4CH9A

Crystal structure of the human klhl3 kelch domain in complex with a wnk4 peptide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
286
structure length
286
Chain Sequence
PKVMIVVGGQAPKAIRSVECYDFEEDRWDQIAELPSRRCRAGVVFMAGHVYAVGGFNGSLRVRTVDVYDGVKDQWTSIASMQERRSTLGAAVLNDLLYAVGGFDGSTGLASVEAYSYKTNEWFFVAPMNTRRSSVGVGVVEGKLYAVGGYDGASRQCLSTVEQYNPATNEWIYVADMSTRRSGAGVGVLSGQLYATGGHDGPLVRKSVEVYDPGTNTWKQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPVTDKWTLLPTNMSTGRSYAGVAVIHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Biochemical Characterisation of the Klhl3-Wnk Kinase Interaction Important in Blood Pressure Regulation.
pubmed doi rcsb
molecule keywords KELCH-LIKE PROTEIN 3
molecule tags Signaling protein/transferase
source organism Homo sapiens
total genus 67
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01344 Kelch_1 Kelch motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.80 Mainly Beta 6 Propeller Neuraminidase Kelch-type beta propeller 4ch9A00
4IN4A 1U6DX 3WN7A 2XN4A 4IQKA 5FNTA 3ZGCA 5F72C 1ZGKA 3WDZA 4IFLX 4N1BA 5FNUA 4L7CA 1X2RA 3ZGDA 4CHBA 3VNGA 5FNSA 4IFJA 2ZZKA 2ZW9A 4L7DA 4L7BA 2FLUX 3VNHA 2Z32A 4ASCA 5CGJA 1X2JA 5FNQA 5FZNA 5FZJA 4ZGCA 5FNRA 4IFNX 4CH9A 4XMBA 2ZWAA 3ADEA 4YY8A 2VPJA 3II7A 2DYHA 4ZY3A 2WOZA
chains in the Genus database with same CATH superfamily
4C1YA 1MWEA 4IN4A 4B7QA 1B9TA 4G3NA 2JKBA 4GZXA 1SLIA 1WCSA 3ALWA 2GVXA 1OFZA 4A0PA 4HZYA 4K1IA 3DASA 3TIBA 1WP5A 1E8VA 4B7MA 3GVLA 3ZGDA 4AH4A 1C5KA 4MWXA 4CPYA 2F11A 2HT5A 5F9TA 1INVA 1N6DA 2C4LA 4ASCA 1MS1A 4X4AA 3D12A 5EX7A 4JF7A 2VSKA 2QWEA 4SLIA 1W21A 4HHOA 1V3DA 4D8SA 1INWA 4GJTA 2AEQA 1QLGA 3TI5A 1POOA 1ZGKA 2VW2A 1CRZA 1Z4WA 4WA4A 2YA8A 3CKZA 4CPMA 4YW3A 2HT7A 4H52A 4XMIA 3NSSA 1EURA 5H47A 4YW4A 3SALA 4XJAA 2HT8A 2HU4A 3FW0A 4XMBA 3TI6A 2VK5A 4IYGA 1Z4VA 2FPBA 4N1BA 1B9SA 1U6DX 1EUSA 2XN4A 4M4NA 2HU0A 4MX0A 3TI4A 4JMLA 2G8SA 1V0FA 2HTVA 3H71A 3H73A 4HW6A 2FP9A 1CQ1A 5HUNA 5FWWA 4UOUA 5FZNA 1IVCA 4GN9A 2QWAA 2F27A 5D9BA 1E8UA 1IVFA 4PWZA 3TICA 3JU4A 2FHRA 4XJ9A 1NMAN 2W20A 4GN8A 4IMBA 2F28A 2QWCA 5GX4A 3ZGCA 3IAXA 2BERA 2YA4A 3K37A 1NCBN 3Q6TA 1NPEA 4IFJA 1VCJA 4YW5A 1V3CA 3TI3A 3I1CA 2FP8A 2QWJA 4QN3A 2IARA 2Z32A 2IAQA 2AGSA 4M4VA 2C4AA 1INXA 3WWAA 4MWRA 2FPCA 4FPEA 2GVWA 3WW9A 2IAOA 4ZY3A 2IAXA 4NN9A 4KS5A 4XJWA 3WDZA 4CPNA 3V64C 2ISMA 2QWHA 4L7CA 4CHBA 1MZ6A 1NNCA 3AMSA 2AEPA 4XJRA 1DIMA 2OJHA 3O9KA 1NN2A 4HZWA 2DYHA 3L6VA 3Q6PA 1KITA 1W0OA 1NCAN 4B7NA 2XZIA 4X6KA 4GDIA 4DG6A 2QWFA 4IQKA 1F8BA 2F12A 4XYXA 1MZ5A 2W8BB 1NSDA 1MS9A 4MC7A 2YA5A 1USRA 4J9TA 4WA5A 5NN9A 5HUGA 3SANA 3VNHA 2QE8A 3S2KA 1EUTA 1NCCN 4B7JA 3S8ZA 3SOQA 1SLLA 1H6LA 1RWIA 4FVKA 1MR5A 6NN9A 1W8NA 2IAPA 3G4EA 4UF7A 1USXA 3GVKA 4GZSA 2SIMA 4NC5A 3SRGA 3D11A 1C9UA 3NN9A 4O5TA 4FQ4A 2VK6A 2DG0A 2QWIA 2ZB6A 4K1KA 2VW0A 1K32A 3KGGA 4CH9A 3CL2A 3HLHA 2YDPA 3HRPA 2BZDA 4FJ6A 2XZKA 4WEFA 3LI3A 3K39A 4FPYA 2F10A 3INBA 4HIZA 1XOGA 4Q6KA 5FNTA 1NMBN 2HTQA 4BBWA 4IFLX 2VAQA 2QWBA 1Z50A 4MJUA 4QN4A 4YZ5A 2F29A 3DR2A 4AGTA 5FNSA 1QBIA 1W1XA 1IJQA 4GB1A 1NSBA 1W0PA 4QN6A 1A4GA 4FP3A 2SILA 5FZJA 2POOA 2QWDA 5FNRA 4XOGA 4KS1A 1V0EA 4GN7A 2XCYA 7NN9A 3S94A 2GHSA 3V1SA 1W20A 2QWGA 4MJVA 1NNAA 2F13A 2QWKA 3U0SA 5HX0A 2F24A 2RKCA 4L7DA 4NCSA 1S18A 3LI4A 4K1JA 4CPZA 1VCUA 4XJUA 4GZWA 1V04A 1W8OA 2YA7A 5GX3A 3K3AA 1Q7FA 5D9DA 4ZGCA 1SO7A 2IAWA 3H6JA 4HZZA 4D4UA 1MS0A 4GNAA 4WEGA 1A4QA 3SOBB 3NO0A 4FPHA 3TC9A 3FVZA 3H72A 5GTQA 1MS8A 2HTRA 2CMLA 4YZ2A 3OPZA 3SLIA 4MWJA 1Z4XA 2BF6A 4MWYA 3BYCA 1INFA 4FPCA 3VNGA 1F8CA 1PJXA 4X47A 4L7BA 3A9GA 2YA6A 1EUUA 5GX5A 4M4UA 4XHXA 4K1HA 3G4HA 1N1TA 2SLIA 1L7FA 4GZPA 2HQSA 4FPLA 1MS4A 4D52C 4MZAA 2WOZA 2DSOA 3W09A 4XE9A 4HZVA 3SOVA 4FOWA 5B2CA 4YZ4A 4CSDA 5GX2A 1S0JA 2W8BA 2F0ZA 1MS3A 2IAUA 1N1SA 1N7DA 1F8DA 2GVVA 3T1EA 4XIKA 5M1ZA 3S8VA 4GEZA 4M3MA 3CYEA 4D52B 4KS3A 3KYAA 3II7A 1MS5A 4Q1UA 1S0IA 4MWUA 4YZ1A 2VW1A 4C1YB 1NMCA 4FOYA 3SILA 1NSCA 3O9JA 1N6EA 2GVUA 2H2NA 4FP2A 2YDTA 5FNUA 4WA3A 3CL0A 3P5BL 4FPJA 1N1VA 2ZW9A 2W38A 3B7EA 5D9CA 2IVZA 4AHAA 1ZI0A 4XJQA 4QN7A 4XIOA 4FOQA 1N1YA 1V3EA 1L7GA 3UC1A 4KS2A 3AMRA 1IVEA 2BATA 2F26A 2VPJA 2VSMA 3E5ZA 4FPOB 3SREA 2HTWA 4FPKA 4XILA 2DG1A 1S1DA 1XOEA 4GZQA 4MWLA 5B2DA 4HZXA 1CRUA 3ALXA 4KS4A 1E1AA 2A75A 3O4PA 4YW1A 1INHA 4XJZA 4AGIA 1IVDA 4GDJA 4CPLA 5HUMA 1Z4ZA 4QNPA 1CVMA 4YZ3A 4IFNX 2HTUA 1IUBA 4I00A 4FPGA 5HUKA 4K3YA 2W5NA 2IAVA 2P4OA 3B69A 4GZOA 4GZTA 1IUCA 1E8TA 2X9MA 1V3BA 1A14N 2B8HA 5JYYA 4XJ8A 1INYA 2ZB5A 3TIAA 2XZJA 4CPOA 1RWLA 1NNBA 2IASA 3LI5A 1X2JA 1WCQA 3A71A 1Z4YA 2VVZA 1SNTA 4GNCA 4MZEA 1INGA 4ZLRA 1V2IA 4H53A 4R40A 2VWDA 1X2RA 1V0ZA 4FPFA 1NCDN 5EO8A 1SUUA 2ZZKA 4MWWA 4GNBA 2FLUX 4QN5A 1IVBA 4XMAA 2V91A 1IVGA 4B7RA 4MWQA 4FZHA 3ADEA 4YY8A 2F25A 4XHBA 1BJIA 3TI8A 3WN7A 4DGRA 3A9HA 3PJQA 4YW2A 1F8EA 1L7HA 5F72C 3Q6KA 4FOVA 3BEQA 4MWVA 4O5SA 3K38A 1DILA 2AH2A 2VK7A 2W5OA 3GVJA 1B9VA 2IATA 3K36A 4HHQA 5CGJA 5EO7A 5FNQA 4D52A 5GX1A 4X49A 3A72A 3V65B 2ZWAA 1N6FA 2H2UA 2HTYA 3HLIA
chains in the Genus database with same CATH topology
4IN4A 1U6DX 3WN7A 2XN4A 4IQKA 5FNTA 3ZGCA 5F72C 1ZGKA 3WDZA 4IFLX 4N1BA 5FNUA 4L7CA 1X2RA 3ZGDA 4CHBA 3VNGA 5FNSA 4IFJA 2ZZKA 2ZW9A 4L7DA 4L7BA 2FLUX 3VNHA 2Z32A 4ASCA 5CGJA 1X2JA 5FNQA 5FZNA 5FZJA 4ZGCA 5FNRA 4IFNX 4CH9A 4XMBA 2ZWAA 3ADEA 4YY8A 2VPJA 3II7A 2DYHA 4ZY3A 2WOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IN4 A;  1U6D X;  3WN7 A;  2XN4 A;  4IQK A;  5FNT A;  3ZGC A;  5F72 C;  1ZGK A;  3WDZ A;  4IFL X;  4N1B A;  5FNU A;  4L7C A;  1X2R A;  3ZGD A;  4CHB A;  3VNG A;  5FNS A;  4IFJ A;  2ZZK A;  2ZW9 A;  4L7D A;  4L7B A;  2FLU X;  3VNH A;  2Z32 A;  4ASC A;  5CGJ A;  1X2J A;  5FNQ A;  5FZN A;  5FZJ A;  4ZGC A;  5FNR A;  4IFN X;  4CH9 A;  4XMB A;  2ZWA A;  3ADE A;  4YY8 A;  2VPJ A;  3II7 A;  2DYH A;  4ZY3 A;  2WOZ A; 
#chains in the Genus database with same CATH topology
 4C1Y A;  1MWE A;  4IN4 A;  4B7Q A;  1B9T A;  4G3N A;  2JKB A;  4GZX A;  1SLI A;  1WCS A;  3ALW A;  2GVX A;  1OFZ A;  4A0P A;  4HZY A;  4K1I A;  3DAS A;  3TIB A;  1WP5 A;  1E8V A;  4B7M A;  3GVL A;  3ZGD A;  4AH4 A;  1C5K A;  4MWX A;  4CPY A;  2F11 A;  2HT5 A;  5F9T A;  1INV A;  1N6D A;  2C4L A;  4ASC A;  1MS1 A;  4X4A A;  3D12 A;  5EX7 A;  4JF7 A;  2VSK A;  2QWE A;  4SLI A;  1W21 A;  4HHO A;  1V3D A;  4D8S A;  1INW A;  4GJT A;  2AEQ A;  1QLG A;  3TI5 A;  1POO A;  1ZGK A;  2VW2 A;  1CRZ A;  1Z4W A;  4WA4 A;  2YA8 A;  3CKZ A;  4CPM A;  4YW3 A;  2HT7 A;  4H52 A;  4XMI A;  3NSS A;  1EUR A;  5H47 A;  4YW4 A;  3SAL A;  4XJA A;  2HT8 A;  2HU4 A;  3FW0 A;  4XMB A;  3TI6 A;  2VK5 A;  4IYG A;  1Z4V A;  2FPB A;  4N1B A;  1B9S A;  1U6D X;  1EUS A;  2XN4 A;  4M4N A;  2HU0 A;  4MX0 A;  3TI4 A;  4JML A;  2G8S A;  1V0F A;  2HTV A;  3H71 A;  3H73 A;  4HW6 A;  2FP9 A;  1CQ1 A;  5HUN A;  5FWW A;  4UOU A;  5FZN A;  1IVC A;  4GN9 A;  2QWA A;  2F27 A;  5D9B A;  1E8U A;  1IVF A;  4PWZ A;  3TIC A;  3JU4 A;  2FHR A;  4XJ9 A;  1NMA N;  2W20 A;  4GN8 A;  4IMB A;  2F28 A;  2QWC A;  5GX4 A;  3ZGC A;  3IAX A;  2BER A;  2YA4 A;  3K37 A;  1NCB N;  3Q6T A;  1NPE A;  4IFJ A;  1VCJ A;  4YW5 A;  1V3C A;  3TI3 A;  3I1C A;  2FP8 A;  2QWJ A;  4QN3 A;  2IAR A;  2Z32 A;  2IAQ A;  2AGS A;  4M4V A;  2C4A A;  1INX A;  3WWA A;  4MWR A;  2FPC A;  4FPE A;  2GVW A;  3WW9 A;  2IAO A;  4ZY3 A;  2IAX A;  4NN9 A;  4KS5 A;  4XJW A;  3WDZ A;  4CPN A;  3V64 C;  2ISM A;  2QWH A;  4L7C A;  4CHB A;  1MZ6 A;  1NNC A;  3AMS A;  2AEP A;  4XJR A;  1DIM A;  2OJH A;  3O9K A;  1NN2 A;  4HZW A;  2DYH A;  3L6V A;  3Q6P A;  1KIT A;  1W0O A;  1NCA N;  4B7N A;  2XZI A;  4X6K A;  4GDI A;  4DG6 A;  2QWF A;  4IQK A;  1F8B A;  2F12 A;  4XYX A;  1MZ5 A;  2W8B B;  1NSD A;  1MS9 A;  4MC7 A;  2YA5 A;  1USR A;  4J9T A;  4WA5 A;  5NN9 A;  5HUG A;  3SAN A;  3VNH A;  2QE8 A;  3S2K A;  1EUT A;  1NCC N;  4B7J A;  3S8Z A;  3SOQ A;  1SLL A;  1H6L A;  1RWI A;  4FVK A;  1MR5 A;  6NN9 A;  1W8N A;  2IAP A;  3G4E A;  4UF7 A;  1USX A;  3GVK A;  4GZS A;  2SIM A;  4NC5 A;  3SRG A;  3D11 A;  1C9U A;  3NN9 A;  4O5T A;  4FQ4 A;  2VK6 A;  2DG0 A;  2QWI A;  2ZB6 A;  4K1K A;  2VW0 A;  1K32 A;  3KGG A;  4CH9 A;  3CL2 A;  3HLH A;  2YDP A;  3HRP A;  2BZD A;  4FJ6 A;  2XZK A;  4WEF A;  3LI3 A;  3K39 A;  4FPY A;  2F10 A;  3INB A;  4HIZ A;  1XOG A;  4Q6K A;  5FNT A;  1NMB N;  2HTQ A;  4BBW A;  4IFL X;  2VAQ A;  2QWB A;  1Z50 A;  4MJU A;  4QN4 A;  4YZ5 A;  2F29 A;  3DR2 A;  4AGT A;  5FNS A;  1QBI A;  1W1X A;  1IJQ A;  4GB1 A;  1NSB A;  1W0P A;  4QN6 A;  1A4G A;  4FP3 A;  2SIL A;  5FZJ A;  2POO A;  2QWD A;  5FNR A;  4XOG A;  4KS1 A;  1V0E A;  4GN7 A;  2XCY A;  7NN9 A;  3S94 A;  2GHS A;  3V1S A;  1W20 A;  2QWG A;  4MJV A;  1NNA A;  2F13 A;  2QWK A;  3U0S A;  5HX0 A;  2F24 A;  2RKC A;  4L7D A;  4NCS A;  1S18 A;  3LI4 A;  4K1J A;  4CPZ A;  1VCU A;  4XJU A;  4GZW A;  1V04 A;  1W8O A;  2YA7 A;  5GX3 A;  3K3A A;  1Q7F A;  5D9D A;  4ZGC A;  1SO7 A;  2IAW A;  3H6J A;  4HZZ A;  4D4U A;  1MS0 A;  4GNA A;  4WEG A;  1A4Q A;  3SOB B;  3NO0 A;  4FPH A;  3TC9 A;  3FVZ A;  3H72 A;  5GTQ A;  1MS8 A;  2HTR A;  2CML A;  4YZ2 A;  3OPZ A;  3SLI A;  4MWJ A;  1Z4X A;  2BF6 A;  4MWY A;  3BYC A;  1INF A;  4FPC A;  3VNG A;  1F8C A;  1PJX A;  4X47 A;  4L7B A;  3A9G A;  2YA6 A;  1EUU A;  5GX5 A;  4M4U A;  4XHX A;  4K1H A;  3G4H A;  1N1T A;  2SLI A;  1L7F A;  4GZP A;  2HQS A;  4FPL A;  1MS4 A;  4D52 C;  4MZA A;  2WOZ A;  2DSO A;  3W09 A;  4XE9 A;  4HZV A;  3SOV A;  4FOW A;  5B2C A;  4YZ4 A;  4CSD A;  5GX2 A;  1S0J A;  2W8B A;  2F0Z A;  1MS3 A;  2IAU A;  1N1S A;  1N7D A;  1F8D A;  2GVV A;  3T1E A;  4XIK A;  5M1Z A;  3S8V A;  4GEZ A;  4M3M A;  3CYE A;  4D52 B;  4KS3 A;  3KYA A;  3II7 A;  1MS5 A;  4Q1U A;  1S0I A;  4MWU A;  4YZ1 A;  2VW1 A;  4C1Y B;  1NMC A;  4FOY A;  3SIL A;  1NSC A;  3O9J A;  1N6E A;  2GVU A;  2H2N A;  4FP2 A;  2YDT A;  5FNU A;  4WA3 A;  3CL0 A;  3P5B L;  4FPJ A;  1N1V A;  2ZW9 A;  2W38 A;  3B7E A;  5D9C A;  2IVZ A;  4AHA A;  1ZI0 A;  4XJQ A;  4QN7 A;  4XIO A;  4FOQ A;  1N1Y A;  1V3E A;  1L7G A;  3UC1 A;  4KS2 A;  3AMR A;  1IVE A;  2BAT A;  2F26 A;  2VPJ A;  2VSM A;  3E5Z A;  4FPO B;  3SRE A;  2HTW A;  4FPK A;  4XIL A;  2DG1 A;  1S1D A;  1XOE A;  4GZQ A;  4MWL A;  5B2D A;  4HZX A;  1CRU A;  3ALX A;  4KS4 A;  1E1A A;  2A75 A;  3O4P A;  4YW1 A;  1INH A;  4XJZ A;  4AGI A;  1IVD A;  4GDJ A;  4CPL A;  5HUM A;  1Z4Z A;  4QNP A;  1CVM A;  4YZ3 A;  4IFN X;  2HTU A;  1IUB A;  4I00 A;  4FPG A;  5HUK A;  4K3Y A;  2W5N A;  2IAV A;  2P4O A;  3B69 A;  4GZO A;  4GZT A;  1IUC A;  1E8T A;  2X9M A;  1V3B A;  1A14 N;  2B8H A;  5JYY A;  4XJ8 A;  1INY A;  2ZB5 A;  3TIA A;  2XZJ A;  4CPO A;  1RWL A;  1NNB A;  2IAS A;  3LI5 A;  1X2J A;  1WCQ A;  3A71 A;  1Z4Y A;  2VVZ A;  1SNT A;  4GNC A;  4MZE A;  1ING A;  4ZLR A;  1V2I A;  4H53 A;  4R40 A;  2VWD A;  1X2R A;  1V0Z A;  4FPF A;  1NCD N;  5EO8 A;  1SUU A;  2ZZK A;  4MWW A;  4GNB A;  2FLU X;  4QN5 A;  1IVB A;  4XMA A;  2V91 A;  1IVG A;  4B7R A;  4MWQ A;  4FZH A;  3ADE A;  4YY8 A;  2F25 A;  4XHB A;  1BJI A;  3TI8 A;  3WN7 A;  4DGR A;  3A9H A;  3PJQ A;  4YW2 A;  1F8E A;  1L7H A;  5F72 C;  3Q6K A;  4FOV A;  3BEQ A;  4MWV A;  4O5S A;  3K38 A;  1DIL A;  2AH2 A;  2VK7 A;  2W5O A;  3GVJ A;  1B9V A;  2IAT A;  3K36 A;  4HHQ A;  5CGJ A;  5EO7 A;  5FNQ A;  4D52 A;  5GX1 A;  4X49 A;  3A72 A;  3V65 B;  2ZWA A;  1N6F A;  2H2U A;  2HTY A;  3HLI A; 
#chains in the Genus database with same CATH homology
 4IN4 A;  1U6D X;  3WN7 A;  2XN4 A;  4IQK A;  5FNT A;  3ZGC A;  5F72 C;  1ZGK A;  3WDZ A;  4IFL X;  4N1B A;  5FNU A;  4L7C A;  1X2R A;  3ZGD A;  4CHB A;  3VNG A;  5FNS A;  4IFJ A;  2ZZK A;  2ZW9 A;  4L7D A;  4L7B A;  2FLU X;  3VNH A;  2Z32 A;  4ASC A;  5CGJ A;  1X2J A;  5FNQ A;  5FZN A;  5FZJ A;  4ZGC A;  5FNR A;  4IFN X;  4CH9 A;  4XMB A;  2ZWA A;  3ADE A;  4YY8 A;  2VPJ A;  3II7 A;  2DYH A;  4ZY3 A;  2WOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...