4CHJA

Structure of inner membrane complex (imc) sub-compartment protein 3 (isp3) from toxoplasma gondii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
Knots found
sequence length
139
structure length
123
Chain Sequence
b'ADLEIGREGEVIQVSKEAFDNWMNRYEAGDTMEVLFPDGHRIECNLKIDRPKNFMNLTFNQKVRPIQLDDIAAVLYGSKMLRNPVVGFRLASSGRAIAFSFKDITDAQCFVSFLDDEIKKNQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMC SUB-COMPARTMENT PROTEIN ISP3
publication title The Inner Membrane Complex Sub-Compartment Proteins Critical for Replication of the Apicomplexan Parasite Toxoplasma Gondii Adopt a Pleckstrin Homology Fold
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Cell cycle
total genus 33
structure length 123
sequence length 139
other databases KnotProt 2.0: K 41
ec nomenclature
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18045 ISP3_C ISP3 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4chjA00
1V5PA 3TCAA 2ZPYA 2UZRA 4DX90 2PZ1A 5EFXA 2CY5A 2D9YA 1H4RA 5C79A 2OQBA 5JLJB 3U7DA 3VOQA 2ELBA 1SHCA 4HAVB 1MIXA 3ODWA 4MT7A 3KSYA 3TFMA 1QC6A 3MDBC 5LONB 4DXAB 4EJNA 2KCJA 3ULBA 5D27A 2UZSA 3DXDA 3PEGA 1OQNA 4B6HA 2ELAA 4CHJA 1H10A 2DHJA 1XODA 4CYEA 2P0HA 1NTVA 5J3TA 2LG1A 1KZGA 3PP2A 5D3WA 2X18A 2DLWA 4A6KA 1J0WA 2EJ8A 4CHMA 2D4QA 2Y8FA 2P0DA 4L6EA 1SGHA 2JP2A 2GJYA 5KCVA 1P3RA 3BJIA 1N3HA 5DHFB 1U5EA 1WGQA 1M7RA 2R0DA 3RCPA 1FAOA 2YT1A 2W2XD 1AQCA 1W1HA 2IYBA 2COCA 4KHAA 1GC6A 2I5CA 4IFSA 4ZRIA 5D3YA 1MIZB 3T06A 4F7UP 1NI2A 4Z2MB 3BINA 1DROA 4XWXA 2W2WA 2YS5A 2NMBA 4GXBA 3AJ4A 5FI1A 3QBVB 1U27A 2LKOA 2P0FA 1X1FA 1ZM0A 3AU5A 4GPTB 4H8SA 1PLSA 3TW1A 4HATB 4HDQA 1TXDA 4BBKA 1WVHA 4GZUA 2K2JA 3X23A 3M1IB 3PG7A 4A6FA 3PSCA 4NSWA 2YT0A 3A98B 3MPXA 1J19A 2NZ8B 4TYZA 2DYQA 2DHIA 2DKQA 2K00A 1W1DA 1XCGA 2RUKB 2DX5A 2LOXA 1P6SA 4HAXB 4F7GA 1MAIA 2I1KA 2XQNM 1WI1A 2P8VA 3QWMA 5DI9B 1OMWA 1ZSQA 4D0NB 2W2XC 1MPHA 2BCJA 2Y7BA 2J59M 2VSZA 2YF0A 1NU2A 3ODXA 1ISNA 4ZRKA 3WYFB 2VKIA 4GMVA 1KZ7A 3OANA 1U5FA 2GCJA 5D3XA 2CODA 1NTYA 2M14A 1PMSA 3PZDA 3D8FA 1DYNA 4DBBA 4K2OA 2K2UA 2DFKA 4NY0A 1LW3A 1GC7A 2G35A 3ULCA 2EMTA 3IVFA 3F0WA 3LJUX 2N23A 1I7AA 1X05A 4HHVA 3FM8C 2N0YA 2ROZB 2Q13A 4A6HA 2CAYA 3SUZA 2IFSA 2H7EA 1M7EA 2Z0PA 2EC1A 1U29A 1B55A 1Q67A 5FI0A 3KY9A 2RLOA 4WSFA 1EGXA 1EF1A 2D10A 5GOWB 2D9VA 3O96A 3CIKA 1UNPA 5D3VA 4DX8A 5HE0A 5C5BB 4MY6A 3UZTA 1MK7B 3GYPA 3ML4A 2GS0A 5C6RA 3P7ZA 1XX0A 4TKNA 3U8ZA 1V5MA 3SYXA 2R09A 1UEFA 3SV1A 1FHXA 5HE3A 5KQ4A 1WJMA 3DXCA 3D8EA 3WA0A 4C0AA 3N7CA 1FOEA 1BAKA 2DTCA 2DKPA 1UPRA 2M38A 5LOPB 3A8QA 2AL6A 2DHKA 4KHBB 4IOYX 4HAUB 1DBHA 1X86A 3ZVRA 2HE7A 4IAPA 3PVLA 5KQ1A 2RSGA 3KZ1A 5JP4A 3DXEA 1I2HA 2H7DA 1FGZA 4F7HA 2OTXA 4GMXB 3VIAA 1UPQA 1DDMA 3V5WA 4K17A 2CY4A 5DHAB 4PQ0A 1XD4A 1FHOA 5JHHA 4HB4B 1Y19B 3CXBB 1UNRA 3ZDTA 2L2IA 1E5WA 4KAXB 2QKLA 4A6FB 1X11A 2Z0OA 3HQCA 4EKUA 5JHGA 3KRXA 2DN6A 1KI1B 2UVMA 2I5FA 2LOZA 1XKEA 1FB8A 1Z87A 2RNRB 1Y5OA 1WG7A 3F5RA 3P6AA 2J0KA 1BTKA 2GCLA 4WVFB 2D11A 1OY2A 2ROVA 1U5GA 1GG3A 2L1CA 3FEHA 2EMSA 1AWEA 1X1GA 3QIJA 3SNHA 1DDWA 1XR0B 2LULA 2RVBB 5DH9B 1WGUA 2J0JA 2RGNB 5J3YA 2D9WA 2FJLA 2V76A 2YS3A 4MK0A 1DDVA 5HE1A 1EAZA 2I1JA 2Z0QA 1K5DB 2QKMA 4ZRJA 1PFJA 2Y8GA 4EMOA 5C5BA 4HDOA 4YONA 4HAYB 4KVGB 4HB2B 3A8PA 1TQZA 2YS1A 5DIFB 2MKRA 4K81A 3TVVA 3FSSA 4P7IA 2DA0A 3AU4A 4HAZB 1TJ6A 5HE2A 2CRFA 1BWNA 3PVUA 1LB1A 4KHOA 3D8DA 1MKEA 2E2XA 4PNKA 4HAWB 1U2BA 4YL8A 2ADZA 4WJ7A 1V89A 1ZVRA 3HK0A 4HB0B 1FGYA 1UNQA 2DYNA 3TO1A 3HW2B 1RJ2A 1V5UA 1BTNA 2KGXB 2YVCA 2DX1A 5L81A 2YSZA 3GYOA 1ZC4B 4K2PA 2COAA 3NSUA 1EVHA 2MDXA 3KRWA 4A5KA 1QQGA 1IRSA 1MK9B 3G9WA 1V61A 2YRYA 5CLQB 3SO6A 5C16A 3ODOA 2MFQA 2VRWB 5CLLB 1RRPB 1W1GA 2KUPA 2MWNB 2HTHB 2AEHA 4Y94A 1K5GB 4GN1A 4HB3B 1U5DA 1FHWA 1ZC3B 2J0MA 5J3QA 2D9ZA 1P5TA 2LYDA 4Z2NA 2D2QA 1WJ1A 2D9XA 2COFA 1V88A 3PVWA
chains in the Genus database with same CATH superfamily
1V5PA 3TCAA 2ZPYA 2UZRA 4DX90 2PZ1A 5EFXA 2CY5A 2D9YA 1H4RA 5C79A 2OQBA 5JLJB 3U7DA 3HSAA 3VOQA 2ELBA 1SHCA 4HAVB 3U12A 1MIXA 3ODWA 4MT7A 3KSYA 3TFMA 2KIEA 4GOUA 1QC6A 3MDBC 5LONB 4DXAB 4EJNA 2KCJA 3ULBA 5D27A 2UZSA 3DXDA 3PEGA 1OQNA 4B6HA 2ELAA 4CHJA 1H10A 2DHJA 1XODA 4CYEA 2P0HA 1NTVA 5J3TA 2LG1A 2NBVA 1KZGA 3PP2A 5D3WA 2X18A 2DLWA 4A6KA 1J0WA 2EJ8A 4CHMA 2D4QA 2Y8FA 2P0DA 2Z4DA 4L6EA 1SGHA 2JP2A 2GJYA 5KCVA 3OHMB 1P3RA 3BJIA 1N3HA 5DHFB 1U5EA 1WGQA 1M7RA 2R0DA 3RCPA 1FAOA 2YT1A 2W2XD 1AQCA 1W1HA 2IYBA 2COCA 4KHAA 1GC6A 4KHBA 2I5CA 4IFSA 4ZRIA 5D3YA 1MIZB 3T06A 4F7UP 1NI2A 4Z2MB 3BINA 1DROA 4XWXA 2W2WA 2YS5A 2NMBA 4GXBA 3AJ4A 5FI1A 3QBVB 1U27A 2LKOA 2P0FA 4GNKB 3NW8A 1X1FA 1ZM0A 3AU5A 4GPTB 4H8SA 1PLSA 2Z13A 3TW1A 4HATB 3DCXA 4HDQA 1TXDA 4BBKA 1WVHA 4GZUA 2K2JA 3X23A 3M1IB 3PG7A 4A6FA 3PSCA 2ZKMX 4D6WA 4NSWA 2YT0A 3A98B 3MPXA 1J19A 2NZ8B 4TYZA 2DYQA 3NWDA 2DHIA 2DKQA 2K00A 1W1DA 1XCGA 2RUKB 2DX5A 2LOXA 1P6SA 4HAXB 4F7GA 1MAIA 2I1KA 2XQNM 1WI1A 2P8VA 3QWMA 5DI9B 1OMWA 1ZSQA 4D0NB 2W2XC 1MPHA 2BCJA 2Y7BA 2J59M 2VSZA 2YF0A 4DIXA 1NU2A 2K49A 3ODXA 1ISNA 4ZRKA 3WYFB 2VKIA 5I2SA 4GMVA 1KZ7A 3OANA 1U5FA 2GCJA 5D3XA 2CODA 1NTYA 1MI1A 2M14A 1PMSA 3PZDA 3D8FA 1DYNA 4DBBA 4K2OA 2K2UA 3HIEA 2DFKA 4NY0A 1LW3A 1GC7A 2G35A 3ULCA 2EMTA 3IVFA 3F0WA 3LJUX 2N23A 1I7AA 1X05A 4HHVA 3FM8C 4QJ3B 2N0YA 2ROZB 2Q13A 4A6HA 2CAYA 3SUZA 2IFSA 2H7EA 1M7EA 2Z0PA 2EC1A 1U29A 4QJ4B 1B55A 1Q67A 4CSQA 5FI0A 3KY9A 2RLOA 4WSFA 1EGXA 1EF1A 2D10A 5GOWB 2D9VA 3O96A 3CIKA 1UNPA 5D3VA 4DX8A 5HE0A 2R2YA 5C5BB 4HSIA 4MY6A 3UZTA 2KUQA 1MK7B 3B77A 4OT1A 3GYPA 3ML4A 2GS0A 5C6RA 3P7ZA 1XX0A 4TKNA 3U8ZA 4QXAB 1V5MA 3SYXA 2R09A 1UEFA 3SV1A 1FHXA 5HE3A 5KQ4A 1WJMA 3DXCA 3D8EA 3WA0A 2K8EA 4C0AA 3N7CA 1FOEA 1BAKA 2DTCA 2DKPA 1UPRA 2M38A 5LOPB 5LG4B 3A8QA 2AL6A 2DHKA 4KHBB 4IOYX 4HAUB 1DBHA 1X86A 4QJ5B 3ZVRA 2HE7A 4IAPA 3PVLA 5KQ1A 2RSGA 3KZ1A 5JP4A 3DXEA 1I2HA 2H7DA 1FGZA 4F7HA 2OTXA 4GMXB 3VIAA 1UPQA 1DDMA 3V5WA 4K17A 2CY4A 5DHAB 2KR0A 2FJUB 4PQ0A 1XD4A 1FHOA 5JHHA 4HB4B 1Y19B 3CXBB 1UNRA 3ZDTA 2L2IA 1E5WA 4KAXB 2QKLA 4A6FB 1X11A 2Z0OA 3HQCA 4EKUA 5JHGA 3KRXA 5M4YB 2DN6A 1KI1B 2UVMA 3NWAA 2I5FA 2LOZA 1XKEA 1FB8A 1Z87A 2RNRB 1Y5OA 1WG7A 3F5RA 3P6AA 2J0KA 1BTKA 2GCLA 4WVFB 2D11A 1OY2A 2ROVA 1U5GA 1GG3A 2L1CA 3FEHA 2EMSA 1AWEA 1X1GA 3QIJA 3SNHA 1DDWA 1XR0B 2LULA 2RVBB 5DH9B 1WGUA 2KIGA 2J0JA 2RGNB 5J3YA 2D9WA 2FJLA 2V76A 2YS3A 4MK0A 1DDVA 5HE1A 1EAZA 2I1JA 2Z0QA 3NWFA 1K5DB 2QKMA 4ZRJA 1PFJA 2Y8GA 4EMOA 5C5BA 4HDOA 4YONA 4HAYB 4KVGB 4HB2B 3A8PA 1TQZA 2YS1A 5DIFB 2MKRA 4K81A 3TVVA 3FSSA 4P7IA 2DA0A 3AU4A 4HAZB 1TJ6A 5HE2A 2CRFA 1BWNA 3PVUA 1LB1A 4KHOA 3D8DA 1MKEA 2YT2A 2E2XA 4PNKA 4HAWB 1U2BA 4YL8A 2ADZA 4WJ7A 1V89A 1ZVRA 3HK0A 3FVCA 4HB0B 1FGYA 1UNQA 2DYNA 3TO1A 3HW2B 1RJ2A 1V5UA 1BTNA 2KGXB 2YVCA 2DX1A 5L81A 2YSZA 3GYOA 1ZYIA 1ZC4B 4K2PA 2RRFA 3A58A 2COAA 3NSUA 1T77A 1EVHA 2MDXA 2Z14A 3KRWA 4A5KA 1QQGA 1IRSA 1MK9B 3G9WA 5IRSA 1V61A 2YRYA 5CLQB 3SO6A 5C16A 3ODOA 2MFQA 4OSNA 2GUMA 2VRWB 5CLLB 1RRPB 1W1GA 2KUPA 2MWNB 2HTHB 2AEHA 4Y94A 1K5GB 5I2MA 4GN1A 4HB3B 1U5DA 1FHWA 1ZC3B 2J0MA 5J3QA 2Z59A 2D9ZA 1P5TA 2LYDA 4L1RA 4Z2NA 2D2QA 1WJ1A 2D9XA 2COFA 1V88A 3PVWA
chains in the Genus database with same CATH topology
1V5PA 3TCAA 2ZPYA 2UZRA 4DX90 2PZ1A 5EFXA 2CY5A 2D9YA 1H4RA 5C79A 2OQBA 5JLJB 3U7DA 3VOQA 2ELBA 1SHCA 4HAVB 1MIXA 3ODWA 4MT7A 3KSYA 3TFMA 1QC6A 3MDBC 5LONB 4DXAB 4EJNA 2KCJA 3ULBA 5D27A 2UZSA 3DXDA 3PEGA 1OQNA 4B6HA 2ELAA 4CHJA 1H10A 2DHJA 1XODA 4CYEA 2P0HA 1NTVA 5J3TA 2LG1A 1KZGA 3PP2A 5D3WA 2X18A 2DLWA 4A6KA 1J0WA 2EJ8A 4CHMA 2D4QA 2Y8FA 2P0DA 4L6EA 1SGHA 2JP2A 2GJYA 5KCVA 1P3RA 3BJIA 1N3HA 5DHFB 1U5EA 1WGQA 1M7RA 2R0DA 3RCPA 1FAOA 2YT1A 2W2XD 1AQCA 1W1HA 2IYBA 2COCA 4KHAA 1GC6A 2I5CA 4IFSA 4ZRIA 5D3YA 1MIZB 3T06A 4F7UP 1NI2A 4Z2MB 3BINA 1DROA 4XWXA 2W2WA 2YS5A 2NMBA 4GXBA 3AJ4A 5FI1A 3QBVB 1U27A 2LKOA 2P0FA 1X1FA 1ZM0A 3AU5A 4GPTB 4H8SA 1PLSA 3TW1A 4HATB 4HDQA 1TXDA 4BBKA 1WVHA 4GZUA 2K2JA 3X23A 3M1IB 3PG7A 4A6FA 3PSCA 4NSWA 2YT0A 3A98B 3MPXA 1J19A 2NZ8B 4TYZA 2DYQA 2DHIA 2DKQA 2K00A 1W1DA 1XCGA 2RUKB 2DX5A 2LOXA 1P6SA 4HAXB 4F7GA 1MAIA 2I1KA 2XQNM 1WI1A 2P8VA 3QWMA 5DI9B 1OMWA 1ZSQA 4D0NB 2W2XC 1MPHA 2BCJA 2Y7BA 2J59M 2VSZA 2YF0A 1NU2A 3ODXA 1ISNA 4ZRKA 3WYFB 2VKIA 4GMVA 1KZ7A 3OANA 1U5FA 2GCJA 5D3XA 2CODA 1NTYA 2M14A 1PMSA 3PZDA 3D8FA 1DYNA 4DBBA 4K2OA 2K2UA 2DFKA 4NY0A 1LW3A 1GC7A 2G35A 3ULCA 2EMTA 3IVFA 3F0WA 3LJUX 2N23A 1I7AA 1X05A 4HHVA 3FM8C 2N0YA 2ROZB 2Q13A 4A6HA 2CAYA 3SUZA 2IFSA 2H7EA 1M7EA 2Z0PA 2EC1A 1U29A 1B55A 1Q67A 5FI0A 3KY9A 2RLOA 4WSFA 1EGXA 1EF1A 2D10A 5GOWB 2D9VA 3O96A 3CIKA 1UNPA 5D3VA 4DX8A 5HE0A 5C5BB 4MY6A 3UZTA 1MK7B 3GYPA 3ML4A 2GS0A 5C6RA 3P7ZA 1XX0A 4TKNA 3U8ZA 1V5MA 3SYXA 2R09A 1UEFA 3SV1A 1FHXA 5HE3A 5KQ4A 1WJMA 3DXCA 3D8EA 3WA0A 4C0AA 3N7CA 1FOEA 1BAKA 2DTCA 2DKPA 1UPRA 2M38A 5LOPB 3A8QA 2AL6A 2DHKA 4KHBB 4IOYX 4HAUB 1DBHA 1X86A 3ZVRA 2HE7A 4IAPA 3PVLA 5KQ1A 2RSGA 3KZ1A 5JP4A 3DXEA 1I2HA 2H7DA 1FGZA 4F7HA 2OTXA 4GMXB 3VIAA 1UPQA 1DDMA 3V5WA 4K17A 2CY4A 5DHAB 4PQ0A 1XD4A 1FHOA 5JHHA 4HB4B 1Y19B 3CXBB 1UNRA 3ZDTA 2L2IA 1E5WA 4KAXB 2QKLA 4A6FB 1X11A 2Z0OA 3HQCA 4EKUA 5JHGA 3KRXA 2DN6A 1KI1B 2UVMA 2I5FA 2LOZA 1XKEA 1FB8A 1Z87A 2RNRB 1Y5OA 1WG7A 3F5RA 3P6AA 2J0KA 1BTKA 2GCLA 4WVFB 2D11A 1OY2A 2ROVA 1U5GA 1GG3A 2L1CA 3FEHA 2EMSA 1AWEA 1X1GA 3QIJA 3SNHA 1DDWA 1XR0B 2LULA 2RVBB 5DH9B 1WGUA 2J0JA 2RGNB 5J3YA 2D9WA 2FJLA 2V76A 2YS3A 4MK0A 1DDVA 5HE1A 1EAZA 2I1JA 2Z0QA 1K5DB 2QKMA 4ZRJA 1PFJA 2Y8GA 4EMOA 5C5BA 4HDOA 4YONA 4HAYB 4KVGB 4HB2B 3A8PA 1TQZA 2YS1A 5DIFB 2MKRA 4K81A 3TVVA 3FSSA 4P7IA 2DA0A 3AU4A 4HAZB 1TJ6A 5HE2A 2CRFA 1BWNA 3PVUA 1LB1A 4KHOA 3D8DA 1MKEA 2E2XA 4PNKA 4HAWB 1U2BA 4YL8A 2ADZA 4WJ7A 1V89A 1ZVRA 3HK0A 4HB0B 1FGYA 1UNQA 2DYNA 3TO1A 3HW2B 1RJ2A 1V5UA 1BTNA 2KGXB 2YVCA 2DX1A 5L81A 2YSZA 3GYOA 1ZC4B 4K2PA 2COAA 3NSUA 1EVHA 2MDXA 3KRWA 4A5KA 1QQGA 1IRSA 1MK9B 3G9WA 1V61A 2YRYA 5CLQB 3SO6A 5C16A 3ODOA 2MFQA 2VRWB 5CLLB 1RRPB 1W1GA 2KUPA 2MWNB 2HTHB 2AEHA 4Y94A 1K5GB 4GN1A 4HB3B 1U5DA 1FHWA 1ZC3B 2J0MA 5J3QA 2D9ZA 1P5TA 2LYDA 4Z2NA 2D2QA 1WJ1A 2D9XA 2COFA 1V88A 3PVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V5P A;  3TCA A;  2ZPY A;  2UZR A;  4DX9 0;  2PZ1 A;  5EFX A;  2CY5 A;  2D9Y A;  1H4R A;  5C79 A;  2OQB A;  5JLJ B;  3U7D A;  3VOQ A;  2ELB A;  1SHC A;  4HAV B;  1MIX A;  3ODW A;  4MT7 A;  3KSY A;  3TFM A;  1QC6 A;  3MDB C;  5LON B;  4DXA B;  4EJN A;  2KCJ A;  3ULB A;  5D27 A;  2UZS A;  3DXD A;  3PEG A;  1OQN A;  4B6H A;  2ELA A;  4CHJ A;  1H10 A;  2DHJ A;  1XOD A;  4CYE A;  2P0H A;  1NTV A;  5J3T A;  2LG1 A;  1KZG A;  3PP2 A;  5D3W A;  2X18 A;  2DLW A;  4A6K A;  1J0W A;  2EJ8 A;  4CHM A;  2D4Q A;  2Y8F A;  2P0D A;  4L6E A;  1SGH A;  2JP2 A;  2GJY A;  5KCV A;  1P3R A;  3BJI A;  1N3H A;  5DHF B;  1U5E A;  1WGQ A;  1M7R A;  2R0D A;  3RCP A;  1FAO A;  2YT1 A;  2W2X D;  1AQC A;  1W1H A;  2IYB A;  2COC A;  4KHA A;  1GC6 A;  2I5C A;  4IFS A;  4ZRI A;  5D3Y A;  1MIZ B;  3T06 A;  4F7U P;  1NI2 A;  4Z2M B;  3BIN A;  1DRO A;  4XWX A;  2W2W A;  2YS5 A;  2NMB A;  4GXB A;  3AJ4 A;  5FI1 A;  3QBV B;  1U27 A;  2LKO A;  2P0F A;  1X1F A;  1ZM0 A;  3AU5 A;  4GPT B;  4H8S A;  1PLS A;  3TW1 A;  4HAT B;  4HDQ A;  1TXD A;  4BBK A;  1WVH A;  4GZU A;  2K2J A;  3X23 A;  3M1I B;  3PG7 A;  4A6F A;  3PSC A;  4NSW A;  2YT0 A;  3A98 B;  3MPX A;  1J19 A;  2NZ8 B;  4TYZ A;  2DYQ A;  2DHI A;  2DKQ A;  2K00 A;  1W1D A;  1XCG A;  2RUK B;  2DX5 A;  2LOX A;  1P6S A;  4HAX B;  4F7G A;  1MAI A;  2I1K A;  2XQN M;  1WI1 A;  2P8V A;  3QWM A;  5DI9 B;  1OMW A;  1ZSQ A;  4D0N B;  2W2X C;  1MPH A;  2BCJ A;  2Y7B A;  2J59 M;  2VSZ A;  2YF0 A;  1NU2 A;  3ODX A;  1ISN A;  4ZRK A;  3WYF B;  2VKI A;  4GMV A;  1KZ7 A;  3OAN A;  1U5F A;  2GCJ A;  5D3X A;  2COD A;  1NTY A;  2M14 A;  1PMS A;  3PZD A;  3D8F A;  1DYN A;  4DBB A;  4K2O A;  2K2U A;  2DFK A;  4NY0 A;  1LW3 A;  1GC7 A;  2G35 A;  3ULC A;  2EMT A;  3IVF A;  3F0W A;  3LJU X;  2N23 A;  1I7A A;  1X05 A;  4HHV A;  3FM8 C;  2N0Y A;  2ROZ B;  2Q13 A;  4A6H A;  2CAY A;  3SUZ A;  2IFS A;  2H7E A;  1M7E A;  2Z0P A;  2EC1 A;  1U29 A;  1B55 A;  1Q67 A;  5FI0 A;  3KY9 A;  2RLO A;  4WSF A;  1EGX A;  1EF1 A;  2D10 A;  5GOW B;  2D9V A;  3O96 A;  3CIK A;  1UNP A;  5D3V A;  4DX8 A;  5HE0 A;  5C5B B;  4MY6 A;  3UZT A;  1MK7 B;  3GYP A;  3ML4 A;  2GS0 A;  5C6R A;  3P7Z A;  1XX0 A;  4TKN A;  3U8Z A;  1V5M A;  3SYX A;  2R09 A;  1UEF A;  3SV1 A;  1FHX A;  5HE3 A;  5KQ4 A;  1WJM A;  3DXC A;  3D8E A;  3WA0 A;  4C0A A;  3N7C A;  1FOE A;  1BAK A;  2DTC A;  2DKP A;  1UPR A;  2M38 A;  5LOP B;  3A8Q A;  2AL6 A;  2DHK A;  4KHB B;  4IOY X;  4HAU B;  1DBH A;  1X86 A;  3ZVR A;  2HE7 A;  4IAP A;  3PVL A;  5KQ1 A;  2RSG A;  3KZ1 A;  5JP4 A;  3DXE A;  1I2H A;  2H7D A;  1FGZ A;  4F7H A;  2OTX A;  4GMX B;  3VIA A;  1UPQ A;  1DDM A;  3V5W A;  4K17 A;  2CY4 A;  5DHA B;  4PQ0 A;  1XD4 A;  1FHO A;  5JHH A;  4HB4 B;  1Y19 B;  3CXB B;  1UNR A;  3ZDT A;  2L2I A;  1E5W A;  4KAX B;  2QKL A;  4A6F B;  1X11 A;  2Z0O A;  3HQC A;  4EKU A;  5JHG A;  3KRX A;  2DN6 A;  1KI1 B;  2UVM A;  2I5F A;  2LOZ A;  1XKE A;  1FB8 A;  1Z87 A;  2RNR B;  1Y5O A;  1WG7 A;  3F5R A;  3P6A A;  2J0K A;  1BTK A;  2GCL A;  4WVF B;  2D11 A;  1OY2 A;  2ROV A;  1U5G A;  1GG3 A;  2L1C A;  3FEH A;  2EMS A;  1AWE A;  1X1G A;  3QIJ A;  3SNH A;  1DDW A;  1XR0 B;  2LUL A;  2RVB B;  5DH9 B;  1WGU A;  2J0J A;  2RGN B;  5J3Y A;  2D9W A;  2FJL A;  2V76 A;  2YS3 A;  4MK0 A;  1DDV A;  5HE1 A;  1EAZ A;  2I1J A;  2Z0Q A;  1K5D B;  2QKM A;  4ZRJ A;  1PFJ A;  2Y8G A;  4EMO A;  5C5B A;  4HDO A;  4YON A;  4HAY B;  4KVG B;  4HB2 B;  3A8P A;  1TQZ A;  2YS1 A;  5DIF B;  2MKR A;  4K81 A;  3TVV A;  3FSS A;  4P7I A;  2DA0 A;  3AU4 A;  4HAZ B;  1TJ6 A;  5HE2 A;  2CRF A;  1BWN A;  3PVU A;  1LB1 A;  4KHO A;  3D8D A;  1MKE A;  2E2X A;  4PNK A;  4HAW B;  1U2B A;  4YL8 A;  2ADZ A;  4WJ7 A;  1V89 A;  1ZVR A;  3HK0 A;  4HB0 B;  1FGY A;  1UNQ A;  2DYN A;  3TO1 A;  3HW2 B;  1RJ2 A;  1V5U A;  1BTN A;  2KGX B;  2YVC A;  2DX1 A;  5L81 A;  2YSZ A;  3GYO A;  1ZC4 B;  4K2P A;  2COA A;  3NSU A;  1EVH A;  2MDX A;  3KRW A;  4A5K A;  1QQG A;  1IRS A;  1MK9 B;  3G9W A;  1V61 A;  2YRY A;  5CLQ B;  3SO6 A;  5C16 A;  3ODO A;  2MFQ A;  2VRW B;  5CLL B;  1RRP B;  1W1G A;  2KUP A;  2MWN B;  2HTH B;  2AEH A;  4Y94 A;  1K5G B;  4GN1 A;  4HB3 B;  1U5D A;  1FHW A;  1ZC3 B;  2J0M A;  5J3Q A;  2D9Z A;  1P5T A;  2LYD A;  4Z2N A;  2D2Q A;  1WJ1 A;  2D9X A;  2COF A;  1V88 A;  3PVW A; 
#chains in the Genus database with same CATH topology
 1V5P A;  3TCA A;  2ZPY A;  2UZR A;  4DX9 0;  2PZ1 A;  5EFX A;  2CY5 A;  2D9Y A;  1H4R A;  5C79 A;  2OQB A;  5JLJ B;  3U7D A;  3HSA A;  3VOQ A;  2ELB A;  1SHC A;  4HAV B;  3U12 A;  1MIX A;  3ODW A;  4MT7 A;  3KSY A;  3TFM A;  2KIE A;  4GOU A;  1QC6 A;  3MDB C;  5LON B;  4DXA B;  4EJN A;  2KCJ A;  3ULB A;  5D27 A;  2UZS A;  3DXD A;  3PEG A;  1OQN A;  4B6H A;  2ELA A;  4CHJ A;  1H10 A;  2DHJ A;  1XOD A;  4CYE A;  2P0H A;  1NTV A;  5J3T A;  2LG1 A;  2NBV A;  1KZG A;  3PP2 A;  5D3W A;  2X18 A;  2DLW A;  4A6K A;  1J0W A;  2EJ8 A;  4CHM A;  2D4Q A;  2Y8F A;  2P0D A;  2Z4D A;  4L6E A;  1SGH A;  2JP2 A;  2GJY A;  5KCV A;  3OHM B;  1P3R A;  3BJI A;  1N3H A;  5DHF B;  1U5E A;  1WGQ A;  1M7R A;  2R0D A;  3RCP A;  1FAO A;  2YT1 A;  2W2X D;  1AQC A;  1W1H A;  2IYB A;  2COC A;  4KHA A;  1GC6 A;  4KHB A;  2I5C A;  4IFS A;  4ZRI A;  5D3Y A;  1MIZ B;  3T06 A;  4F7U P;  1NI2 A;  4Z2M B;  3BIN A;  1DRO A;  4XWX A;  2W2W A;  2YS5 A;  2NMB A;  4GXB A;  3AJ4 A;  5FI1 A;  3QBV B;  1U27 A;  2LKO A;  2P0F A;  4GNK B;  3NW8 A;  1X1F A;  1ZM0 A;  3AU5 A;  4GPT B;  4H8S A;  1PLS A;  2Z13 A;  3TW1 A;  4HAT B;  3DCX A;  4HDQ A;  1TXD A;  4BBK A;  1WVH A;  4GZU A;  2K2J A;  3X23 A;  3M1I B;  3PG7 A;  4A6F A;  3PSC A;  2ZKM X;  4D6W A;  4NSW A;  2YT0 A;  3A98 B;  3MPX A;  1J19 A;  2NZ8 B;  4TYZ A;  2DYQ A;  3NWD A;  2DHI A;  2DKQ A;  2K00 A;  1W1D A;  1XCG A;  2RUK B;  2DX5 A;  2LOX A;  1P6S A;  4HAX B;  4F7G A;  1MAI A;  2I1K A;  2XQN M;  1WI1 A;  2P8V A;  3QWM A;  5DI9 B;  1OMW A;  1ZSQ A;  4D0N B;  2W2X C;  1MPH A;  2BCJ A;  2Y7B A;  2J59 M;  2VSZ A;  2YF0 A;  4DIX A;  1NU2 A;  2K49 A;  3ODX A;  1ISN A;  4ZRK A;  3WYF B;  2VKI A;  5I2S A;  4GMV A;  1KZ7 A;  3OAN A;  1U5F A;  2GCJ A;  5D3X A;  2COD A;  1NTY A;  1MI1 A;  2M14 A;  1PMS A;  3PZD A;  3D8F A;  1DYN A;  4DBB A;  4K2O A;  2K2U A;  3HIE A;  2DFK A;  4NY0 A;  1LW3 A;  1GC7 A;  2G35 A;  3ULC A;  2EMT A;  3IVF A;  3F0W A;  3LJU X;  2N23 A;  1I7A A;  1X05 A;  4HHV A;  3FM8 C;  4QJ3 B;  2N0Y A;  2ROZ B;  2Q13 A;  4A6H A;  2CAY A;  3SUZ A;  2IFS A;  2H7E A;  1M7E A;  2Z0P A;  2EC1 A;  1U29 A;  4QJ4 B;  1B55 A;  1Q67 A;  4CSQ A;  5FI0 A;  3KY9 A;  2RLO A;  4WSF A;  1EGX A;  1EF1 A;  2D10 A;  5GOW B;  2D9V A;  3O96 A;  3CIK A;  1UNP A;  5D3V A;  4DX8 A;  5HE0 A;  2R2Y A;  5C5B B;  4HSI A;  4MY6 A;  3UZT A;  2KUQ A;  1MK7 B;  3B77 A;  4OT1 A;  3GYP A;  3ML4 A;  2GS0 A;  5C6R A;  3P7Z A;  1XX0 A;  4TKN A;  3U8Z A;  4QXA B;  1V5M A;  3SYX A;  2R09 A;  1UEF A;  3SV1 A;  1FHX A;  5HE3 A;  5KQ4 A;  1WJM A;  3DXC A;  3D8E A;  3WA0 A;  2K8E A;  4C0A A;  3N7C A;  1FOE A;  1BAK A;  2DTC A;  2DKP A;  1UPR A;  2M38 A;  5LOP B;  5LG4 B;  3A8Q A;  2AL6 A;  2DHK A;  4KHB B;  4IOY X;  4HAU B;  1DBH A;  1X86 A;  4QJ5 B;  3ZVR A;  2HE7 A;  4IAP A;  3PVL A;  5KQ1 A;  2RSG A;  3KZ1 A;  5JP4 A;  3DXE A;  1I2H A;  2H7D A;  1FGZ A;  4F7H A;  2OTX A;  4GMX B;  3VIA A;  1UPQ A;  1DDM A;  3V5W A;  4K17 A;  2CY4 A;  5DHA B;  2KR0 A;  2FJU B;  4PQ0 A;  1XD4 A;  1FHO A;  5JHH A;  4HB4 B;  1Y19 B;  3CXB B;  1UNR A;  3ZDT A;  2L2I A;  1E5W A;  4KAX B;  2QKL A;  4A6F B;  1X11 A;  2Z0O A;  3HQC A;  4EKU A;  5JHG A;  3KRX A;  5M4Y B;  2DN6 A;  1KI1 B;  2UVM A;  3NWA A;  2I5F A;  2LOZ A;  1XKE A;  1FB8 A;  1Z87 A;  2RNR B;  1Y5O A;  1WG7 A;  3F5R A;  3P6A A;  2J0K A;  1BTK A;  2GCL A;  4WVF B;  2D11 A;  1OY2 A;  2ROV A;  1U5G A;  1GG3 A;  2L1C A;  3FEH A;  2EMS A;  1AWE A;  1X1G A;  3QIJ A;  3SNH A;  1DDW A;  1XR0 B;  2LUL A;  2RVB B;  5DH9 B;  1WGU A;  2KIG A;  2J0J A;  2RGN B;  5J3Y A;  2D9W A;  2FJL A;  2V76 A;  2YS3 A;  4MK0 A;  1DDV A;  5HE1 A;  1EAZ A;  2I1J A;  2Z0Q A;  3NWF A;  1K5D B;  2QKM A;  4ZRJ A;  1PFJ A;  2Y8G A;  4EMO A;  5C5B A;  4HDO A;  4YON A;  4HAY B;  4KVG B;  4HB2 B;  3A8P A;  1TQZ A;  2YS1 A;  5DIF B;  2MKR A;  4K81 A;  3TVV A;  3FSS A;  4P7I A;  2DA0 A;  3AU4 A;  4HAZ B;  1TJ6 A;  5HE2 A;  2CRF A;  1BWN A;  3PVU A;  1LB1 A;  4KHO A;  3D8D A;  1MKE A;  2YT2 A;  2E2X A;  4PNK A;  4HAW B;  1U2B A;  4YL8 A;  2ADZ A;  4WJ7 A;  1V89 A;  1ZVR A;  3HK0 A;  3FVC A;  4HB0 B;  1FGY A;  1UNQ A;  2DYN A;  3TO1 A;  3HW2 B;  1RJ2 A;  1V5U A;  1BTN A;  2KGX B;  2YVC A;  2DX1 A;  5L81 A;  2YSZ A;  3GYO A;  1ZYI A;  1ZC4 B;  4K2P A;  2RRF A;  3A58 A;  2COA A;  3NSU A;  1T77 A;  1EVH A;  2MDX A;  2Z14 A;  3KRW A;  4A5K A;  1QQG A;  1IRS A;  1MK9 B;  3G9W A;  5IRS A;  1V61 A;  2YRY A;  5CLQ B;  3SO6 A;  5C16 A;  3ODO A;  2MFQ A;  4OSN A;  2GUM A;  2VRW B;  5CLL B;  1RRP B;  1W1G A;  2KUP A;  2MWN B;  2HTH B;  2AEH A;  4Y94 A;  1K5G B;  5I2M A;  4GN1 A;  4HB3 B;  1U5D A;  1FHW A;  1ZC3 B;  2J0M A;  5J3Q A;  2Z59 A;  2D9Z A;  1P5T A;  2LYD A;  4L1R A;  4Z2N A;  2D2Q A;  1WJ1 A;  2D9X A;  2COF A;  1V88 A;  3PVW A; 
#chains in the Genus database with same CATH homology
 1V5P A;  3TCA A;  2ZPY A;  2UZR A;  4DX9 0;  2PZ1 A;  5EFX A;  2CY5 A;  2D9Y A;  1H4R A;  5C79 A;  2OQB A;  5JLJ B;  3U7D A;  3VOQ A;  2ELB A;  1SHC A;  4HAV B;  1MIX A;  3ODW A;  4MT7 A;  3KSY A;  3TFM A;  1QC6 A;  3MDB C;  5LON B;  4DXA B;  4EJN A;  2KCJ A;  3ULB A;  5D27 A;  2UZS A;  3DXD A;  3PEG A;  1OQN A;  4B6H A;  2ELA A;  4CHJ A;  1H10 A;  2DHJ A;  1XOD A;  4CYE A;  2P0H A;  1NTV A;  5J3T A;  2LG1 A;  1KZG A;  3PP2 A;  5D3W A;  2X18 A;  2DLW A;  4A6K A;  1J0W A;  2EJ8 A;  4CHM A;  2D4Q A;  2Y8F A;  2P0D A;  4L6E A;  1SGH A;  2JP2 A;  2GJY A;  5KCV A;  1P3R A;  3BJI A;  1N3H A;  5DHF B;  1U5E A;  1WGQ A;  1M7R A;  2R0D A;  3RCP A;  1FAO A;  2YT1 A;  2W2X D;  1AQC A;  1W1H A;  2IYB A;  2COC A;  4KHA A;  1GC6 A;  2I5C A;  4IFS A;  4ZRI A;  5D3Y A;  1MIZ B;  3T06 A;  4F7U P;  1NI2 A;  4Z2M B;  3BIN A;  1DRO A;  4XWX A;  2W2W A;  2YS5 A;  2NMB A;  4GXB A;  3AJ4 A;  5FI1 A;  3QBV B;  1U27 A;  2LKO A;  2P0F A;  1X1F A;  1ZM0 A;  3AU5 A;  4GPT B;  4H8S A;  1PLS A;  3TW1 A;  4HAT B;  4HDQ A;  1TXD A;  4BBK A;  1WVH A;  4GZU A;  2K2J A;  3X23 A;  3M1I B;  3PG7 A;  4A6F A;  3PSC A;  4NSW A;  2YT0 A;  3A98 B;  3MPX A;  1J19 A;  2NZ8 B;  4TYZ A;  2DYQ A;  2DHI A;  2DKQ A;  2K00 A;  1W1D A;  1XCG A;  2RUK B;  2DX5 A;  2LOX A;  1P6S A;  4HAX B;  4F7G A;  1MAI A;  2I1K A;  2XQN M;  1WI1 A;  2P8V A;  3QWM A;  5DI9 B;  1OMW A;  1ZSQ A;  4D0N B;  2W2X C;  1MPH A;  2BCJ A;  2Y7B A;  2J59 M;  2VSZ A;  2YF0 A;  1NU2 A;  3ODX A;  1ISN A;  4ZRK A;  3WYF B;  2VKI A;  4GMV A;  1KZ7 A;  3OAN A;  1U5F A;  2GCJ A;  5D3X A;  2COD A;  1NTY A;  2M14 A;  1PMS A;  3PZD A;  3D8F A;  1DYN A;  4DBB A;  4K2O A;  2K2U A;  2DFK A;  4NY0 A;  1LW3 A;  1GC7 A;  2G35 A;  3ULC A;  2EMT A;  3IVF A;  3F0W A;  3LJU X;  2N23 A;  1I7A A;  1X05 A;  4HHV A;  3FM8 C;  2N0Y A;  2ROZ B;  2Q13 A;  4A6H A;  2CAY A;  3SUZ A;  2IFS A;  2H7E A;  1M7E A;  2Z0P A;  2EC1 A;  1U29 A;  1B55 A;  1Q67 A;  5FI0 A;  3KY9 A;  2RLO A;  4WSF A;  1EGX A;  1EF1 A;  2D10 A;  5GOW B;  2D9V A;  3O96 A;  3CIK A;  1UNP A;  5D3V A;  4DX8 A;  5HE0 A;  5C5B B;  4MY6 A;  3UZT A;  1MK7 B;  3GYP A;  3ML4 A;  2GS0 A;  5C6R A;  3P7Z A;  1XX0 A;  4TKN A;  3U8Z A;  1V5M A;  3SYX A;  2R09 A;  1UEF A;  3SV1 A;  1FHX A;  5HE3 A;  5KQ4 A;  1WJM A;  3DXC A;  3D8E A;  3WA0 A;  4C0A A;  3N7C A;  1FOE A;  1BAK A;  2DTC A;  2DKP A;  1UPR A;  2M38 A;  5LOP B;  3A8Q A;  2AL6 A;  2DHK A;  4KHB B;  4IOY X;  4HAU B;  1DBH A;  1X86 A;  3ZVR A;  2HE7 A;  4IAP A;  3PVL A;  5KQ1 A;  2RSG A;  3KZ1 A;  5JP4 A;  3DXE A;  1I2H A;  2H7D A;  1FGZ A;  4F7H A;  2OTX A;  4GMX B;  3VIA A;  1UPQ A;  1DDM A;  3V5W A;  4K17 A;  2CY4 A;  5DHA B;  4PQ0 A;  1XD4 A;  1FHO A;  5JHH A;  4HB4 B;  1Y19 B;  3CXB B;  1UNR A;  3ZDT A;  2L2I A;  1E5W A;  4KAX B;  2QKL A;  4A6F B;  1X11 A;  2Z0O A;  3HQC A;  4EKU A;  5JHG A;  3KRX A;  2DN6 A;  1KI1 B;  2UVM A;  2I5F A;  2LOZ A;  1XKE A;  1FB8 A;  1Z87 A;  2RNR B;  1Y5O A;  1WG7 A;  3F5R A;  3P6A A;  2J0K A;  1BTK A;  2GCL A;  4WVF B;  2D11 A;  1OY2 A;  2ROV A;  1U5G A;  1GG3 A;  2L1C A;  3FEH A;  2EMS A;  1AWE A;  1X1G A;  3QIJ A;  3SNH A;  1DDW A;  1XR0 B;  2LUL A;  2RVB B;  5DH9 B;  1WGU A;  2J0J A;  2RGN B;  5J3Y A;  2D9W A;  2FJL A;  2V76 A;  2YS3 A;  4MK0 A;  1DDV A;  5HE1 A;  1EAZ A;  2I1J A;  2Z0Q A;  1K5D B;  2QKM A;  4ZRJ A;  1PFJ A;  2Y8G A;  4EMO A;  5C5B A;  4HDO A;  4YON A;  4HAY B;  4KVG B;  4HB2 B;  3A8P A;  1TQZ A;  2YS1 A;  5DIF B;  2MKR A;  4K81 A;  3TVV A;  3FSS A;  4P7I A;  2DA0 A;  3AU4 A;  4HAZ B;  1TJ6 A;  5HE2 A;  2CRF A;  1BWN A;  3PVU A;  1LB1 A;  4KHO A;  3D8D A;  1MKE A;  2E2X A;  4PNK A;  4HAW B;  1U2B A;  4YL8 A;  2ADZ A;  4WJ7 A;  1V89 A;  1ZVR A;  3HK0 A;  4HB0 B;  1FGY A;  1UNQ A;  2DYN A;  3TO1 A;  3HW2 B;  1RJ2 A;  1V5U A;  1BTN A;  2KGX B;  2YVC A;  2DX1 A;  5L81 A;  2YSZ A;  3GYO A;  1ZC4 B;  4K2P A;  2COA A;  3NSU A;  1EVH A;  2MDX A;  3KRW A;  4A5K A;  1QQG A;  1IRS A;  1MK9 B;  3G9W A;  1V61 A;  2YRY A;  5CLQ B;  3SO6 A;  5C16 A;  3ODO A;  2MFQ A;  2VRW B;  5CLL B;  1RRP B;  1W1G A;  2KUP A;  2MWN B;  2HTH B;  2AEH A;  4Y94 A;  1K5G B;  4GN1 A;  4HB3 B;  1U5D A;  1FHW A;  1ZC3 B;  2J0M A;  5J3Q A;  2D9Z A;  1P5T A;  2LYD A;  4Z2N A;  2D2Q A;  1WJ1 A;  2D9X A;  2COF A;  1V88 A;  3PVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...