GVX A;  2QWB A;  4G3N A;  4MWL A;  4MZA A;  3ADE A;  1CQ1 A;  5GX3 A;  3TC9 A;  3SOB B;  4D52 A;  5D9C A;  3DAS A;  4L7D A;  4GN9 A;  1F8D A;  1MWE A;  4KS5 A;  4GZO A;  1A4G A;  2VWD A;  4BBW A;  3HLH A;  3G4E A;  1INV A;  2C4L A;  5FNT A;  5H47 A;  4MJV A;  5B2D A;  5B2C A;  3NO0 A;  2HT8 A;  2DSO A;  4CPY A;  2YDP A;  2IAU A;  3LI4 A;  2F13 A;  1NSD A;  4XIL A;  4XHB A;  1N6E A;  4M3M A;  3CKZ A;  3NSS A;  2HT7 A;  1RWL A;  3K37 A;  1INF A;  4DG6 A;  3NN9 A;  4FP3 A;  3A72 A;  4YW4 A;  2XZI A;  1W1X A;  5HUG A;  3CL2 A;  4KS3 A;  1IVG A;  2DYH A;  1MS8 A;  4K1I A;  3D11 A;  1CRU A;  3G4H A;  4NCS A;  2GVU A;  2OJH A;  1BJI A;  2HQS A;  4CSD A;  4AH4 A;  4GNB A;  3GVK A;  4GN7 A;  4XE9 A;  2GVV A;  5FNQ A;  4D52 C;  4K3Y A;  4KS2 A;  2VVZ A;  1N6F A;  2YA5 A;  4B7N A;  4PWZ A;  4HZW A;  1XOG A;  2VPJ A;  4FPG A;  4XJQ A;  2DG0 A;  1NCA N;  2XZK A;  1E1A A;  2AEQ A;  3CYE A;  2VSM A;  2BER A;  1IVE A;  1V04 A;  2F10 A;  1L7G A;  2AH2 A;  1V0Z A; 
#chains in the Genus database with same CATH homology
 5H47 A;  4D52 A;  5EO8 A;  5EO7 A;  4C1Y A;  4UOU A;  4AGT A;  4D52 C;  4D52 B;  4C1Y B;  4CSD A;  4AH4 A;  1OFZ A;  1IUC A;  4AGI A;  1IUB A;  4D4U A;  4AHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...