4CA1A

Crystal structure of siah1 at 1.58 a resolution.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
192
structure length
189
Chain Sequence
ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two High-Resolution Structures of the Human E3 Ubiquitin Ligase Siah1.
pubmed doi rcsb
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE SIAH1
molecule tags Ligase
source organism Homo sapiens
total genus 42
structure length 189
sequence length 192
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4ca1A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ca1A01
2CSZA 2IDAA 3SOUA 4NN2A 4N3WA 5B75A 2E6RA 5LKTA 2M6MA 2MD7B 4AUQB 2EA6A 1T1HA 4L58A 2F1XA 4WZ2A 1MM3A 3C6WA 2QICA 3LRQA 3KV6A 4A4CA 1LB6A 5AIUA 3HQMA 3HCTA 2HDPA 2KFTA 2LDRA 2YSMA 5AITA 2DX8A 5TABA 4A0CD 1WIMA 3RTRB 4PTBA 2L43A 2YSJA 2FUUA 4LKAA 2YURA 5G0FA 1CA9A 3MQSC 5D1MB 5FEYA 3KNVA 1VFYA 3O34A 2KWKA 3ZTGA 2ZETC 2VPDA 1WEUA 3RPGC 2MNYA 5H1TA 4W4UA 3O36A 4GWNA 1LDKC 4CA1A 2HYED 4BHWA 4O64A 2KWOA 4N4FA 2KR4A 3KV5A 1JM7B 4YATA 2L75A 3MHHA 3L1XA 2H0DA 1WEOA 4BBQA 3O35A 3GV4A 1V87A 2JMJA 2LGKA 3DPLR 3L1ZB 4R8PK 2LXHC 2KREA 1LB4A 4YAXA 2EODA 1LDJB 3HQLA 2EGPA 2XXNA 1RF3A 1WGMA 4LK9A 1LB5A 4O1VA 2MUMA 5D1KB 5TBNA 3VK6A 2ECNA 2RI7A 1JOCA 3HQHA 1VD4A 3LQJA 4P5OB 5C13A 3EB5A 2E6SA 4IC2A 3HU6A 1Z2QA 2KGIA 3ASLA 2PUYA 3SOWA 5D1LB 2G6QA 2PNXA 2ECTA 1U6GB 2YUCA 3M62A 4QF3A 5LKXA 1F62A 3U5NA 1DVPA 4JJQA 5JG6A 5TDRA 2MD8C 2H0DB 1JM7A 3ZPVE 2ECIA 1K2FA 3O33A 1WEQA 2L80A 1L0AA 2F42A 2FOOA 2YW8A 3ZVZB 2JMIA 1FP0A 3N9QA 4TKPB 3O37A 4ZUXU 5LCWB 2OXQC 1YZEA 2Y43A 1WEWA 4PPEA 2KGGA 2L0BA 4ZQLA 4V3KC 2K16A 2F6NA 1D0AA 3HTKC 1WESA 4S3OC 4A49A 1X4UA 5B78A 3SOXA 2VPEA 2F1ZA 5E1TA 4WA6A 2C2VS 1WEVA 4LJNA 3ZJBA 5B76A 1CA4A 2C2LA 2VNFA 4ZDTA 3I2DA 5B77A 3ZNIA 1BORA 3KQIA 1Z6UA 2VPBA 3O7AA 2LGVA 1WEPA 2LRIC 2MNZA 2RSDA 3FL2A 4GNDA 4GHUA 3PUQA 4XI1A 2VPGA 2LQ6A 2F1YA 5KH9A 2Y1NA 5G05B 5FB0A 2F1WA 5G04B 2F6JA 3N9OA 2CR2A 4AYCB 1ZBDB 2YU4A 3M99A 2MA6A 1HYJA 2MT5A 3LQHA 1CHCA 2I50A 5DINA 3IVQA 4WZ3B 4UP0A 5EYAF 4FIPA 3M63A 4FJCA 1WFKA 4YABA 5H9MA 5B8DA 3N9MA 4MSXA 3HCSA 3SHBA 2L5UA 4AVXA 2D8SA 2FSAA 1FBVA 2KWJA 1D00A 1Z60A 3PHDA 1WE9A 4S3OB 5KH3A 4I7BA 2YHNA 1FLLA 4Z8MA 2CSYA 1XWHA 2LGGA 2LV9A 3IVVA 2QIZA 1WEEA 3GL6A 5H1VA 2ECVA 3RPGB 2LXPC 4B86C 2ECJA 1WILA 4C9ZA 5C11A 2LGLA 4AYCA 2YQLA 4LLBA 5DKAA 2KE1A 1FLKA 1CZYA 4GWMA 3T7LA 4GNEA 3N9LA 3NG2A 3C5KA 3U5PA 2LN0A 4FO9A 1RMDA 3DQVR 5LKUA 3MQRA 4YBSA 2YYRA 2YT5A 2K4DA 3HCUA 2AN6A 2VJEA 3LQIA 2XEUA 4I7DA 4X3GA 1G25A 2A25A 5H1UA 4CCGX 1QSCA 4QF2A 2M3HA 2VJFA 4YBMA 5KH7A 4I7CA 3U5OA 3V43A 3IVBA 4Q6FA 3O70A 3PURA 4YADA 4A4BA 4GNGA 1D0JA 4B7YC 4KG9A 2BAYA 2FOJA 2CKLA 4YSIA 4GB0A 1F3VB 3IHPA 2M85A 4WZ0A 3HQIA 4MVTA 2NAAA 1HYIA 4IC3A 1WENA 3T6RA 1IYMA 1YY6A 1KZZA 1CZZA 1ZMSA 3HSVA 3MHSA 4YC9A 4YBTA 4F52B 2UZGA 3U5MA 1D01A 4GJHA 2JRJA 2VJEB 4FK5A 2FUIA 4L7XA 2VP7A 5J3XA 2KU3A 2MA5A 4LADB 2GKWA 3N9PA 5B79A 4K8UA 2ECGA 2K1JA 2Y1MA 4R2YA 1E4UA 1MM2A 2M1RA 5TRBA 2XB1A 2VJFB 3QZVA 3N9NA 4UP5A 5LKZA 1VYXA 2KWNA 1X4IA 2G43A 2ECWA 4R7EA 1WEMA 2YHOA 2QJ0A 2MIQA 4AP4A 5I3LA 2CKLB 5FERA 2YREA 2KYUA 5FB1A 4V3LC 3EB6A 2FOPA 4GNFA 2K17A 4UI9B 2G45A 3ZPV1 3ZVYA 2YQMA 1N87A 2KIZA 3ZYQA 2JMDA 5TDWA 2CT2A 3L11A 1X4JA 4M4EA
chains in the Genus database with same CATH superfamily
2CSZA 2IDAA 3SOUA 4NN2A 4N3WA 2YVRA 5B75A 2E6RA 5LKTA 2M6MA 2MD7B 4AUQB 1MBMA 2EA6A 1T1HA 4L58A 2F1XA 4WZ2A 1MM3A 3C6WA 2QICA 3LRQA 3KV6A 4A4CA 1LB6A 5AIUA 3HQMA 3HCTA 2HDPA 2KFTA 2LDRA 2YSMA 5AITA 2DX8A 5TABA 4A0CD 1WIMA 3RTRB 4PTBA 5SVYA 2L43A 2YSJA 3LVRE 2FUUA 3FEHA 4LKAA 2YURA 4OGEA 5G0FA 1CA9A 3MQSC 5D1MB 5FEYA 3KNVA 1VFYA 3O34A 2KWKA 3ZTGA 2ZETC 2VPDA 1WEUA 3RPGC 2MNYA 5H1TA 4W4UA 2EXUA 3O36A 4GWNA 1DCQA 4F1PA 1LDKC 4CA1A 2FD4A 2HYED 2LAUA 2RR4A 4BHWA 4O64A 2KWOA 4N4FA 2KR4A 3KV5A 1JM7B 4YATA 2L75A 5SVIB 3MHHA 4Z0OA 3L1XA 2H0DA 1WEOA 4BBQA 2KKXA 3O35A 3GV4A 1V87A 2JMJA 2LGKA 3DPLR 3L1ZB 4R8PK 2LXHC 2KREA 1LB4A 4YAXA 2EODA 2E61A 1LDJB 3HQLA 2EGPA 2XXNA 1RF3A 1WGMA 4LK9A 1LB5A 4O1VA 2MUMA 4QQ4A 3Q1DA 5D1KB 3LJUX 3MDBC 5TBNA 3VK6A 2ECNA 2RI7A 2OWAA 1JOCA 3HQHA 1VD4A 3LQJA 4P5OB 5C13A 3EB5A 2E6SA 4IC2A 3HU6A 1Z2QA 2KGIA 3ASLA 3SUBA 2PUYA 3SOWA 5D1LB 2G6QA 2PNXA 2ECTA 1U6GB 2YUCA 3M62A 2MKEA 4QF3A 5LKXA 1F62A 3U5NA 1DVPA 4JJQA 5JG6A 5TDRA 2MD8C 2H0DB 1JM7A 3ZPVE 2CRWA 2ECIA 1K2FA 2DSMA 5SVIA 3O33A 1WEQA 3DDTA 2L80A 1L0AA 2F42A 2EGMA 3M7KA 2FOOA 2YW8A 3ZVZB 2JMIA 3E2DA 1FP0A 3N9QA 4TKPB 3O37A 4ZUXU 5LCWB 4O62A 2OXQC 1YZEA 2Y43A 1WEWA 4PPEA 2KGGA 2L0BA 4ZQLA 4V3KC 2K16A 2F6NA 1D0AA 3HTKC 1WESA 3FAOA 4S3OC 4A49A 3JUEA 1X4UA 5B78A 3SOXA 2VPEA 2F1ZA 5E1TA 4WA6A 2C2VS 1WEVA 2L7PA 2XOCA 4LJNA 3ZJBA 5B76A 2KKYA 1CA4A 2C2LA 2M13A 2VNFA 4ZDTA 2B0OE 3I2DA 5B77A 3ZNIA 1BORA 3KQIA 1Z6UA 2VPBA 2JM3A 3O7AA 2LGVA 1WEPA 2LRIC 2MNZA 2RSDA 3FL2A 4GNDA 4GHUA 3PUQA 4XI1A 3KDEC 2VPGA 2LQ6A 2F1YA 5KH9A 2Y1NA 5G05B 5FB0A 2F1WA 5G04B 2FFWA 2F6JA 3N9OA 2CR2A 4AYCB 1ZBDB 2YU4A 3M99A 2MA6A 1HYJA 2MT5A 3LQHA 2IQJA 2P57A 1CHCA 2I50A 5DINA 3IVQA 4WZ3B 4UP0A 5EYAF 4FIPA 3M63A 4FJCA 1WFKA 3FJUB 3LDYA 4YABA 5H9MA 5B8DA 3N9MA 4MSXA 3HCSA 3SHBA 4OGCA 2L5UA 4AVXA 2D8SA 2D8UA 2FSAA 1FBVA 2KWJA 1D00A 1Z60A 3PHDA 3O47A 1WE9A 4S3OB 5KH3A 4I7BA 2YHNA 1FLLA 4Z8MA 2CSYA 1XWHA 2LGGA 2LV9A 3IVVA 2QIZA 1WEEA 3GL6A 5H1VA 2ECVA 3RPGB 2LXPC 4B86C 2ECJA 1WILA 4C9ZA 5C11A 2LGLA 4AYCA 2YQLA 4LLBA 5DKAA 2KE1A 1FLKA 1CZYA 4GWMA 3T7LA 4GNEA 3N9LA 3NG2A 3C5KA 3FANA 3U5PA 2LN0A 4FO9A 1RMDA 3DQVR 5LKUA 3MQRA 4YBSA 2YYRA 2YT5A 2K4DA 3HCUA 2AN6A 2DJAA 2VJEA 3LQIA 2XEUA 4I7DA 4X3GA 1G25A 2A25A 5H1UA 4CCGX 1QSCA 4QF2A 2M3HA 2VJFA 4YBMA 5KH7A 4I7CA 3U5OA 3V43A 3IVBA 5SVXA 4Q6FA 3O70A 3PURA 4YADA 4A4BA 4GNGA 1D0JA 4B7YC 4KG9A 2BAYA 2FOJA 2CKLA 4YSIA 2XP0A 2CSVA 4GB0A 4H9DA 1F3VB 3IHPA 2M85A 4WZ0A 3LVQE 3HQIA 4MVTA 2NAAA 1HYIA 4IC3A 2CONA 1WENA 3T6RA 1IYMA 1YY6A 1KZZA 1CZZA 1ZMSA 3HSVA 3MHSA 4YC9A 4YBTA 4F52B 2UZGA 3U5MA 1D01A 4GJHA 2JRJA 2CRRA 2VJEB 4FK5A 2FUIA 4L7XA 2VP7A 2XOYA 5J3XA 2KU3A 2MA5A 4LADB 3PLWA 2GKWA 3N9PA 3DWDA 5B79A 4K8UA 4Z0RA 2ECGA 2K1JA 2Y1MA 4R2YA 1E4UA 1MM2A 2M1RA 5TRBA 2XB1A 2XOZA 3H7HA 2JUNA 3T9KA 2VJFB 3QZVA 3N9NA 4UP5A 5LKZA 1VYXA 2KWNA 1X4IA 2G43A 2ECWA 4R7EA 1WEMA 2YHOA 2QJ0A 2MIQA 4AP4A 5I3LA 2CKLB 5FERA 2YREA 2KYUA 3FM8C 5FB1A 4V3LC 3EB6A 2FOPA 4GNFA 2K17A 4UI9B 2G45A 3ZPV1 3ZVYA 2YQMA 1N87A 2KIZA 3ZYQA 2JMDA 5TDWA 2CT2A 3L11A 5K3QA 1X4JA 4M4EA
chains in the Genus database with same CATH topology
2CSZA 2IDAA 3SOUA 4NN2A 4N3WA 5B75A 2E6RA 5LKTA 2M6MA 2MD7B 4AUQB 2EA6A 1T1HA 4L58A 2F1XA 4WZ2A 1MM3A 3C6WA 2QICA 3LRQA 3KV6A 4A4CA 1LB6A 5AIUA 3HQMA 3HCTA 2HDPA 2KFTA 2LDRA 2YSMA 5AITA 2DX8A 5TABA 4A0CD 1WIMA 3RTRB 4PTBA 2L43A 2YSJA 2FUUA 4LKAA 2YURA 5G0FA 1CA9A 3MQSC 5D1MB 5FEYA 3KNVA 1VFYA 3O34A 2KWKA 3ZTGA 2ZETC 2VPDA 1WEUA 3RPGC 2MNYA 5H1TA 4W4UA 3O36A 4GWNA 1LDKC 4CA1A 2HYED 4BHWA 4O64A 2KWOA 4N4FA 2KR4A 3KV5A 1JM7B 4YATA 2L75A 3MHHA 3L1XA 2H0DA 1WEOA 4BBQA 3O35A 3GV4A 1V87A 2JMJA 2LGKA 3DPLR 3L1ZB 4R8PK 2LXHC 2KREA 1LB4A 4YAXA 2EODA 1LDJB 3HQLA 2EGPA 2XXNA 1RF3A 1WGMA 4LK9A 1LB5A 4O1VA 2MUMA 5D1KB 5TBNA 3VK6A 2ECNA 2RI7A 1JOCA 3HQHA 1VD4A 3LQJA 4P5OB 5C13A 3EB5A 2E6SA 4IC2A 3HU6A 1Z2QA 2KGIA 3ASLA 2PUYA 3SOWA 5D1LB 2G6QA 2PNXA 2ECTA 1U6GB 2YUCA 3M62A 4QF3A 5LKXA 1F62A 3U5NA 1DVPA 4JJQA 5JG6A 5TDRA 2MD8C 2H0DB 1JM7A 3ZPVE 2ECIA 1K2FA 3O33A 1WEQA 2L80A 1L0AA 2F42A 2FOOA 2YW8A 3ZVZB 2JMIA 1FP0A 3N9QA 4TKPB 3O37A 4ZUXU 5LCWB 2OXQC 1YZEA 2Y43A 1WEWA 4PPEA 2KGGA 2L0BA 4ZQLA 4V3KC 2K16A 2F6NA 1D0AA 3HTKC 1WESA 4S3OC 4A49A 1X4UA 5B78A 3SOXA 2VPEA 2F1ZA 5E1TA 4WA6A 2C2VS 1WEVA 4LJNA 3ZJBA 5B76A 1CA4A 2C2LA 2VNFA 4ZDTA 3I2DA 5B77A 3ZNIA 1BORA 3KQIA 1Z6UA 2VPBA 3O7AA 2LGVA 1WEPA 2LRIC 2MNZA 2RSDA 3FL2A 4GNDA 4GHUA 3PUQA 4XI1A 2VPGA 2LQ6A 2F1YA 5KH9A 2Y1NA 5G05B 5FB0A 2F1WA 5G04B 2F6JA 3N9OA 2CR2A 4AYCB 1ZBDB 2YU4A 3M99A 2MA6A 1HYJA 2MT5A 3LQHA 1CHCA 2I50A 5DINA 3IVQA 4WZ3B 4UP0A 5EYAF 4FIPA 3M63A 4FJCA 1WFKA 4YABA 5H9MA 5B8DA 3N9MA 4MSXA 3HCSA 3SHBA 2L5UA 4AVXA 2D8SA 2FSAA 1FBVA 2KWJA 1D00A 1Z60A 3PHDA 1WE9A 4S3OB 5KH3A 4I7BA 2YHNA 1FLLA 4Z8MA 2CSYA 1XWHA 2LGGA 2LV9A 3IVVA 2QIZA 1WEEA 3GL6A 5H1VA 2ECVA 3RPGB 2LXPC 4B86C 2ECJA 1WILA 4C9ZA 5C11A 2LGLA 4AYCA 2YQLA 4LLBA 5DKAA 2KE1A 1FLKA 1CZYA 4GWMA 3T7LA 4GNEA 3N9LA 3NG2A 3C5KA 3U5PA 2LN0A 4FO9A 1RMDA 3DQVR 5LKUA 3MQRA 4YBSA 2YYRA 2YT5A 2K4DA 3HCUA 2AN6A 2VJEA 3LQIA 2XEUA 4I7DA 4X3GA 1G25A 2A25A 5H1UA 4CCGX 1QSCA 4QF2A 2M3HA 2VJFA 4YBMA 5KH7A 4I7CA 3U5OA 3V43A 3IVBA 4Q6FA 3O70A 3PURA 4YADA 4A4BA 4GNGA 1D0JA 4B7YC 4KG9A 2BAYA 2FOJA 2CKLA 4YSIA 4GB0A 1F3VB 3IHPA 2M85A 4WZ0A 3HQIA 4MVTA 2NAAA 1HYIA 4IC3A 1WENA 3T6RA 1IYMA 1YY6A 1KZZA 1CZZA 1ZMSA 3HSVA 3MHSA 4YC9A 4YBTA 4F52B 2UZGA 3U5MA 1D01A 4GJHA 2JRJA 2VJEB 4FK5A 2FUIA 4L7XA 2VP7A 5J3XA 2KU3A 2MA5A 4LADB 2GKWA 3N9PA 5B79A 4K8UA 2ECGA 2K1JA 2Y1MA 4R2YA 1E4UA 1MM2A 2M1RA 5TRBA 2XB1A 2VJFB 3QZVA 3N9NA 4UP5A 5LKZA 1VYXA 2KWNA 1X4IA 2G43A 2ECWA 4R7EA 1WEMA 2YHOA 2QJ0A 2MIQA 4AP4A 5I3LA 2CKLB 5FERA 2YREA 2KYUA 5FB1A 4V3LC 3EB6A 2FOPA 4GNFA 2K17A 4UI9B 2G45A 3ZPV1 3ZVYA 2YQMA 1N87A 2KIZA 3ZYQA 2JMDA 5TDWA 2CT2A 3L11A 1X4JA 4M4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSZ A;  2IDA A;  3SOU A;  4NN2 A;  4N3W A;  5B75 A;  2E6R A;  5LKT A;  2M6M A;  2MD7 B;  4AUQ B;  2EA6 A;  1T1H A;  4L58 A;  2F1X A;  4WZ2 A;  1MM3 A;  3C6W A;  2QIC A;  3LRQ A;  3KV6 A;  4A4C A;  1LB6 A;  5AIU A;  3HQM A;  3HCT A;  2HDP A;  2KFT A;  2LDR A;  2YSM A;  5AIT A;  2DX8 A;  5TAB A;  4A0C D;  1WIM A;  3RTR B;  4PTB A;  2L43 A;  2YSJ A;  2FUU A;  4LKA A;  2YUR A;  5G0F A;  1CA9 A;  3MQS C;  5D1M B;  5FEY A;  3KNV A;  1VFY A;  3O34 A;  2KWK A;  3ZTG A;  2ZET C;  2VPD A;  1WEU A;  3RPG C;  2MNY A;  5H1T A;  4W4U A;  3O36 A;  4GWN A;  1LDK C;  4CA1 A;  2HYE D;  4BHW A;  4O64 A;  2KWO A;  4N4F A;  2KR4 A;  3KV5 A;  1JM7 B;  4YAT A;  2L75 A;  3MHH A;  3L1X A;  2H0D A;  1WEO A;  4BBQ A;  3O35 A;  3GV4 A;  1V87 A;  2JMJ A;  2LGK A;  3DPL R;  3L1Z B;  4R8P K;  2LXH C;  2KRE A;  1LB4 A;  4YAX A;  2EOD A;  1LDJ B;  3HQL A;  2EGP A;  2XXN A;  1RF3 A;  1WGM A;  4LK9 A;  1LB5 A;  4O1V A;  2MUM A;  5D1K B;  5TBN A;  3VK6 A;  2ECN A;  2RI7 A;  1JOC A;  3HQH A;  1VD4 A;  3LQJ A;  4P5O B;  5C13 A;  3EB5 A;  2E6S A;  4IC2 A;  3HU6 A;  1Z2Q A;  2KGI A;  3ASL A;  2PUY A;  3SOW A;  5D1L B;  2G6Q A;  2PNX A;  2ECT A;  1U6G B;  2YUC A;  3M62 A;  4QF3 A;  5LKX A;  1F62 A;  3U5N A;  1DVP A;  4JJQ A;  5JG6 A;  5TDR A;  2MD8 C;  2H0D B;  1JM7 A;  3ZPV E;  2ECI A;  1K2F A;  3O33 A;  1WEQ A;  2L80 A;  1L0A A;  2F42 A;  2FOO A;  2YW8 A;  3ZVZ B;  2JMI A;  1FP0 A;  3N9Q A;  4TKP B;  3O37 A;  4ZUX U;  5LCW B;  2OXQ C;  1YZE A;  2Y43 A;  1WEW A;  4PPE A;  2KGG A;  2L0B A;  4ZQL A;  4V3K C;  2K16 A;  2F6N A;  1D0A A;  3HTK C;  1WES A;  4S3O C;  4A49 A;  1X4U A;  5B78 A;  3SOX A;  2VPE A;  2F1Z A;  5E1T A;  4WA6 A;  2C2V S;  1WEV A;  4LJN A;  3ZJB A;  5B76 A;  1CA4 A;  2C2L A;  2VNF A;  4ZDT A;  3I2D A;  5B77 A;  3ZNI A;  1BOR A;  3KQI A;  1Z6U A;  2VPB A;  3O7A A;  2LGV A;  1WEP A;  2LRI C;  2MNZ A;  2RSD A;  3FL2 A;  4GND A;  4GHU A;  3PUQ A;  4XI1 A;  2VPG A;  2LQ6 A;  2F1Y A;  5KH9 A;  2Y1N A;  5G05 B;  5FB0 A;  2F1W A;  5G04 B;  2F6J A;  3N9O A;  2CR2 A;  4AYC B;  1ZBD B;  2YU4 A;  3M99 A;  2MA6 A;  1HYJ A;  2MT5 A;  3LQH A;  1CHC A;  2I50 A;  5DIN A;  3IVQ A;  4WZ3 B;  4UP0 A;  5EYA F;  4FIP A;  3M63 A;  4FJC A;  1WFK A;  4YAB A;  5H9M A;  5B8D A;  3N9M A;  4MSX A;  3HCS A;  3SHB A;  2L5U A;  4AVX A;  2D8S A;  2FSA A;  1FBV A;  2KWJ A;  1D00 A;  1Z60 A;  3PHD A;  1WE9 A;  4S3O B;  5KH3 A;  4I7B A;  2YHN A;  1FLL A;  4Z8M A;  2CSY A;  1XWH A;  2LGG A;  2LV9 A;  3IVV A;  2QIZ A;  1WEE A;  3GL6 A;  5H1V A;  2ECV A;  3RPG B;  2LXP C;  4B86 C;  2ECJ A;  1WIL A;  4C9Z A;  5C11 A;  2LGL A;  4AYC A;  2YQL A;  4LLB A;  5DKA A;  2KE1 A;  1FLK A;  1CZY A;  4GWM A;  3T7L A;  4GNE A;  3N9L A;  3NG2 A;  3C5K A;  3U5P A;  2LN0 A;  4FO9 A;  1RMD A;  3DQV R;  5LKU A;  3MQR A;  4YBS A;  2YYR A;  2YT5 A;  2K4D A;  3HCU A;  2AN6 A;  2VJE A;  3LQI A;  2XEU A;  4I7D A;  4X3G A;  1G25 A;  2A25 A;  5H1U A;  4CCG X;  1QSC A;  4QF2 A;  2M3H A;  2VJF A;  4YBM A;  5KH7 A;  4I7C A;  3U5O A;  3V43 A;  3IVB A;  4Q6F A;  3O70 A;  3PUR A;  4YAD A;  4A4B A;  4GNG A;  1D0J A;  4B7Y C;  4KG9 A;  2BAY A;  2FOJ A;  2CKL A;  4YSI A;  4GB0 A;  1F3V B;  3IHP A;  2M85 A;  4WZ0 A;  3HQI A;  4MVT A;  2NAA A;  1HYI A;  4IC3 A;  1WEN A;  3T6R A;  1IYM A;  1YY6 A;  1KZZ A;  1CZZ A;  1ZMS A;  3HSV A;  3MHS A;  4YC9 A;  4YBT A;  4F52 B;  2UZG A;  3U5M A;  1D01 A;  4GJH A;  2JRJ A;  2VJE B;  4FK5 A;  2FUI A;  4L7X A;  2VP7 A;  5J3X A;  2KU3 A;  2MA5 A;  4LAD B;  2GKW A;  3N9P A;  5B79 A;  4K8U A;  2ECG A;  2K1J A;  2Y1M A;  4R2Y A;  1E4U A;  1MM2 A;  2M1R A;  5TRB A;  2XB1 A;  2VJF B;  3QZV A;  3N9N A;  4UP5 A;  5LKZ A;  1VYX A;  2KWN A;  1X4I A;  2G43 A;  2ECW A;  4R7E A;  1WEM A;  2YHO A;  2QJ0 A;  2MIQ A;  4AP4 A;  5I3L A;  2CKL B;  5FER A;  2YRE A;  2KYU A;  5FB1 A;  4V3L C;  3EB6 A;  2FOP A;  4GNF A;  2K17 A;  4UI9 B;  2G45 A;  3ZPV 1;  3ZVY A;  2YQM A;  1N87 A;  2KIZ A;  3ZYQ A;  2JMD A;  5TDW A;  2CT2 A;  3L11 A;  1X4J A;  4M4E A; 
#chains in the Genus database with same CATH topology
 2CSZ A;  2IDA A;  3SOU A;  4NN2 A;  4N3W A;  2YVR A;  5B75 A;  2E6R A;  5LKT A;  2M6M A;  2MD7 B;  4AUQ B;  1MBM A;  2EA6 A;  1T1H A;  4L58 A;  2F1X A;  4WZ2 A;  1MM3 A;  3C6W A;  2QIC A;  3LRQ A;  3KV6 A;  4A4C A;  1LB6 A;  5AIU A;  3HQM A;  3HCT A;  2HDP A;  2KFT A;  2LDR A;  2YSM A;  5AIT A;  2DX8 A;  5TAB A;  4A0C D;  1WIM A;  3RTR B;  4PTB A;  5SVY A;  2L43 A;  2YSJ A;  3LVR E;  2FUU A;  3FEH A;  4LKA A;  2YUR A;  4OGE A;  5G0F A;  1CA9 A;  3MQS C;  5D1M B;  5FEY A;  3KNV A;  1VFY A;  3O34 A;  2KWK A;  3ZTG A;  2ZET C;  2VPD A;  1WEU A;  3RPG C;  2MNY A;  5H1T A;  4W4U A;  2EXU A;  3O36 A;  4GWN A;  1DCQ A;  4F1P A;  1LDK C;  4CA1 A;  2FD4 A;  2HYE D;  2LAU A;  2RR4 A;  4BHW A;  4O64 A;  2KWO A;  4N4F A;  2KR4 A;  3KV5 A;  1JM7 B;  4YAT A;  2L75 A;  5SVI B;  3MHH A;  4Z0O A;  3L1X A;  2H0D A;  1WEO A;  4BBQ A;  2KKX A;  3O35 A;  3GV4 A;  1V87 A;  2JMJ A;  2LGK A;  3DPL R;  3L1Z B;  4R8P K;  2LXH C;  2KRE A;  1LB4 A;  4YAX A;  2EOD A;  2E61 A;  1LDJ B;  3HQL A;  2EGP A;  2XXN A;  1RF3 A;  1WGM A;  4LK9 A;  1LB5 A;  4O1V A;  2MUM A;  4QQ4 A;  3Q1D A;  5D1K B;  3LJU X;  3MDB C;  5TBN A;  3VK6 A;  2ECN A;  2RI7 A;  2OWA A;  1JOC A;  3HQH A;  1VD4 A;  3LQJ A;  4P5O B;  5C13 A;  3EB5 A;  2E6S A;  4IC2 A;  3HU6 A;  1Z2Q A;  2KGI A;  3ASL A;  3SUB A;  2PUY A;  3SOW A;  5D1L B;  2G6Q A;  2PNX A;  2ECT A;  1U6G B;  2YUC A;  3M62 A;  2MKE A;  4QF3 A;  5LKX A;  1F62 A;  3U5N A;  1DVP A;  4JJQ A;  5JG6 A;  5TDR A;  2MD8 C;  2H0D B;  1JM7 A;  3ZPV E;  2CRW A;  2ECI A;  1K2F A;  2DSM A;  5SVI A;  3O33 A;  1WEQ A;  3DDT A;  2L80 A;  1L0A A;  2F42 A;  2EGM A;  3M7K A;  2FOO A;  2YW8 A;  3ZVZ B;  2JMI A;  3E2D A;  1FP0 A;  3N9Q A;  4TKP B;  3O37 A;  4ZUX U;  5LCW B;  4O62 A;  2OXQ C;  1YZE A;  2Y43 A;  1WEW A;  4PPE A;  2KGG A;  2L0B A;  4ZQL A;  4V3K C;  2K16 A;  2F6N A;  1D0A A;  3HTK C;  1WES A;  3FAO A;  4S3O C;  4A49 A;  3JUE A;  1X4U A;  5B78 A;  3SOX A;  2VPE A;  2F1Z A;  5E1T A;  4WA6 A;  2C2V S;  1WEV A;  2L7P A;  2XOC A;  4LJN A;  3ZJB A;  5B76 A;  2KKY A;  1CA4 A;  2C2L A;  2M13 A;  2VNF A;  4ZDT A;  2B0O E;  3I2D A;  5B77 A;  3ZNI A;  1BOR A;  3KQI A;  1Z6U A;  2VPB A;  2JM3 A;  3O7A A;  2LGV A;  1WEP A;  2LRI C;  2MNZ A;  2RSD A;  3FL2 A;  4GND A;  4GHU A;  3PUQ A;  4XI1 A;  3KDE C;  2VPG A;  2LQ6 A;  2F1Y A;  5KH9 A;  2Y1N A;  5G05 B;  5FB0 A;  2F1W A;  5G04 B;  2FFW A;  2F6J A;  3N9O A;  2CR2 A;  4AYC B;  1ZBD B;  2YU4 A;  3M99 A;  2MA6 A;  1HYJ A;  2MT5 A;  3LQH A;  2IQJ A;  2P57 A;  1CHC A;  2I50 A;  5DIN A;  3IVQ A;  4WZ3 B;  4UP0 A;  5EYA F;  4FIP A;  3M63 A;  4FJC A;  1WFK A;  3FJU B;  3LDY A;  4YAB A;  5H9M A;  5B8D A;  3N9M A;  4MSX A;  3HCS A;  3SHB A;  4OGC A;  2L5U A;  4AVX A;  2D8S A;  2D8U A;  2FSA A;  1FBV A;  2KWJ A;  1D00 A;  1Z60 A;  3PHD A;  3O47 A;  1WE9 A;  4S3O B;  5KH3 A;  4I7B A;  2YHN A;  1FLL A;  4Z8M A;  2CSY A;  1XWH A;  2LGG A;  2LV9 A;  3IVV A;  2QIZ A;  1WEE A;  3GL6 A;  5H1V A;  2ECV A;  3RPG B;  2LXP C;  4B86 C;  2ECJ A;  1WIL A;  4C9Z A;  5C11 A;  2LGL A;  4AYC A;  2YQL A;  4LLB A;  5DKA A;  2KE1 A;  1FLK A;  1CZY A;  4GWM A;  3T7L A;  4GNE A;  3N9L A;  3NG2 A;  3C5K A;  3FAN A;  3U5P A;  2LN0 A;  4FO9 A;  1RMD A;  3DQV R;  5LKU A;  3MQR A;  4YBS A;  2YYR A;  2YT5 A;  2K4D A;  3HCU A;  2AN6 A;  2DJA A;  2VJE A;  3LQI A;  2XEU A;  4I7D A;  4X3G A;  1G25 A;  2A25 A;  5H1U A;  4CCG X;  1QSC A;  4QF2 A;  2M3H A;  2VJF A;  4YBM A;  5KH7 A;  4I7C A;  3U5O A;  3V43 A;  3IVB A;  5SVX A;  4Q6F A;  3O70 A;  3PUR A;  4YAD A;  4A4B A;  4GNG A;  1D0J A;  4B7Y C;  4KG9 A;  2BAY A;  2FOJ A;  2CKL A;  4YSI A;  2XP0 A;  2CSV A;  4GB0 A;  4H9D A;  1F3V B;  3IHP A;  2M85 A;  4WZ0 A;  3LVQ E;  3HQI A;  4MVT A;  2NAA A;  1HYI A;  4IC3 A;  2CON A;  1WEN A;  3T6R A;  1IYM A;  1YY6 A;  1KZZ A;  1CZZ A;  1ZMS A;  3HSV A;  3MHS A;  4YC9 A;  4YBT A;  4F52 B;  2UZG A;  3U5M A;  1D01 A;  4GJH A;  2JRJ A;  2CRR A;  2VJE B;  4FK5 A;  2FUI A;  4L7X A;  2VP7 A;  2XOY A;  5J3X A;  2KU3 A;  2MA5 A;  4LAD B;  3PLW A;  2GKW A;  3N9P A;  3DWD A;  5B79 A;  4K8U A;  4Z0R A;  2ECG A;  2K1J A;  2Y1M A;  4R2Y A;  1E4U A;  1MM2 A;  2M1R A;  5TRB A;  2XB1 A;  2XOZ A;  3H7H A;  2JUN A;  3T9K A;  2VJF B;  3QZV A;  3N9N A;  4UP5 A;  5LKZ A;  1VYX A;  2KWN A;  1X4I A;  2G43 A;  2ECW A;  4R7E A;  1WEM A;  2YHO A;  2QJ0 A;  2MIQ A;  4AP4 A;  5I3L A;  2CKL B;  5FER A;  2YRE A;  2KYU A;  3FM8 C;  5FB1 A;  4V3L C;  3EB6 A;  2FOP A;  4GNF A;  2K17 A;  4UI9 B;  2G45 A;  3ZPV 1;  3ZVY A;  2YQM A;  1N87 A;  2KIZ A;  3ZYQ A;  2JMD A;  5TDW A;  2CT2 A;  3L11 A;  5K3Q A;  1X4J A;  4M4E A; 
#chains in the Genus database with same CATH homology
 2CSZ A;  2IDA A;  3SOU A;  4NN2 A;  4N3W A;  5B75 A;  2E6R A;  5LKT A;  2M6M A;  2MD7 B;  4AUQ B;  2EA6 A;  1T1H A;  4L58 A;  2F1X A;  4WZ2 A;  1MM3 A;  3C6W A;  2QIC A;  3LRQ A;  3KV6 A;  4A4C A;  1LB6 A;  5AIU A;  3HQM A;  3HCT A;  2HDP A;  2KFT A;  2LDR A;  2YSM A;  5AIT A;  2DX8 A;  5TAB A;  4A0C D;  1WIM A;  3RTR B;  4PTB A;  2L43 A;  2YSJ A;  2FUU A;  4LKA A;  2YUR A;  5G0F A;  1CA9 A;  3MQS C;  5D1M B;  5FEY A;  3KNV A;  1VFY A;  3O34 A;  2KWK A;  3ZTG A;  2ZET C;  2VPD A;  1WEU A;  3RPG C;  2MNY A;  5H1T A;  4W4U A;  3O36 A;  4GWN A;  1LDK C;  4CA1 A;  2HYE D;  4BHW A;  4O64 A;  2KWO A;  4N4F A;  2KR4 A;  3KV5 A;  1JM7 B;  4YAT A;  2L75 A;  3MHH A;  3L1X A;  2H0D A;  1WEO A;  4BBQ A;  3O35 A;  3GV4 A;  1V87 A;  2JMJ A;  2LGK A;  3DPL R;  3L1Z B;  4R8P K;  2LXH C;  2KRE A;  1LB4 A;  4YAX A;  2EOD A;  1LDJ B;  3HQL A;  2EGP A;  2XXN A;  1RF3 A;  1WGM A;  4LK9 A;  1LB5 A;  4O1V A;  2MUM A;  5D1K B;  5TBN A;  3VK6 A;  2ECN A;  2RI7 A;  1JOC A;  3HQH A;  1VD4 A;  3LQJ A;  4P5O B;  5C13 A;  3EB5 A;  2E6S A;  4IC2 A;  3HU6 A;  1Z2Q A;  2KGI A;  3ASL A;  2PUY A;  3SOW A;  5D1L B;  2G6Q A;  2PNX A;  2ECT A;  1U6G B;  2YUC A;  3M62 A;  4QF3 A;  5LKX A;  1F62 A;  3U5N A;  1DVP A;  4JJQ A;  5JG6 A;  5TDR A;  2MD8 C;  2H0D B;  1JM7 A;  3ZPV E;  2ECI A;  1K2F A;  3O33 A;  1WEQ A;  2L80 A;  1L0A A;  2F42 A;  2FOO A;  2YW8 A;  3ZVZ B;  2JMI A;  1FP0 A;  3N9Q A;  4TKP B;  3O37 A;  4ZUX U;  5LCW B;  2OXQ C;  1YZE A;  2Y43 A;  1WEW A;  4PPE A;  2KGG A;  2L0B A;  4ZQL A;  4V3K C;  2K16 A;  2F6N A;  1D0A A;  3HTK C;  1WES A;  4S3O C;  4A49 A;  1X4U A;  5B78 A;  3SOX A;  2VPE A;  2F1Z A;  5E1T A;  4WA6 A;  2C2V S;  1WEV A;  4LJN A;  3ZJB A;  5B76 A;  1CA4 A;  2C2L A;  2VNF A;  4ZDT A;  3I2D A;  5B77 A;  3ZNI A;  1BOR A;  3KQI A;  1Z6U A;  2VPB A;  3O7A A;  2LGV A;  1WEP A;  2LRI C;  2MNZ A;  2RSD A;  3FL2 A;  4GND A;  4GHU A;  3PUQ A;  4XI1 A;  2VPG A;  2LQ6 A;  2F1Y A;  5KH9 A;  2Y1N A;  5G05 B;  5FB0 A;  2F1W A;  5G04 B;  2F6J A;  3N9O A;  2CR2 A;  4AYC B;  1ZBD B;  2YU4 A;  3M99 A;  2MA6 A;  1HYJ A;  2MT5 A;  3LQH A;  1CHC A;  2I50 A;  5DIN A;  3IVQ A;  4WZ3 B;  4UP0 A;  5EYA F;  4FIP A;  3M63 A;  4FJC A;  1WFK A;  4YAB A;  5H9M A;  5B8D A;  3N9M A;  4MSX A;  3HCS A;  3SHB A;  2L5U A;  4AVX A;  2D8S A;  2FSA A;  1FBV A;  2KWJ A;  1D00 A;  1Z60 A;  3PHD A;  1WE9 A;  4S3O B;  5KH3 A;  4I7B A;  2YHN A;  1FLL A;  4Z8M A;  2CSY A;  1XWH A;  2LGG A;  2LV9 A;  3IVV A;  2QIZ A;  1WEE A;  3GL6 A;  5H1V A;  2ECV A;  3RPG B;  2LXP C;  4B86 C;  2ECJ A;  1WIL A;  4C9Z A;  5C11 A;  2LGL A;  4AYC A;  2YQL A;  4LLB A;  5DKA A;  2KE1 A;  1FLK A;  1CZY A;  4GWM A;  3T7L A;  4GNE A;  3N9L A;  3NG2 A;  3C5K A;  3U5P A;  2LN0 A;  4FO9 A;  1RMD A;  3DQV R;  5LKU A;  3MQR A;  4YBS A;  2YYR A;  2YT5 A;  2K4D A;  3HCU A;  2AN6 A;  2VJE A;  3LQI A;  2XEU A;  4I7D A;  4X3G A;  1G25 A;  2A25 A;  5H1U A;  4CCG X;  1QSC A;  4QF2 A;  2M3H A;  2VJF A;  4YBM A;  5KH7 A;  4I7C A;  3U5O A;  3V43 A;  3IVB A;  4Q6F A;  3O70 A;  3PUR A;  4YAD A;  4A4B A;  4GNG A;  1D0J A;  4B7Y C;  4KG9 A;  2BAY A;  2FOJ A;  2CKL A;  4YSI A;  4GB0 A;  1F3V B;  3IHP A;  2M85 A;  4WZ0 A;  3HQI A;  4MVT A;  2NAA A;  1HYI A;  4IC3 A;  1WEN A;  3T6R A;  1IYM A;  1YY6 A;  1KZZ A;  1CZZ A;  1ZMS A;  3HSV A;  3MHS A;  4YC9 A;  4YBT A;  4F52 B;  2UZG A;  3U5M A;  1D01 A;  4GJH A;  2JRJ A;  2VJE B;  4FK5 A;  2FUI A;  4L7X A;  2VP7 A;  5J3X A;  2KU3 A;  2MA5 A;  4LAD B;  2GKW A;  3N9P A;  5B79 A;  4K8U A;  2ECG A;  2K1J A;  2Y1M A;  4R2Y A;  1E4U A;  1MM2 A;  2M1R A;  5TRB A;  2XB1 A;  2VJF B;  3QZV A;  3N9N A;  4UP5 A;  5LKZ A;  1VYX A;  2KWN A;  1X4I A;  2G43 A;  2ECW A;  4R7E A;  1WEM A;  2YHO A;  2QJ0 A;  2MIQ A;  4AP4 A;  5I3L A;  2CKL B;  5FER A;  2YRE A;  2KYU A;  5FB1 A;  4V3L C;  3EB6 A;  2FOP A;  4GNF A;  2K17 A;  4UI9 B;  2G45 A;  3ZPV 1;  3ZVY A;  2YQM A;  1N87 A;  2KIZ A;  3ZYQ A;  2JMD A;  5TDW A;  2CT2 A;  3L11 A;  1X4J A;  4M4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...