4CKVX

Crystal structure of vegfr-1 domain 2 in presence of zn
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
GRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Biophysical Studies of the Induced Dimerization of Human Vegf R Receptor 1 Binding Domain by Divalent Metals Competing with Vegf-A
pubmed doi rcsb
molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 1
molecule tags Receptor
source organism Homo sapiens
total genus 21
structure length 94
sequence length 94
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ckvX00
4OJFL 2JK5B 1SM3L 1FVDA 4I3RH 4W4NA 1BIHA 4XWOC 5HGAB 3WFHB 4F37F 3WIFB 3MC0A 3MUGB 3RI5F 3VXPA 4M1GL 4Y0GA 4O2EB 3GRWL 5D96C 4WTZG 2ZG2A 3VGGA 1XF3A 2GEEA 4P3DA 4HPYH 4EUPG 1L7TL 3VFOA 4OCYH 4OFDA 2VZ1A 4IDLA 2R39A 2VLKD 1MHPL 4H0HB 5C7XH 3QDGB 1CXEA 3VRJB 1OGAA 3EOTH 4DKFH 1G7QA 5ICXB 3G9VA 4K7FA 4OLVL 4P5MA 1ZHLA 1F8TH 1MCQA 5F3BB 1KGCE 5I1KH 3UX9B 1U8MB 1CT8A 1F90H 1WK0A 4EOWL 3O0RL 2NY4D 2DIBA 1ULVA 1N3NA 1CLOL 4M9OA 4Y19D 4NDMA 5F7HA 2IPKB 1DBML 5C6TL 2NLJB 4G43B 4BJLA 2OJEA 12E8L 5F7NC 1N6QL 5KANG 2VZTA 4L8CB 3CH1A 4E41A 5H94A 5JW4N 4G3YH 4MJIA 5I1JH 4QRQA 1L6XA 3BW9B 4P3CL 4LASL 2Z93A 1D5XA 1MJUL 1U3JA 5E1AA 4XCEB 1PQZB 4UDUB 1IGFL 5DD0L 5FGBC 4JZJB 3X3GL 5E00A 5TGBB 3LKPB 1L0QA 1KTLA 3DVGB 5F1IB 3RIFF 1OOAA 2ZPKH 2AJUL 5D7SH 2ATKA 2IPUK 1F97A 1JNNL 3MV8A 4XCYB 3MGOB 3MRNA 1CICB 3KYKH 1W72H 3AAZA 5HHNB 2BJML 2KKQA 1BQHB 3IDJB 3D3VD 4JKWA 4ZFOL 2CRMA 3EO9H 2H6PB 1KBGH 2CGRL 4JJ5A 4OZHB 1UFUA 4PJ5B 4FMFA 3P4MA 2VB5A 4UI2A 4XNYH 3EYOA 1YUHA 2VLMD 4JB9L 3VRLE 4HWEL 1FVDB 3BZFB 4MWFA 4O9HL 2Q3AA 1N6VA 1YEFH 2Q6WB 2ICEA 3ESVF 3VXPB 3ARTA 5DEZA 2BDNH 3SKOA 4NRZB 2AXFA 4ONHB 3MCKA 3BDYH 1MELA 4IOFC 2C3VB 4PJAB 3NZHH 2V6HA 2ZNWA 3WNKA 4C83B 3VFOB 5CZXC 3DTXA 5KVGH 1HSBA 2OSLB 1B2WL 2A6KA 4MQTB 1K4CA 3QQ9C 5HJ3A 3VI4F 2JJWA 5CIPH 5DT1H 3GBMH 5H8DA 3WL9A 4RGNC 3F58L 1U93A 1YQVH 2VOTA 1EO7A 1G7QB 4RQQB 2F5BL 3W11D 1A22B 5EA0L 3SOBL 2A6JB 4PY8J 4K7FB 4P5MB 5FHAL 3VD5A 3G5VA 1IT9H 5ICZB 1RIVH 1CT8B 4A2LA 3MUY1 4XBPB 4XGZB 1M7DA 4NRYA 1BEYH 3Q1SL 1HCFX 5E56A 5FM4A 1N3NB 4Y1AB 4P2QE 4NDMB 1F4XL 2VR5A 1U58B 2DD8L 2KPNA 4YHYC 5HHOB 4WFFE 4PG9A 1BD2A 4Z7UA 1YMHA 2OJEB 4J3WA 4R6UA 4GH7B 2VQUA 4M7LL 2WAHA 5MERB 5DJ0A 2Y36L 5MEND 4MJIB 5F88A 1KN2H 4PG2C 2Z93B 2V2TA 1D5XB 3Q3GB 3TVMA 1A6TA 5FYJL 5ITFB 5D7KD 3MJ9L 2HWZH 4J3UA 5E08H 3C5ZD 2R4RL 2DI8A 3QNZA 4OLXH 2FJHA 1KTLB 5F9AC 4RMQA 3E6HA 5CFHA 4KUZL 2ATKB 1V05A 2HT4C 3L9RB 3MV8B 3C8HA 5E2WH 2DI7A 3H42L 1OP9A 3KPRE 3MRNB 3WKML 1WWBX 3TCLA 2E7HA 4JJ5B 4YX2L 1FC2D 4DGYH 4U6YA 5L2JA 5GRUH 4NHUA 3U4BL 4WDIB 5EU4A 3P4MB 3KJ4C 1MCNA 1YUHB 4E0RB 2BY0A 1ADQL 5FUZL 4UBDD 5BRZD 3V5DA 4UIKL 2Q8BL 2BCKB 5GRJH 4WV1A 3W9EA 4L3CA 3SKOB 1MVFA 1ZLUK 3MCKB 2WLYA 1FAKT 3TNNA 4MNGE 4BK5A 2QSVA 2R1WA 3DTXB 4PLKD 1RUPL 1MLCA 1K4CB 5HJ3B 1CZ8L 3BZDA 3WL9B 1H3GA 5IVXE 1U93B 5ADPL 4OZIF 3VA2C 1BQLL 2NNAB 1CLZL 3QDME 3VWJD 3K80A 3G5VB 4QRRB 2YN5A 4Q9BA 1R3KA 5GJSL 1M7DB 4NRYB 2OMBA 3EJYC 3S3SA 1S7UA 3MTRA 5F6IB 3Q6FB 3NFNA 5EORL 5EZLB 4PG9B 3TJHD 1BD2B 2CUMA 2VZVA 1YMHB 1CGTA 3CZFB 4GAGL 4JFFA 5I1EH 4S1RH 5LWYL 3W5NA 2FATL 4CNIA 2DF3A 2JCCE 4DAGH 4I0PA 5AWNL 4UTAH 4CW1B 5D7JD 1G6RL 5KVDH 3HA0A 5F88B 1H5BC 2HRPH 4EI6A 4XZUA 4JY6B 3RVUD 4O2CA 3VMNA 2XICA 1WC7A 1UWXH 3MLYL 4JQVA 1T89A 2AK4D 3W82A 2AVGA 4B7LA 2IF7A 2R56L 1MFAL 1CU4L 3SPVA 1N0XH 4L8SB 1G7PA 1A7PH 3PL6D 1MCSA 5JPNA 3TNMA 1F5WA 4XNMA 3GO1L 4MQSB 3ARQA 2BOCA 2X6MA 1K6QL 1MI5D 1IC4H 5DUMH 2P24A 3TCLB 4ZD3H 1DBJL 5IGXL 3O6FD 5DUBA 2PR4H 3OQ3B 4KXZH 3SDYL 3CXHK 1BWMA 3GRWH 1OPGH 5L2JB 4NHUB 1GJIA 3OR7A 4EN3B 5IB4A 1YMMA 1XMWA 3QIUA 1OTTD 4I77L 1L7TH 4I48A 4ZAKD 5EU4B 1TQBB 3BMWA 1S5HA 3CCHB 1MHPH 3VXQA 1WFTA 5ECJE 3I02A 3VA6A 1S78D 1NGQL 1QBBA 2EEAA 4TNWK 3W9EB 4YK4B 3MLUL 4L3CB 4WUKH 1H3VA 1MCIA 1XF4B 4NFBA 3BEVB 4HS3A 1AXTL 4EOWH 2PUQT 1MLCB 4RX4A 5MP6L 4UT6H 4AJ0A 3BOVA 3T09A 3TYGL 5I1HL 1XCTA 4AK1A 3ARYA 3U1SL 4ONOA 1N6QH 3QUYB 5BW7A 1R3KB 1YJDH 2PO6C 1I1RA 1CG9B 3EYUL 1RUKL 1FE8H 4X8JA 3M17A 4X6FA 4KJYA 1VEOA 1S7UB 4NKIH 3MOBL 4IDJL 3NFNB 1P9MA 4Y5VA 2O5XH 4NO3A 1MJUH 3H9HB 2DKMA 4CU8A 4LLQB 3OR6A 4LCWA 2FYYA 4G8EA 5KSAA 1S7TA 3SE3C 4CNIB 5I1GL 4NZRL 5EOTA 3WJJA 2WUCL 1T7YA 5LGHH 4LCCC 2AJUH 1OB1B 4GSDH 5DWUL 2AW2A 2GUOA 2YZ1A 2CDFA 3V8CA 1WC7B 5F3HA 5JQHC 2VMFA 2WUBH 5DJZB 2ZUVA 4LSQL 3FAXA 2R4SL 3MCLL 5JHLL 4X4MA 1RJLA 3SPVB 3ULVD 1Q9LB 1G7PB 5HDQH 2GIYA 2O5YL 5EC2A 5SWZA 5JPNB 3NCYS 1CD1A 4TOYH 1AO7D 4XNMB 5C6PB 3PWPD 5JLZA 4Y4HC 2DKSA 3CC5A 2P24B 5DUBB 1G7JB 1TZIB 3GBNH 3D0VA 4LPVA 1A8JH 4NM8H 3HE7A 3JV6A 3OR7B 5IB4B 1YMMB 3TT1L 4UV4L 4I48B 3SE4C 1S5HB 1VCAA 3O6KH 3VXQB 3I02B 3T0XA 5FYKL 4N0CC 4MB3A 4KZDH 2R0KL 2X4OA 1T5WA 2F5BH 4RCAA 3SOBH 1BVLB 1C5CL 1I7UA 1R3HA 4Z7QF 2EXYC 1I4FB 2D7OA 1JFQL 1I1AB 2P43B 5F1OB 4JRXD 3WDHA 5DUPL 2LU3A 1UM4L 5CJQL 1LK3H 1I7ZA 4KK5D 2ZWLT 3A67H 4Z7NE 2DD8H 4XP1H 5KOMC 3SO3B 1VFBA 3S7GA 1BM3L 3DX6A 5E9DD 4JHBA 3D2UD 4M7LH 3I50L 4X8JB 5GQBA 1KYOJ 2EDDA 4HCRH 4X6FB 2QADB 4PJIE 3VCLB 4KI5E 5E2VH 5E5MA 2X4TA 4HF5L 3GSWA 2IAND 4W70A 3BUYB 4LCWB 4MB5A 2OLDA 5KSAB 4YFLF 1WIPA 3U83A 2R4RH 4BSVA 5EOTB 4IIQC 3I6LD 5F1NA 2B39A 2DWDB 5HHMB 2CKBL 1EO8L 1RZGA 4XWGL 2GUOB 1F3JA 4Q6YA 2CDFB 1P4LA 5KVMC 4RRPG 4RGOL 4YDIH 5DFVD 3AC0A 5C0NC 2W07A 3G6JF 1NBZA 5IM7B 3MFFA 5I73C 4Q0XL 1CIUA 4YX2H 1RJLB 5MI0B 2P44B 3SEPA 1FP5A 1K8IA 3HPLB 4HFUH 1MHHA 5SWZB 3BIKA 2CKNA 3BI9X 3SDCC 3MLWL 1CD1B 4M1CD 5JXAH 2CR3A 3SE8L 4MNHB 1ADQH 3MBED 3N1FC 4YBQD 5JLZB 3CC5B 1S9XB 5EZJA 2X1XR 5HYJA 5DJAB 2A6DA 1EERB 3D0VB 4LHUD 5EU5A 3PQYE 5AYQA 2RGSA 1NFIA 4RA3A 3ROOA 4G6ML 2BSSA 4Q58C 1FNFA 2P5WB 4NN5C 3MLZH 4WFEE 3SGEI 2OX5A 5D8JL 4JG1H 4C56A 2X4OB 4V1DE 1EFQA 1QSED 1T5WB 3S34H 5ADPH 3ILQC 1J87A 3R4DA 4PR5B 1F4AA 2GYSA 1I8MA 3UYOD 5HI3D 3RVXD 5J1SC 2WV3A 1MUJB 3QR2A 1HSAA 4QCIA 3TV3L 1I7ZB 1X9QA 2V5TA 2VUYA 3AM8A 3RDTA 1JE6A 1NC2B 4FS0A 5GGVH 5EORH 4GRWF 5FF6A 1HWHB 5D1ZA 1ZHBA 4WFHE 4GAGH 2FRGP 3DX6B 5LWYH 1WZLA 2F58H 1AJ7L 2A9NH 3IAGC 5K93A 2FX9H 3L5WA 3BAEL 3LQZB 4H88L 1CQYA 3BT2H 2NY2D 5IIEB 1Y6NR 43CAA 3GSWB 1NGZA 1JPSL 4XBGB 4LSVH 5EIVA 3BGFC 1MF2L 2FH6A 3K8MA 2XZAH 2CSPA 3I6KB 1Q8MA 1CU4H 1QKZL 5F96L 1U8KB 3NAAH 4HDIA 5JXEC 2VAAB 3WFCL 3QNYB 1G84A 5T5NG 4QRTA 1FZMA 3ZO0A 2MQ0A 4P2YA 1FPTL 2GTZA 3K8KA 1P4LB 1X44A 1F02I 4YHNB 3LKSA 2NW3B 1A1NA 3GKWL 4Y16B 3BKJH 5KANI 4LP5A 4ZXBA 5IJKA 4QYOA 4AIZA 3R06A 1BJ1H 4S1SH 3MFFB 1X5XA 1K8IB 4MCZA 1MHHB 2VLRD 3BIKB 3T0ED 1XIWA 3QIBA 2IQAB 2B5IC 3VGFA 5EOQH 4NIKB 1VEPA 3QZWA 1W0WA 4HBQA 4JN2B 5E6YA 4WCYH 3GSXA 5HYJB 3TZVD 2PXYD 1NEUA 4ERSH 2A6DB 4NQDD 5FM8A 5EU5B 1LD9A 2P5EE 1OTSD 5IOPA 3UTZA 1BJ8A 1NFIB 4KRPC 1Y18A 4MAYD 1OP3K 4S1DD 2R15A 1MFDL 4G5ZL 4PY8I 1AXTH 5TF1H 1N5YH 1HNFA 1U95A 3UTTE 3UPRA 1OF2A 4G6JH 4JE4B 5MEPB 4D8PB 5MP6H 4C56B 3SKMA 1TPXB 1J9CT 1A7QL 2I9TA 1JNLL 3EHBD 4KKLD 4QHNA 3TYGH 5I1HH 4S1QL 1QR4A 2EZ0C 5E8EB 1BIIA 3WXVH 2X4QA 3N85L 2PYED 4RAVA 3RY6A 4HGMA 4XC3H 4PRPE 1HSAB 4QCIB 1EJ6A 1C7TA 2W0LA 3WYRA 1WUNT 4GMSL 4UNUA 1LE5A 1H15A 5D1ZB 2DB8A 1ZHBB 5I1IH 5K9QG 2MJWA 1DEDA 3CFEB 2EDYA 3E2HC 1CI5A 2BSTA 5I1GH 5EUKB 4XCFH 3OG6B 4N5EC 3S4SA 3THML 1JUFB 3L5WB 4PPTA 5D7IE 4Y5XC 5FKPA 4OLYL 1KC5H 4P4KC 1NGZB 3OXRA 3CU1A 2D7QA 5CKAA 4P2QA 5HY9A 3V7AG 4PRBB 3IDXL 2Z91A 1CGYA 4HDIB 1WTLA 1H8OA 4QRTB 1M6OA 1FZMB 1F2QA 3TIEA 5I8CA 2GTZB 3V52H 3KG5A 2VDOL 3CFIC 5JDJA 2HVJA 3DHJA 1OLZA 1A1NB 3PIQA 4ZXBB 1GGBL 1EEZA 1CE6A 2OR8A 4XWOD 1G9MH 2QV2A 3IFOA 5IUSA 4MCZB 4Z7NF 2BSED 3RU8H 3LIZL 1XIWB 3QIBB 4AH2A 4N9GA 3AS2A 1HHJA 1NGPL 1W0WB 4JRYE 5CD3B 5I1CL 5L6YH 5J12B 4PP2A 5CIPA 3GSXB 1MJ7L 5I1DA 5JMRA 1LD9B 2NY6D 5DQDL 3MLPA 4LPXA 3UTZB 5IOPB 5DJ6A 5D7LD 5L9DH 2BVUA 4KDTC 1DDHA 1DSFH 1VEMA 3ZKSD 5DUPH 3FMGL 3TLRA 4TQEH 3NH7L 3UPRB 5BZDA 1UWGL 2HT3C 3PG2A 1LO3L 2O5ZH 2FHFA 4JZOB 5H37G 3NABL 2I9TB 4KY1L 2BK8A 2ED9A 5I15H 3DMMC 3SCMC 2AAVA 3O6LH 1AY1L 2X4QB 3SGDH 5T1KD 4D0BA 4RAVB 5DK0A 2OTPA 1C5BH 3I50H 5HDOA 2EYSA 1TCMA 4MNGA 4NGHL 3LKRA 4NQEB 4Y4FA 3RUGF 4UTBL 4XNZB 4KMTH 3FFCB 3SGKC 4D3CH 3B5HA 1LE5B 4GW4A 2APVA 4XMLH 5IVXA 1K8DA 4BK4A 4WIQA 3B6SB 2BSTB 1QFWH 1MRCL 2ZOKA 5DD1H 3QDMA 3S4SB 3KYAA 1IM9D 3O3AB 2E27H 3WSQH 4F58H 2A77H 5FKPB 4XC1L 1UG9A 4FZ8H 4YJZL 3ISWA 1W72B 2VXUL 3OXRB 4AENA 4P2QB 4QXGH 3ZDZE 4BH7B 5DGRA 1IGIL 2X4UA 2Z91B 3NACH 4X7SL 1QLRA 4ZFZA 2BNRD 3G5XA 4JDZA 2GITA 5F9WC 2DN7A 4KH2A 2AGJH 2JCCA 2VTFA 4OQTL 5MEOA 3AREC 4HXAL 2VDQL 5E6IA 2HVJB 4FFYL 4YHPA 1MNUH 3BD5A 3BH9A 1EEZB 1CE6B 1KIRA 1ITCA 1CXLA 3IFOB 2DQEL 4MGXA 5HGBA 1LDPL 5FYJD 3BUTA 1OTUC 4NUJB 1IE5A 1Z5LA 1HHJB 4R0LA 1IGTA 4IOFD 4LQ1A 4A2MA 1KENL 5CIPB 1BJ1J 1A3QA 3NGBC 3KPRB 3SQOL 5I1DB 3GSNL 4AEIH 4NN6C 3QQ9D 1KCLA 4LARH 2JJUA 4I3GA 4Q6IA 4RGND 3LEYL 1T4KB 1BBJA 5E8PB 5C2BH 3FB8A 1DDHB 3CXDH 4OM1H 1KG0A 2E9JA 5CZKA 4M6NL 1KCVL 5BZDB 5LCVH 4P99A 5L88H 1TLKA 2VXSH 4EI5A 3QFJE 4MQ7A 3QT2A 3V6BR 1BAFL 3N1PC 4OGAC 3PUCA 2J6EL 5DK0B 1KB5A 4M1DL 4MNGB 3RWGA 5KJRL 3LKRB 3BAEH 2NY0B 3WMSA 1O7SA 2FGWL 3NFSL 3U9UB 2G5RA 4U3CA 1GZPB 5IVXB 5J13C 3B9AA 4XVTL 1K8DB 5LXGL 3TH3T 4JPVH 4Y5YA 2ZOKB 3OGCB 3R1GL 1KPVB 3D3VE 2MOVA 3VG0H 5C9JA 4R7DA 5ENWA 1UZ6E 5DD3L 4PB0L 1JGDA 4AENB 3AROA 3H9ZA 2HT4D 3GKWH 2QQLH 1R5VA 3HC3H 1MCOL 1FZOA 1DUZA 1IFHH 4G6KH 1M05A 4G8GB 3ARDC 4ZFZB 3HKFA 1BF2A 3G5XB 1A64A 4P2OC 3N9GL 2GITB 3QHFL 2JCCB 3O45A 4UAOC 4XP4L 1TJGL 4BZYA 2VDRL 1PKOA 4LLMA 1Q0YH 4DTGH 4GRLA 4NBXB 3VH8A 1LEKB 1KIRB 2X70B 1I7RA 3NTCL 4G42A 4XNQB 5HYQA 1GSMA 3X17A 1HIMH 1Z5LB 4R0LB 4XNUH 1IGTB 3I2CH 5CEZL 3MMEA 3IFLL 2O61B 1FFRA 2DYPB 1W2KT 4LCUA 1OW0A 4U6VL 4XMKL 1ZLWK 4Q6IB 3CSYA 2L7JA 2WIMA 5DJ8A 4X4ZA 3CMOL 3JWDC 7FABH 3FB8B 5IF0A 2NY1B 4M7ZB 1RZKC 1KG0B 1PBYA 2V9RA 3N50A 4K3EL 5IQ7H 2LU7A 4JVUA 1OAQL 5E94A 1BWWA 3UCRA 3EO1B 3KDMA 4GQ9L 4G8IA 4EI5B 1OM3L 4MQ7B 5FIEA 4LNVA 3GI8L 5IVOA 5JW3L 4BUHA 3F7YA 1TETL 5EU6B 2P1YA 3BWAB 2C1OA 5IBTL 5GS2H 1BQSA 4LHQB 1FFPB 4JM2A 1IRAY 3DNKA 1KB5B 1NCDH 3NCMA 1N2RA 1WBZA 5LQBH 1HH6B 1C7SA 3RWGB 3VFGH 1BFVH 2OTWA 3ZKXC 1AH1A 3B9EA 3T65B 2APFA 1XGYL 4FQJL 2FHCA 2BRRH 4OT1L 5FA3A 5CP3H 1X7QA 5ADOL 4WY7H 3DV4B 3C9NA 5A2LH 1KJ3L 3TIDA 3INUH 4X5WB 4R7DB 4X4YB 1FSKB 4KTDH 4PJIA 1T0PB 1JGDB 4R4FH 1R5VB 4U0RC 1XF2A 1FZOB 3WHXB 3SE9L 1J1PL 1A7NL 3JWDL 5DVNA 1RZKL 3CNKA 3EO0A 5KAQG 5CD5C 3O45B 5GGRY 4P23A 3DO7A 4DQOL 4FXLA 3GDBA 4X0KA 3BE1H 5TDOB 3VH8B 4N0UE 3G04A 4G9FD 2Y6SD 2PTTB 2W9DL 1UM5L 1EJOH 1KUMA 3R0MA 4KXZI 4P9HH 1I7RB 3X12A 1JI1A 4G42B 1MHEA 4RISL 3OG4B 5CINL 4LHJB 1CE1H 3MMEB 1J12A 2AJ3B 3NABH 3IDUA 1CVRA 2AEPL 1TMCB 4V2BA 4ODXB 1G1CA 3CSYB 2ESVD 4QGTA 5DJ8B 4KQ3L 3L1OL 5IF0B 1A21A 3QUZA 1KEML 3FL7A 3PQYA 4OIIL 1I75A 5D4QA 2ORBH 5GRXG 3ZDZF 4NGHH 3O4LD 4PYHA 5E94B 4IOIB 4X6DE 1C1EL 2PO6D 3EDEA 4LQFH 4LSDA 4KI1A 1JHLL 2VZSA 1YYML 4ORGB 4PY7A 1RUQL 5D9SA 2JIXA 4V1DA 3U9PL 4N8VA 2EE2A 5FYKD 3T3MF 2OK0H 4NOFA 4NWUH 4JM2B 1I1YA 3KNBB 1CS6A 3O3EB 1DQQA 1N2RB 1WBZB 1I9RH 1HKLH 3V6OE 3HG1D 1P69B 2OTWB 4XC1H 2OYPA 3RPIA 3TA3A 1B0WA 4YHKL 3P11H 4PBXA 2Z92B 1X7QB 1IGIH 3PGCA 4X7SH 5FGRA 5J0BA 2NXZB 5INDA 3C9NB 3OTTA 5IWLC 1CD9B 1P4IL 3T77A 5TDPA 2D31A 3HTLX 4PJIB 4BKLA 5D2NE 1XF2B 1QD0A 4K9EC 4Y4HD 1QFHA 1DBAL 2FL5B 3P0YL 2F19L 5JZ7C 4PV9A 1TZHB 3LD8C 4U1SB 2FECI 3LS4H 4M7KH 5IVZA 1INEL 1SBSL 2BC4A 1NCNA 4P23B 3DO7B 5DSCA 3QI9A 1J0JA 3N0PB 2DDQL 4XPFH 5I8OH 5IB2B 5FCUH 4X0KB 2NQCA 3G04B 1UZ8A 5JA8B 4N0CD 4RSVA 3IDIA 3UTOA 4YEEA 1DP0A 5TQ0L 3CFJA 3BKMH 3QRFM 2EC9U 2EXYD 5BQ7A 1MPAL 3KHOA 4OFPA 4YQXH 2FEEL 3STZA 3DGCR 5B8CA 2BERA 3ZTJH 3EFDL 3MROA 3VXUD 1RZFH 2Z31C 4OSUH 1U91A 4BFEA 1ZXQA 2V7NA 3BPNB 4XAKD 4R26L 1NKRA 2P5EA 3QUZB 3PQYB 2IAMD 4YE4H 5ILTL 1EFXA 1KT2A 2ZOLB 4P5TA 3G6DH 5KS9E 5AUMA 1UACL 1ZA3B 2FGWH 4GXUN 3NFSH 3UTTA 4PY7B 4ODWA 4Q9QH 4DW2L 4G6FB 4PJXE 1I9JL 4ZUTB 4K9EL 4V1DB 1D5IH 1PG7H 1DQJB 5LBSL 1WWCA 5T1MB 3RWCA 3FQUA 4MA3A 2WZPD 3IYLW 4HHAB 4K07A 3IGAA 2ICWA 4RFNC 3CLEL 2DM2A 4UMGA 1AHWB 3RPIB 3S35H 1UM6H 3TA3B 3WUWA 4PRPA 4JDVA 4F2MA 2WP3T 4WGVB 5DS8B 3QCTL 3I3DA 1OT2A 4FQCL 2EICA 3G5ZB 2GK2A 2M2DA 1F4HA 1ITBB 5C0ND 2DQCH 5JOEA 1IAOA 5INDB 2XZQL 3PV6B 4ODVH 3TPUA 4MZ2A 4WI4A 1TJGH 2YPVH 4NWTL 2D31B 5FAAA 5D7IA 2UZXB 1KIUA 5AYUH 3SDCD 4M62H 1MCPL 4BKLB 1K85A 2VE6A 4Q7DA 4PRNA 3HE6C 2CRIA 3MFGB 4YXLH 2NY5C 3GHEH 3KPOA 1JHTB 5DLML 5J1AB 4U7SA 5IVZB 2WBJA 4DK6A 5DEFA 4AEHL 4X6CF 5DSCB 3QI9B 1J18A 2NX5A 3SDXE 3V5HB 2BVQA 3IFLH 3MA9L 3U0TB 1GOGA 4TSCH 4WHTB 2XG4A 1PEZA 3X3FH 5JMOC 3O2VL 2VZOA 4U7MA 4AT6A 5D2LF 3IDIB 5L2KD 1IAMA 3ILQD 4POZC 1M4KA 4K3EH 2HJFB 2CIKB 1HE7A 1Q0XL 5CHNA 5KTEH 5IHUL 5BQ7B 5DMYA 4FXGA 4KVNL 1HWGB 4GQ9H 1FN4A 2MPAH 2COQA 3HC0A 5DMIL 3GI8H 3STZB 4Z7WE 5B8CB 4CN4A 4PGBA 1J1XL 3KWWA 2I07A 1YEIH 2WWMC 2V7NB 1XGUA 1YC8A 3U7WL 4ZOCA 2VLLB 4KRLB 2IANE 1OAZL 2X1QA 1EFXB 4UB0L 3DXAD 4P5TB 3QUMH 2QR0A 3OWEA 5AUMB 1S7VA 3OV6A 3E6FB 5GXBB 4ODWB 4PV8A 1XGYH 1I8LC 4H25A 1HCVA 2YA1A 4H5SA 4MNQE 4D9QE 3I6LE 3DRTA 2BFVL 2VDML 2B1AL 1QSFA 3P4OB 3V4PH 2NY5L 3RWCB 3HFMH 4MA3B 2Y07L 5T3ZL 1XGTB 3IGAB 4OGXL 1IKNC 2ICWB 1J0YA 1KJ3H 1T83C 5FYLL 4A6YA 5JXED 4LLYB 1A7OH 4MHHG 4F2MB 5DMGC 2OI9B 2MCPH 1IEAA 1IEBB 3QA3A 3SE9H 1J1PH 1IAOB 2ITCA 4LCIL 1JYNA 3FB5A 1G7HA 5C0BD 2LV4A 2AJVL 4WNQA 4NNXA 2IWGA 3QUXA 5D7IB 1TXKA 1MVUA 2ARJA 4ZO9A 4OUOA 4J3TA 2VC2H 3KPQA 2VE6B 1KCKA 1H3XA 4PRNB 3ARRA 1UM5H 3MLTA 5D5ME 1TVBB 3S88L 4F3FA 3KPOB 3QG7L 4W4OA 2DQGH 4IMKA 1KIQA 4PJCE 1QSEE 1R3IL 5DEFB 4OCSH 4KRPD 4MJ6A 2BVQB 1UKTA 1AQKH 5BXFA 1N64L 1CDBA 1P7KA 1IKFH 4F8TA 3L3OA 5E2UH 1L6ZA 1NEZB 4ZDHA 3RL2A 4R8WH 4YHLL 1FYTD 2OXGA 1I3GL 5IESH 3T0BA 1CIDA 5ID0B 1KEMH 4JANA 4LSPH 2EZ0D 4HIEB 4APQB 5EZIH 5CHNB 4FXGB 2UYLB 1FN4B 4JRYB 3RIAK 4LRNH 2YPLB 2HFFA 2OM5A 4PGBB 3KWWB 1KCUL 4HS8L 4AMKL 4CL7A 1XGUB 3CDCA 2VH5L 3C5JB 4N0RA 5E24E 3LQAH 4F7MA 4RFEA 4BFIA 3EIFA 4OLUL 2XACC 4N5ED 4NQVA 3BJ91 3MRGA 4PV8B 5DO2C 4H25B 4H5SB 4D9RD 3QFJA 4JDTH 3X14A 3DRTB 4P4KD 1FRGH 3DOSA 5E03A 1UJ3C 1WFNA 3V4VL 1FFOA 4H20H 4A6YB 3RL1A 1DVFB 1HH9B 1P4IH 5HHPA 4K55A 5I74B 4Z7OE 1OAUL 4JQXA 3QA3B 2YC1A 3O4OC 1DBAH 2G5BB 2I5YL 2YWZA 1QLFB 3RKPA 2C4FT 3FB5B 5I8KL 2RCSL 3E3QE 5GS0C 3WHE1 3DGGA 5HGHA 4NNXB 4ODHH 3S37X 1FNEB 4QY8A 4RGMC 3LKNA 3D3VA 2ARJB 3RWEA 1AR2A 3KPQB 4GFTB 4PBVC 2GSGB 3LPGA 3MLTB 4GW1A 3L3DA 5KZCB 3NA9L 4ZUSA 4DOHE 1KIQB 4MYWB 2EH8L 1FIGH 2QQNL 5HBBA 4WJ5A 1X4ZA 1KXQE 4ZOEA 1Z9MA 2JLLA 2V9TA 3L5XH 4G6AC 1OSPH 4HUUA 1M7IA 4L8BA 1P7KB 4X6BA 3NIFF 3GSVA 2HT3D 5KOVC 4HW6A 4ETQA 4KHXL 3ABZA 4TUKH 1XCQB 3MRQB 3HC4L 1F3DJ 4IRJB 2ZUQC 1YPZF 1KXVC 3VU2A 1JPTH 3DMMD 5LGKA 3ULVF 3SCMD 4OUUA 3T2PA 1UWXK 4TSBL 1WZKA 4WW1B 3OKOB 4I5BB 5DTFA 5IBUG 1ZK9A 2J5LC 2J88L 4BFBD 4JFYA 1NLDL 3UO1L 1MH5B 4WUUD 4K94H 5I19L 4NNYA 2HFFB 4KPHL 3T04D 3FRUB 4JVWA 4TVPL 2XYCA 3VXSD 2YD4A 2HN7A 3AB0C 3F7VA 3SGDI 3B8SA 5CS7A 5GS0L 1B4JH 4F7MB 4RFEB 4F9LA 3D6GA 4JY4B 1FVCA 4MA8H 4UNVA 5EU3A 1R0AL 3MRGB 1BHGA 2VQ1A 3QFJB 3F5WB 3VJ6A 1YC7A 1OSZA 1YECH 1VGKA 3MRCB 1QFWI 2VWEC 1ZANL 4FQIL 3HPJB 2W91A 1L7IL 4MS8C 4NWTH 4UV7H 3L7EB 4QOKB 2B0SL 4FTVD 3ARED 1XT5A 4XRCA 5E2TL 1JI2A 5A16A 2YKLL 2W38A 2ADFH 2AV7A 5HGHB 1MLBA 3BP6A 3BMVA 3GJFA 1CQKA 1SVZA 2FCBA 3DYMA 3WBDA 2XY1A 3LKNB 4O5LH 1JV5A 3RWEB 2YMXH 1OTUD 4BYHA 1PYWA 2DICA 5HYIA 5D7LE 2XT1B 3FN3A 3HS0A 4CVZA 3LRHA 3V5KB 1P1ZA 4GW1B 3L3DB 4UOJA 1I9EA 4YXHL 3VXRD 5CZVH 4ZUSB 2OR9H 1MJ8L 4UOW0 2CK0L 4XPGH 2FJFB 3CFBB 3QIWC 4WJ5B 2IG2L 1U0QA 4FQXB 4HUUB 4NO0D 1M7IB 1T0NA 5DMIH 4YWGL 1RQ5A 5IFHH 1NCTA 1J1XH 4ALAL 1CR9H 5F7EL 5IEHB 4ETQB 1DLFH 4N0UA 4YBLB 1GGYA 1JWMA 1KN4L 3GMNA 2DM3A 1LNUB 2ATPA 4OGAD 3VXNA 1GOFA 4UB0H 5DTFB 1IC7H 3QO0A 3K74B 4NNYB 1EEQA 5CEZD 2PYFB 4GKZA 5CLTA 5CP3A 4JKMA 3F7VB 3LPFA 3O2DL 3NIGE 3RTQD 2NY3B 3BHBA 4BZ1L 4HWBL 4E5XB 2R2EB 3HUJF 5IFAL 4BZ2H 4NNPL 1AKJA 1MHCA 1V7NL 3RIAF 2R0LL 3M07A 1INDL 4X6DA 4HPOL 2VQ1B 3MJ6A 3VJ6B 2AKRA 3D39D 1NCAL 1KPRA 1VPOL 1VGKB 5D7JA 3VWKC 2R69L 3S3JA 1JGUL 1U8OA 2OBGA 4PTUB 1MRFH 1AGDA 4L4JA 3ARDD 3V6OA 2IFFL 4LK4A 4P2OD 3RHWF 1I85A 2AK4A 2QSCH 3WDIA 5HSFA 2OS7A 1QBAA 1O7VA 1DANT 1HDMA 2DTML 4OCXL 4LDEB 4XRCB 5A16B 2X40A 3QG7H 1GYAA 4JPKL 2VXTL 3BSZH 2AV7B 8CGTA 1MLBB 3MLSH 5JIKA 4AIOA 4OI9A 3V95A 2IMMA 4XH2A 1JV5B 4RGNE 1MRDL 2HYMA 1MWAA 1CGUA 4LCYA 1NDGA 4R90H 1GRWA 2J4WL 3MRIA 1HQRA 3MXWL 4QRSA 1FL6A 4ZO6A 4LSTL 5D2NA 1JK8B 1KJ2H 4FQHA 4MXWL 4HQQH 5T5FL 4GG6E 1ZAGA 3QPXH 4LSRH 3GSOA 3MO1B 4LLVA 1T0NB 3CDGA 3D85D 4JFXA 2HKHL 4LLDA 5IKCA 1U3HC 2EO1A 4N0UB 4ELMF 4ZPTB 3FFDA 3GMNB 4PD4J 4KVCL 4TULL 5EBMA 1KLFA 2ATPB 2FX8L 4EIZC 1R3JB 2CLVA 4OLUH 3O9WB 1T1ZB 1U2CA 3QO0B 2R2CA 4GBXA 4LAQL 1E28B 1P2CA 3C8KA 3CLFL 5F6HI 4Z7VE 3BHBB 4DVRL 4QHUA 1JRHH 2G75A 3O8XC 2VL4A 1U8PA 4P48A 4EEEA 1AKJB 1MHCB 2YA0A 4X6DB 1MIEL 5KS9A 4H8WC 1D9KB 4X5LA 3V4UL 3IVKA 2AKRB 4JO1H 4F7PA 5C0DA 1DFBH 2L4OA 1F4YL 5GRWA 3JWNC 1U8OB 4IBLT 2F54E 1AGDB 5HD8C 4N0YL 2FSEB 3IXAB 2XN9D 3HI1A 5CD5D 1EIBA 2M1KA 4MX7A 4YPJA 1XR9B 4L4VD 2LAAA 1IBGH 3QEQD 3OBAA 3NA9H 1NL0H 2RHEA 3WO4B 3FB7B 3TGXA 1CFVH 4I3SH 5IQ9A 2CDGB 3X13B 1CDYA 2IQ9L 1A02N 4X5XA 1NBVH 2DBLH 3PWPA 3C6LB 3QJFA 5EB9A 3HZYA 1ZT7A 4XH2B 5I2IB 3KAAA 4M00A 1NDGB 1OWWA 3B9DA 4C4KT 1E6OL 1OP5H 1F2XK 1FL6B 1FO0L 2VXQH 3OZ9H 1IAIH 1QBLH 1U6AH 4WW2B 3SO5A 4GXVH 1Q1JL 5FKAA 3BJLA 2A9ML 3TO4A 3GSOB 4CMMA 4LLVB 4M5ZH 4DN4H 3CDGB 1NLDH 5JPMB 4H8WL 3QSKB 3SDXA 4LLUB 3BPLB 1WFOA 5C08E 5IKCB 5HI5C 4XB8A 4OI8A 4FQ1L 1RD6A 4DGVH 3FFDB 3WS6C 1WBYA 3ARGA 5ETUA 5D6CA 3UTPD 4TSAL 5IMKB 4F15B 1AGFA 3RAJL 5DXWA 5EOCH 4WVRA 1CICC 2VIRA 3D2UA 1EBPA 4GBXB 1P2CB 4MXQC 4Z7WA 4PJ7F 3H3BC 1NC4D 4M6MH 2BSRA 3WN5B 4QHUB 2G75B 1FLRH 3RWIB 1BOGA 1U8PB 1RI8A 1L7IH 2ADJA 3MXVL 4UT9H 4PJBE 2IANA 1ZLSH 3UJIL 5KS9B 1K3ZA 2AABH 4YGVA 4F7PB 4PJXB 5E2TH 3P0VL 4MNQA 5E4EB 1UH4A 2EIZA 3I3BA 5FUCC 1S9YA 5BVPL 4PJEF 1DEEA 1T3FA 5E99H 2D9QB 3OPZL 5T5NF 5JZ7D 3JWOH 4J4PC 2Z35B 4PJHE 3HI1B 3FZUC 4NPYA 1YQ2A 1E4WH 4MX7B 3MRRA 3P77A 1YA5A 1RUMH 4YXHH 4TUOA 1RJYA 3LHPL 5IQ9B 3VFWA 4M5YL 4X5XB 4Y89A 2IPUG 3MBEA 4HLZG 5BMFH 3QJFB 3CFKA 1T1WA 3HCVA 2FLBT 3NIGF 3RNKB 4Y2DC 3C2SA 2DQJL 5TFSL 1BVKB 3GB7B 2X89D 4LHUA 5SV4A 1YDPA 4IM8A 3MYJA 4UU9A 1FL5A 3DUSB 3T2NL 1GH7A 3A6CL 3O4LE 2ZCHL 4HEME 3TM6A 4EBQL 3OJ2C 5IEKA 5D5MA 2Z31D 2ZSWB 2EDFA 4PJCA 3TO4B 4CMMB 4LIQH 3HRPA 4RWYL 1QSEA 3DO3A 5FYKE 4NHCL 3ZYJA 4GUPA 1MY5A 3BDBA 4QXUH 3SDXB 2EYTA 3NBNA 3UTSD 5EPMA 3U36A 2LE9A 5ALCL 1N59B 2ERJC 3O2DH 4OF7A 4UDTA 4QHLB 3LDBB 1MIML 3GEWB 1UYWH 1U92A 1WBYB 3ARGB 5ETUB 1A6ZA 3ET9F 4P9MH 4XPTH 4JG0H 5D6CB 1VHPA 3G9AB 3QCVH 4HPOH 4OKDA 4JN1L 2EIBA 4OB5L 4Z7WB 4LKCB 3H0TA 3WEXA 2A73A 3WIIL 3JVGC 4CJ1A 4AY0A 2ADJB 2I25N 2B8OT 5DQ9A 3V7MA 1KB9K 4EVNA 4WEMB 1WZ1L 4GG6F 3LH2L 2DJ4A 4HJ0C 3VXME 4YGVB 3QAZC 4FN0A 1N8ZA 1ETZA 2JJSA 4NCC2 4MNQB 4C59B 4D0DA 1JWSB 4GT7A 1PGRB 2FLRT 1GPOL 2H1PL 2MHAA 3HE6D 4LIQE 4P4RA 3P4NB 1EK3A 4W68A 1NCBL 5TE7H 3ZT7A 5JR1H 3KJ6H 4R4NC 4NPYB 1DBKH 5T3ZD 1A3RH 2BXZA 2V17H 4N0FB 1NCWH 5FYLD 3LY6A 3OKYA 2OL3H 3MRRB 2J4WH 4ZS7H 2VLRA 3FHQA 2AJZA 4OQ1A 5T5FH 3HNVH 1OAYL 1ZS8B 5IFJA 1ACYL 1JHKH 3VXUE 4POZD 2UUDK 1T1WB 3TZVA 3HCVB 2ZNXA 3EYVA 4Y4KD 5F6IC 4Z7VF 4OD1L 4NQDA 4LHUB 2C3GA 1YDPB 4UU9B 4MAYA 4AL8H 1DBBL 1HNGA 4GAJL 5IEKB 1JZ2A 3JV4B 5D5MB 2CQVA 4TULH 5IW3A 4O4YL 2FX8H 5T3XH 2WWMD 4X6EB 3KPSB 4PJCB 3QUMB 4DUVA 4RAHA 3MV9D 1QSEB 5SWSD 1HEZA 3SBWA 1YEEL 1ZWIA 2EYTB 2JF1A 1S7RA 2NXYB 5EPMB 3QG6A 2XI9A 4HKXA 4HXBL 4HT1L 5I76A 4PJDB 3FB6A 3W9DB 1JJUA 1RUAL 3ZYIA 4FFZL 1A6ZB 1I3UA 5T33H 3PE9A 4HG4J 4L8SC 5L7XL 1KSRA 3AMKA 3PP4H 3S98A 4XVUC 1FNGA 2YD5A 1OT1A 4MD0A 3LZFH 5GGTH 3V4UH 2GI7A 3ZT6A 1D6VL 4OTXH 1LP9B 1Q9KA 5LGJA 2FIKA 1NMAL 3BQUB 4GRMA 3ZL4L 3H0TB 5DMGD 1C5DA 4Z18A 1BGXL 5AG9A 1OD7A 2DOCA 4EN3C 3CFDA 1BQUA 2V2WB 4ISVA 3DSNA 2JB6B 3UC0H 3CDYA 1TQBC 3L3HA 5DQ9B 1BLNA 5F89A 3ARUA 3IKKA 4ZYKB 4WO4C 1N8ZB 4YK4C 5IHZB 5DRZB 4D0DB 1ZHKB 5GS1A 4F7EB 5T3XE 3QCUH 2MHAB 1XGQB 4P4RB 5I16B 3P2TA 2PW2A 1CK0H 4Q9RH 3RPKA 3IETA 1A0QL 1EEUA 4Z9KB 5CBAB 1N5AB 4LVEA 1A6VH 3EYSH 2FB4L 5BVJA 2AJZB 1DN2A 4HUNB 2Q8AH 3WO3B 2ZZUT 3V0VA 4QF1A 3QUYC 1LO0H 1A7RL 2VN4A 1MFBH 4PRIB 3EYVB 2OZ4A 4MDIB 3ZHLA 3GIVA 4GKNA 4OD2A 2QSQA 5D7LA 3NA4A 4RMSA 3GIZL 3R8QA 4ZFOA 2NCMA 1J8HD 2IADB 4DOHB 3FO0H 3OKEB 2LABA 2IJ0C 4Z77A 4JFHD 4ZUUA 5GRVK 3SGJC 3VDCA 3WUZA 5CJXC 2GJJA 1GGCL 2NTFB 1HEZB 1KCRH 1ZWIB 5C0IB 1S7RB 1JN6A 2IALB 3QG6B 4HKXB 4D2NA 2P8PA 5T1KA 5I76B 3H3PH 1B0GB 1T89C 1OAXH 4I2XE 5DO2D 5SWQB 1UADC 2CH8A 4OV5B 4KQ4L 4LVHB 2G9HB 2APWA 4LEOA 4HMDA 4HEPG 4NKOA 1BFOB 5HYFA 4ONGL 3ARVA 2NZ9D 2J8UE 4OZFH 2RIKA 3K2UH 1OVZA 2R9HC 4XPBL 3OSKA 2C7UA 1FZKA 1C5DB 1D7FA 5FGBA 1IM9A 5CSZB 2PKDA 2P49B 3TC9A 1JGLH 3CXHJ 4TVPD 3VFMB 4IRZL 2Q7YB 4GG8A 4NQCE 2D7MA 1S3KH 1BLNB 4NRXB 5GS0D 5F89B 1GAFH 2AI0H 5DRNA 1S8DA 3ZDXF 4PGEB 4FZEH 3WLWC 4NFCA 2HFGH 2XQBL 4X7CC 3PGFL 4XHQA 1OAKL 1I1AC 3VG9B 2PW2B 1K2DB 1TNNA 2X1OA 2GW5A 3DBXA 4NKDB 3CK0H 3WNLA 2DQHH 4XNXH 5ESAA 3SO3C 4G6AD 5CILH 3VGEA 3T2NH 2Y5TA 2O26U 3A6CH 5BVJB 1GHFH 3V0VB 1RZJH 3K1KC 1ZGLA 5HYSG 4R9HA 1QP1A 2XKNA 1QNZL 2CLZA 4MD4B 4RWYH 3MZTA 2QADC 1BF8A 4L9DA 5DVKA 4HZAA 2AEWA 3CD4A 4J6RH 3M8OH 5I30H 1KJVA 2DLEA 4OD2B 3TWCL 3DURA 2DQUL 1NDMA 3P9MA 5M95B 4OCWL 4ZFOB 2O93L 4IRSA 1NAKL 2CK2A 5CCKL 4QRUA 5KSAC 3DUUA 4Z77B 3MNWB 2W0KA 4ZUUB 4GG6A 5C71A 1JWUB 1J7VR 3HMXL 5C09D 3ZYOA 1T21B 4FQ2L 3VFTB 1I8KA 1JN6B 3EGSA 3CFCL 3K0WA 3DLQR 2P8PB 2YBRA 5DD6A 2UVFA 2XQYG 3ZDYF 4GMTH 3I75B 5MI0C 2R1XB 2ADIB 3CPLA 3U2SA 5JHDD 5JOPD 2I60H 4NKOB 1RZIA 3UTQA 3ZE1E 3LEVH 3DV6A 1T80A 3I9GL 3QEUB 4PG2A 5ACZA 4MS8D 4D9LH 3LV3B 1ZTXH 4IMLA 1FZKB 1NMCB 2AJSH 4HIJA 5C0CD 1GPOH 1HN1A 1X5IA 3B9KB 4Z7VA 3DVFA 5M7QA 3GSQA 3FQNA 5DMKA 3M1BA 2ZCLH 3AS3A 4EJ1C 3C5ZC 5C0FA 5JO5A 4UT7L 3RBSA 3VW3L 3VI3E 4BSJA 1Z3GH 2H26A 3NIDE 3P40A 4PRAA 1EMTH 2PTVA 4R4BA 5DRXA 5J11C 3IU3A 1MAML 1RMFH 4P5KB 1ACYH 3RZCB 1QRKA 3ARZA 3G5YB 3WXWL 2E8YA 1OGAE 4N1HB 1G6RA 2F54A 2D7TH 1KEGL 1RZ7L 3MACH 4YR6A 4MMXC 4JLRA 5FB8A 4JFOA 4Z95L 4QXTA 5IMOA 2LU4A 6FABL 5B38A 1ZGLB 1CDGA 1QUNA 5E8OA 2CLZB 2UWEE 3VFUA 2NYYC 3B5TA 4DEPB 3GSUA 1KJVB 4HXBH 4HWZA 1BECA 3DURB 4HH8A 3P9MB 2FJGA 4IRSB 5IROC 2AP2A 4OZFG 4QRUB 1XZ0B 5MEQA 3RGVD 3DUUB 1RUAH 3U7YH 4YDKL 3ZKQD 1RK1A 3F12A 1I8KB 4PJGE 4PRHD 4X7EC 3CSPA 3DRQA 3DX8A 3GKZA 4NSKB 3RJDA 4S11A 2YBRB 4U6XA 4Y16C 4HWUA 5C08A 1FBIH 1NFDF 2CDEA 4M7JL 1KOAA 4M43L 3AFLA 4Z0XA 4FP8H 3U2SB 3P9LA 5K59F 1RZIB 4FQQA 3UTQB 4YXKL 4F8QA 3VWKD 3RFZC 3TJHC 1H5BA 2VDNL 1DQMH 1A7BA 4JPWH 3V6ZA 3SKUD 2R29H 2D7PA 4I0CC 4IMLB 4JR9L 2FO1A 4OM0L 5F7DB 1R24A 2I27N 4QHKI 1BQHG 1S7SA 4XAWL 4MQXC 5LAXA 3PHQB 4NZTL 3FKUS 1NQBA 4G7YL 5J1TC 4PJBA 4XX1G 3WFEH 5ICYA 3W81A 1TPXC 3WFBL 1A5FL 1KELL 4PJ9A 4JFDE 3PL6C 2F53D 3MREA 2FZ3A 3X11A 4R4BB 5DRXB 4XXDA 3N06B 1BJMA 3B2VL 5JQ6L 1AGBA 2OXHA 3ULSB 2UZYB 5A3IC 2F54B 3O6FC 2DM7A 4G9FA 1J05A 4YHML 3TT3L 3AM8C 4M8VA 4JLRB 4BQ8A 5FB8B 5JW4M 3PXHA 5C0AD 3L6FA 4JFOB 5D1ZC 4QXTB 4ZTOH 3KR3L 5CSGA 2J8UF 5B38B 4Z78A 1GC1C 3RWHA 5FO8A 1A6UL 5HHQA 4K8RC 5IB5A 4UINL 5CEZE 5I18L 4XP5L 3VFUB 3L95A 5DJXA 4KJQC 5C07D 3REWA 3GSUB 3W39A 4HWZB 4JM4L 3UDWA 3QWOB 2CJUL 5MEQB 3HNTL 3O4LA 2EE3A 2X4PA 5B39A 3ZE0F 3BP4A 3F12B 3O8XD 4TTDC 5GISL 5TDNA 1B0RA 2ICCA 3DRQB 3DX8B 4FNLH 4ZMAT 1TFHA 2YD3A 4ZXBC 5C08B 2CDEB 2IMNA 3C60B 3HG1A 2HTKC 3SE3A 1JRHI 3BN3B 1XIWC 4FQQB 4LCCA 5I8EA 1BBDH 4ONFL 1H5BB 2I24N 4NJAL 5HD8D 1BX2B 3JZ7A 5EC1A 3F7QA 3QDGD 1A47A 1R24B 3T4AA 2XQBH 2FX7H 2EDOA 1GC1L 4XT1C 1JPFB 4U31A 4K8RL 1WISA 5LAXB 4UILH 5I71B 3BYTA 3DSFH 3QQ3B 3HLAA 4PJBB 5ICYB 3LQMA 2CMRL 3VGAC 1HHGA 4PJ9B 5GRZA 4X4XA 3VXMA 4WU7B 3WIHL 2EDHA 5HDBF 2BP3A 3FCTA 2FZ3B 4X9HA 1U8NA 4XXDB 4LMQE 2VDLL 5CGMA 3E8UL 4K3DL 3RY6C 3VGBA 1QNZH 3VMPA 2AEIT 3B43A 1X5AA 3IKCA 4JJHA 4ZODA 1TJIL 5EZOH 2CKBA 3DX9A 2H9GA 5KVFH 4HIIA 4PJHB 4XNZC 4KK8C 2YD7A 4AIXA 4LOUD 3TH2T 3L6FB 4H1LA 4OCWH 3SJVE 1IAII 2WLZA 4Z78B 5HI5D 5HHQB 5FO8B 2X4SB 4HPYL 5ID1B 1CXHA 4OCYL 1MFNA 2MKLC 3KVQA 3VXUA 4FQ2H 3EOTL 1PG7X 3W39B 1I9IH 1PY4A 4JFFE 4DKFL 3MGAA 5KSVA 5DHVA 2I26N 2ZKHL 1F8TL 1CICD 3O4LB 1F90L 2X4PB 4MXQD 4CU6A 3MRJA 3S35X 5B39B 3RY5A 3VI3F 4BELD 1IAKB 4L29A 3NIDF 5J3HC 3LRGA 1B0RB 4KAQH 4PJ5D 5GSVB 4PJ8B 2W0FB 3MR9A 1UCBH 4L4TD 2XN9E 3K1DA 1F11A 4IIQA 2PCPA 4L4VE 4L1HA 4G3YL 1T0MA 4LRIA 5I1JL 5ALBH 3VFVA 3RJQB 2ZCKH 3MV11 4J4PD 5EC1B 1MY7A 3FZUD 4BSWA 1JVKA 3UJTH 4QEGA 3DROA 3L7FB 2ZPKL 4LNRA 5M94B 3SDCA 1I1CA 2DQFB 3HLAB 5D7SL 3WXWH 1P5VA 4MJ2A 2YRLA 1RZ7H 2GJ6D 3IFPB 4JO3H 3KYKL 5C0GB 1W72L 2FD6H 1HHGB 2LVEA 2H2PC 3VXMB 4U1GC 4Y1AD 1IZKA 5I0DA 3TO2A 3FCTB 1U8NB 1ZA6A 1KLUA 3REVB 5HHOD 3EDFA 4KK6C 3IKCB 4XNYL 2FR4A 5EU7E 2X4NA 3D1MC 3DX9B 1B4RA 4HIIB 3TEUA 4X8XA 3Q2CA 2BDNL 5L2KA 4MJID 1NCCL 5BJTA 1TCRA 1AE6H 4H1LB 4OFYD 2ED8A 5C6WH 3LN4A 1JPGB 3NZHL 5F9JB 4YZFF 5GZOC 2A0LC 2KDGA 3KPNA 5KVGL 1PG7W 1S7QA 1UXWA 2VABB 3OKLB 2F9BT 5DT1L 3GBML 5TQ2H 4FXKA 1FDLH 3O3DB 3S97C 5BOZG 4O2FB 5KSVB 1SEBA 3MV8D 5HI3C 3SDAA 1DQLH 1ONQA 1X5FA 4M7JH 1IAIM 5BOPA 1RIVL 3OF6D 4GS7C 25C8H 3MRJB 5DK2A 1GOHA 5BV7B 4KJWD 1AXSA 3EOBA 4YXKH 1FV1A 3QULA 2D0GA 1EAPA 3VE0B 5D1XC 4RWHA 2SEBA 4PD4K 4HJ0D 3VI4E 4KTEH 1MEXH 5JXEA 5ISZB 3BO8A 1RJZB 4IIQB 2PCPB 4NZTH 4R0LC 5K9OA 3VFVB 1KN2L 3BP5A 2H2SC 2OL3B 1JNHB 2J8UA 4R4ND 2HWZL 1VESA 5IHBA 1CBVH 4ENEC 5E08L 1ZHNA 5C0BA 3HB3C 2YD6A 4OLXL 2AS5M 1FHGA 4AM0A 2NY1C 4M7ZC 5HPOA 1U8QA 3SDCB 3HRZA 3P73A 2M8XA 5CUSH 1UEMA 4QRRD 5E2WL 3RZWA 1ACZA 4NQCA 2F8XC 1HI6A 3ULUH 1RHFA 3TT3H 4JAMA 1EO5A 2HRLA 5CP7A 4QTHA 4MD5A 4O02H 4DGYL 3TO2B 1ZA6B 1KLUB 3UTSE 4UINH 1BD2D 2W59A 2FR4B 5AEAA 3OKDA 5T1DH 1AD9A 3T1FB 3L3IB 4W6YB 5GRJL 1U8LA 3MRMA 1FYTA 1KPUB 3OXSA 5HYSB 4U1JB 3RNQA 5BJTB 1LMKA 3FQWA 1N4XH 4OGYH 3KPNB 3LOWA 5CJ8A 1S7QB 1UXWB 2WINA 2WM0A 2CLRB 1AGEA 1BZ7A 1RURH 1FSKC 4FXKB 4XVUD 1EGJA 4NN7B 1SEBB 4KKCC 3SDAB 5KSBE 2G60H 2NZIA 2DWEA 3F8UB 5DK2B 3O81A 1AXSB 2AJYH 2A74B 1FV1B 1G7MA 3RX7A 5DRWA 4MXVF 4Y5XA 4EN3D 4P4KA 1EAPB 4TVSa 5FOBA 1WAAF 4YHOH 5GGSY 3VFRA 2SEBB 4LSSH 5E8DH 4WO4D 5I1EL 3N1QC 1T03H 2VSDA 3SKNA 4M03A 5MHSE 4I2XB 5T3ZE 3BO8B 3NCEB 4DAGL 1KB5L 1AFVL 5FYLE 4UTAL 5TH2A 4CBPA 4OZIE 4X7FC 5KVDL 5K9OB 2HRPL 5FDWA 3BP5B 5CBEA 2B4CH 1MREH 3ALPA 4KZEH 1ZHNB 1ZGLP 1X5HA 3UYRL 1FCGA 3TPKA 3GMMA 1N0XL 1A7PL 1YJDC 2IFGA 3PWVA 1U8QB 3P73B 1TJIH 3QUYD 4NQCB 1HI6B 3WDJA 4JAMB 5DUML 1IC4L 3WFZA 2LQRA 4ZD3L 5CP7B 3NCFB 2PR4L 4MD5B 1OPGL 1C16A 1BOYA 4L3EE 5HTSA 4KDTA 1K4DA 5JW4R 5DR5L 4FMKA 3B2UD 3OKDB 2NY6C 1AD9B 5CEXA 1U8LB 1HYSC 4M7LT 1T66C 3CIQA 3MRMB 5IK3A 3IJYA 4OZGE 2ZKHH 5ELIA 4WUKL 3SCMA 4WWKB 1HXYB 1JGEA 2NXZC 4YC2B 2Y25A 1A1OA 2WINB 3KXFE 1P6FA 1AGEB 4UT6L 1BZ7B 5FUOH 2UWEA 3AMLA 2X05A 4OZFB 4HV8A 4KI5C 1WT5C 4BH8A 3GSNA 4ZO7A 2OMNA 5ITBL 2NY7H 4TYUA 1TTGA 1YJDL 2R9HD 1FE8L 4XPAL 2DLGA 2GTWB 1FFQA 1W0VA 2MQCA 4NKIL 4P23C 3D0LA 4U2YA 2O5XL 5FOBB 4ZTPH 1IL1A 2RR3A 4PJGA 3VFRB 2XPGB 5C8JB 4NT6A 4OLWH 1CD8A 3KYOA 1MCHA 1FORH 5TH2B 5F44A 3WLWD 5LGHL 4GSDL 5GSRA 1X5JA 5IJVA 1I1AD 3A0OA 4I9WD 5FDWB 5CBEB 2X4RA 5E1HB 5C0RH 2WUBL 3DETC 5AD0A 4RX4D 1HQ4A 2P8LB 1KFAH 2AXGA 5DFWH 4MJ4A 4DN3L 3GMMB 4F33A 4NQUA 3OJDB 1SYSB 2FECL 3PWVB 5HDQL 3QUZC 1LE9A 4TOYL 2B7DT 3G6AA 2WBWB 5C92A 3RVVC 3T8XA 3VGDA 2QADD 1NCCH 5T1LA 4JFHE 3GBNL 3UPCA 3WE6A 4NM8L 4JFDA 1A14H 1C16B 1XF3B 4P3DB 1K4DB 5J56B 1MJJA 4LCWD 4NO0A 1EX0A 3O6KL 1JF6A 5KSAD 1AHWC 4KZDL 3TA3C 2CPCA 1OGAB 5IK3B 3IJYB 1ZHLB 2IBGA 2HG5A 3PWNA 1DN0A 1F42A 3IFNH 4AEFA 1LK3L 3FHAA 3A67L 2UWEB 5SWZD 4XP1L 4TVPE 4NM4H 3BKYH 4BH8B 1KV3A 1ED3A 3L3KA 2KZWA 2XA8H 2HVKA 4PB9L 1J0ZA 4U1LA 3VMOA 3CH1B 4E41B 5H94B 1CFBA 4HCRL 4Z7QE 1WLHA 3CJJA 1OP5K 5E2VL 1U8JA 1P4BH 4Q74A 4QRQB 5IG7A 4JFQA 1IL1B 2P5WD 4PJGB 5E1AB 4ZNEE 4FG6C 1RIUL 2EYRA 3W0WD 4NT6B 3TBTA 5EUOF 5E00B 2QHRH 4HG4K 3WJLC 1PAMA 3LPWA 1LEIA 4P2OA 5EH1A 5IJVB 1WEJL 2OQJA 4WI3A 4DZBA 1SJXA 2X4RB 3AAZB 4RMVA 4YDIL 5E2JA 3TCXA 1CTNA 2BZDA 3QZWG 1CD0A 4NQXA 4Z0BH 2IPTH 1HQ4B 2ILLA 2AXGB 5GS3A 1NC2D 4HFUL 4NCC1 2HAZA 4J3OC 3BGMA 3HI5H 5JXAL 1TTFA 3EYOB 32C2A 4IHOA 3D18A 5KSBF 3MRHA 4MWFB 1LK2A 2ICEB 2NYYD 4NKQB 2AXFB 5T1LB 5GGRA 4ZFFA 2XXCB 4NN6B 1Z9LA 4N90D 3WE6B 4JFDB 5JUEH 1CXIA 3G6JE 1MJJB 4N68A 1SJVA 3E1F1 3D85A 3K2MC 1HSBB 3MLZL 3LSOA 4HK0A 1F00I 2A6KB 2ID5A 2P42B 2BVOA 4JG1L 2OJZH 3FOMA 4P46C 5GGUA 1WJ3A 4LU5H 3S34L 3MUZ1 2OI9C 5JHDE 5CGTA 5E7BA 2E7BA 4CVXA 3SJVA 2VKWA 3MNVA 4ZUVA 4Y16D 1I1FA 1QRNE 5F1KC 3ARBC 3BKCH 1U42A 4QTIL 3S4SG 5KW9H 1JGVH 5GGVL 4H26A 4CN6A 4ODSH 5DQJA 1ED3B 3L3KB 4Z7UB 2WSKA 1QHOA 4PFEA 4DFHA 1WCQA 4FQLH 4RZCA 4U3HA 2HVKB 5HYJD 2F58L 5TE4H 1KB5H 1AFVH 2A9NL 4OI7A 5DJ0B 4P2RE 1PJ9A 2FX9L 5GGVY 1U8JB 1YEKL 3BT2L 4MQXD 1D5MA 2V2TB 3TVMB 4UNTA 1A6TB 2FBJH 4LSVL 3NZ8A 2XZAL 3RQ3A 4KHTH 1DLHA 3UYRH 4C56D 4HJJL 3QNZB 3NAAL 2FJHB 3E6HB 4GRWE 3IU4H 3KLAA 2XN9A 4P2OB 2X5PA 1A6WH 4APQC 3GNMH 2OQJB 3ELAT 4OZGF 4DZBB 1IGYA 4Q97A 3KPTA 4L4VA 3OKNA 3V2AR 1EVUA 5A3ID 1X5ZA 3BKJL 1GIGH 4HKZA 1X5LA 2EEDA 2HKFH 4S1SL 4HSQA 4U6YB 4LPUA 4JO2H 3TN0A 2BMKA 3BGMB 2W9EH 5D1ZD 3DI2B 3CSGA 5EOQL 32C2B 5DR5H 2J1KA 1UENA 2Y6SC 3MX0A 3V5DB 4WCYL 4K8RD 1OWRM 1LK2B 1K5NA 4WV1B 5FO9A 1FGVH 4ERSL 4ZFFB 4KJQD 1T1YA 3WNMA 3TNNB 3QDJE 3B5GA 2R1WB 1BP3B 3P0GB 4PRHE 4RBPK 4YDLB 4F57L 5TF1L 1N5YL 3BYYA 3LSOB 4LAJH 4HK0B 1DVFC 4G6JL 3BDXA 2EH7H 3FOMB 3MRLA 5I74C 2DQIL 4WHDA 2B1HH 4TTDD 1CFNA 3MUJA 3OAYH 3WXVL 5ITBH 1G9MC 1QA9A 4CVXB 3SJVB 1H3PH 4ZXBD 4XPAH 4XC3L 4CU7A 4K3GA 2YR3A 3ARXA 4LMQI 2D4DA 2HTKD 3ZKXB 4PJFF 3ARPA 1XIWD 3QIBD 4KDWA 4H26B 1ZSDA 5EBWA 1H0DA 1LEGA 5I1IL 4JFFB 5CJOH 1H3WM 1FNSH 4RZCB 4XCFL 4W4OC 4IMKC 4I0PB 4X80H 5DD5H 2YZ8A 5IBLD 2BXYA 1WGOA 4EI6B 4XZUB 1KC5L 4O2CB 1D5MB 4U6HA 2XTJB 1FZJA 3NZ8B 2ZUYA 2HT2D 4U0RB 1WITA 4DN3H 2VLJE 2LTQB 1VADA 3R8BB 4IRJC 1YEHH 3KLAB 4JY5H 3TNMB 3AXLA 1NSNH 1IGYB 3VFSA 3V52L 3LRSA 2BOCB 3OKNB 3W2DH 2LAGB 3IAQA 1FJ1A 4HKZB 4NQED 2VAJA 1CFQA 4LGRB 1ZOXA 4NFDA 4MAUH 2WW8A 5L8KB 1G9ML 3MLRH 4WI7A 4KK8D 3FFCD 3TN0B 3C6SA 3QIUB 2BMKB 5F9OH 3RU8L 1IGCH 4WGWB 2X89A 4HAGA 4FQPA 5L6YL 2FO4A 5FO9B 1XFPA 1OLLA 4NO5A 2VDPL 3TP4A 1T1YB 2Z31A 2ITDA 3HI6H 4P3WA 1EHNA 1ZEAL 5L9DL 2XQYK 3OL2A 4HS3B 4EZMA 4P2QD 1DSFL 1JPST 3BGAA 4TQEL 4WFFD 3MJGX 3UTSA 2O5ZL 4LBEA 3MRLB 5EUOA 3L5HA 3GMRA 3QQ4A 1XEDA 5J3HD 5I15L 1OL0A 1XCTB 1F58H 1CFNB 1EBAA 3O6LL 3U79A 2KUTA 2IAMC 3C2AH 1G1YA 3STBA 4PB9H 1C5BL 4YDJA 1QEWA 1YEDA 4P49A 3M17B 3DJ9A 4KJYB 4WEBL 2YRPA 5I6XC 4HGKC 4PGCA 3QDGE 4Y5VB 4KMTL 2VDKH 4NO3B 4D3CL 1ZSDB 3OR6B 4XMLL 2QJDA 1RIUH 2FYYB 1F4WH 4G8EB 1S7TB 5KSBA 1QFWL 2XKSA 5DD1L 3KPRD 1RK0A 2E27L 1IC5L 3WSQL 1UWEL 1VACA 2A77L 4F58L 1WEJH 1UB6A 4Z76A 4FZ8L 1S9WA 1ZLVH 1B6DA 4FQXC 4U6HB 5F3HB 4KV5F 2XRAL 4YFEA 1FZJB 2DLHA 4X9GA 4QXGL 1U8IA 3RUGE 3HE6A 3NACL 1EXUA 4YBLC 5A2JH 3G08A 5EC2B 1MFCH 3VH8G 3LD8B 2H2PD 4FABH 2YEZA 2AGJL 4KUCD 4JKPH 3VFSB 4OZIA 3FO1A 4KK6D 3JBG7 4TRPL 1MNUL 5F7FA 1LO4H 1CFQB 3IS0X 2NY0D 1INQA 1H8NA 3HE7B 3JV6B 1MCCA 3C6SB 4XHJC 3H9SE 3V9FA 5F93C 1EVTC 2NY3C 5D70H 2E3VA 4JGMA 2XWTA 4F7CA 5GZOD 1SEQH 2A0LD 2YUWA 5EG6C 4NO5B 4AEIL 1R3HB 1I7UB 4LARL 2ITDB 4MA7H 4I4WA 3MV01 5C2BL 2V2XA 3JTTA 3CXDL 4OM1L 5SWSA 1AIFA 4L3EA 5LCVL 2MWCA 5L88L 4QTIH 3F6LA 1T2QH 4G8GD 4LBEB 2VXSL 4TNWF 3QDHA 2Y06H 4L4TE 3QRGH 1I7TA 3GMRB 3QQ4B 1VFBB 4PREA 4M4RA 3UBXA 5A1AA 3UJJH 5IV2A 3RVTC 3AS0A 4GKOA 1MCWM 1P7QA 5D1XD 5FUCE 3K4DA 4OZGA 1YEDB 3K46A 1TJHL 4CGTA 1T83A 4X98A 3CAFA 5E5UB 1YEKH 5E5MB 2X4TB 4PGCB 4LPWA 4J3XA 3KXFA 2PTUA 5EN2A 3UAJC 4JPVL 5GGQL 2H2SD 5IMMA 4HJJH 2DYPD 3CSBA 4BSVB 2GJ6E 5L0QB 3EKCA 5F1NB 4ENED 1RK0B 4XPHH 3HB3D 1LO2H 1RZGB 3VG0L 1F3JB 1ZV5A 3T3PF 1S9WB 2MNUA 2NY1D 2YA2A 4GJTB 4Y1AE 3U30B 2K7QA 2QQLL 5GRVL 5HHOE 1U8IB 1NBZB 3HC3L 1IFHL 4G6KL 2XZCL 4EI5D 1EXUB 5EU6D 4QRPE 5K9JL 1DL7H 2XV6B 4YUEH 2A38A 3OMZA 3QEGH 4OZIB 2IEPA 3O9WC 4YAQA 5EZJB 2MMXA 4DTGL 1Q0YL 2R0ZH 4TTGA 3RWDA 3OKKA 5LJYH 1FAIH 2C26A 3EFFA 4M48H 1INQB 3NPZB 2V7HA 4G80A 3ROOB 5KN5A 2BSSB 2E8ZA 1HIML 4F57H 5EO9A 2VNCA 4XNUL 4DCQA 3I2CL 3QEHA 2XWTB 1T1XA 1JF1A 4B7IA 5CAYB 5BO1H 2DQIH 4LSUH 5DF0A 4R7NA 3D5OF 1D9KC 5J4MA 1QFUH 5DMJB 3MA7A 3O2WH 4I4WB 5BS0E 2EEBA 7FABL 1I8MB 2V2XB 3JTTB 1CTOA 3CMGA 4KKCD 5IQ7L 8FABA 4L3EB 1Y0LA 1A9BA 1AC6A 3BWUC 2ZSVA 4NZUL 4PREB 3RDTB 4KTYA 3UBXB 2Z8VC 1MFEH 5IV2B 5FF6B 4LL9A 4GQPH 1PSKH 3ORJA 1P7QB 1E4XL 3AGVA 4P9HC 5TPWH 2BY2A 1NCDL 4ODUA 1YEJL 5KVEH 1UC6A 4FOMA 5LQBL 3VFGL 1UVQA 3C6LC 1BFVL 2Q87A 3KXFB 43CAB 1VDGA 5EN2B 4IS6A 3VXOA 2BRRL 5IMMB 5DC0A 3FT2A 4WY7L 1YNKH 4B5EA 4WW2C 2NX5E 3INUL 4XP9H 4A6YH 5I66A 1C08A 1T7VA 5DEGA 2DTSA 4KTDL 3LKSB 4R4FL 5FECA 1IGMH 4QYOB 4AIZB 3R06B 3PNWA 3K3QA 4UZGA 4GXUM 4O58H 4ZNEA 2N1KA 4GLRH 3QQNA 1Q38A 1V3KA 2RJMA 3QZWB 4J1UA 2UY7A 4JM2D 4YHIA 4HFWA 4TPRH 3CUPA 1RHHA 4F15C 5ESVA 4FFWC 3BE1L 4QXWA 3OKKB 2VDPH 2ENSA 1SY6A 1EJOL 4GBXC 3Q5YA 1UB5A 1HYSD 5DJ2A 4NQSA 4G80B 4P9HL 1T66D 1Y18B 1ZEAH 5KN5B 4JKKA 3NPSC 1U3YA 3WN5C 2E7CA 5KSUA 1U95B 1CE1L 1OF2B 3QEHB 1IQWH 1S9KC 3SKMB 1CFSA 1CL7H 1T1XB 1S9VA 2NXZD 3O3BA 1QSFE 4QHNB 1HZHH 2ADGA 3MA7B 1YNLH 4CMHB 1CFTA 3HAEH 1BIIB 1MCEA 1TITA 1A1MA 4KI5D 5E4EC 2ORBL 8FABB 5CLWA 5D93B 3G6JA 4WEBH 2ZSVB 4LQFL 3DARA 5JORA 4XBEH 2CD0A 1H15B 2R23A 4P23D 1P53A 1B3JA 3U4AA 2OK0L 4NWUL 3V6FA 4K3JH 5JHDA 2WK2A 4ODUB 5D1QC 3HZKA 1I9RL 1HKLL 4B50A 2E9WA 1IC5H 1UWEH 1QRNA 1Q94A 3HR5A 4KMLB 3P11L 2XRAH 4R2GB 1E6JH 4IS6B 2DQTH 4KU1A 4AYFA 5HY9B 2EDKA 1ND0A 3FT2B 3DETD 3FQXA 1M6OB 2YD8A 1PLGH 3TIEB 1IEHA 3OAUH 5I8CB 1T22A 1C08B 1U36A 3T3ME 4F9PC 4HUXA 4P2RA 3RWJA 3TO4C 2A83A 4OFVA 4OZHF 1OHQA 3QUZD 4RA0C 3PQYD 5FECB 3TBSA 1CGSL 4XMPL 3PIQB 4TRPH 2KH2B 2JELH 1JIBA 3DVNA 3PNWB 3RVVD 5E70A 3PWJA 2ICWJ 2VLKE 4WFED 1P84K 4K71C 3LDBC 4G6FD 1YYLH 3LS4L 4M7KL 4V1DD 4AH2B 1NEZG 4N9GB 3QIWA 4PS4H 4YHIB 1LGVA 4PP2B 4HFWB 3CUPB 1RHHB 3QXTA 4XPFL 5DVOA 5FCUL 5ESVB 3AUVA 3OX8A 5I8OL 3T4YA 1OARH 4PJAF 3O6ML 2NPLX 3TA3D 4PRDA 5JIHA 5DJ6B 2PN5A 1HHIA 4Y19E 3BKML 5KSUB 1AP2A 3ZYZA 1S9VB 2J5LB 4YQXL 1IZJA 1I3RA 3GHBH 2YUXA 3S96A 4OFIA 2ADGB 1RZFL 4MCYA 4OSUL 1CFTB 4F37K 4PGJA 1A1MB 1QO3A 15C8H 4D0BB 4ACPA 1NGYA 4EQ3A 1TJHH 2DQDH 2EYSB 1TZGH 3QDJA 2RB8A 4YE4L 3G6JB 4Y4FB 4PRHA 3FQRA 3G6DL 5IB3A 1SJEA 3RTQC 4N1EA 4Q9QL 4GW4B 3LMJH 4K7PH 1D5IL 1PG7L 5GGQH 2GT9A 4KGJA 5JHDB 4K2UH 3QDMB 2AXJA 4FG6D 2BRQA 4XVJH 1QRNB 3S35L 1UM6L 1Q94B 3LN5A 3BPOB 2C3HA 3QUKA 3CVIH 3DYPA 2X4UB 2QKIA 2XZCH 1ND0B 2VLME 1QLRB 2DQCL 5L8JB 3FQXB 4JDZB 4ODVL 5I75B 5K9JH 2GFBA 2Z4QA 4U1HA 4DJMA 5MEOB 4HUXB 2YPVL 4P2RB 1KCSH 5E6IB 1TIUA 5AYUL 4M62L 1GGUA 3TBSB 4YHPB 1EFXD 3BH9B 5HPMA 1WCBA 2YS4A 1O0VA 5TE6H 3PWJB 4YXLL 6CGTA 3GHEL 1D5BA 4EUPH 5HGBB 1T5XA 3TYFA 4BQ9A 3Q6GL 2VLJA 5C70A 3GJFH 1RULH 3HZVA 3QIWB 4GRWB 3FOLA 3RIFK 3MRKA 4KWUA 3GGWA 3OX8B 3T4YB 1QYGH 1FNLA 4TSCL 4YDVA 3X3FL 4XVSH 2C5DC 1JNJA 4P46D 4PRDB 1U3HA 3CH8A 2CUHA 1BBJB 3BQUC 5IT2H 3DI3B 1EHXA 1A6PA 3H3KA 1AP2B 5KTEL 1VFOA 2W1NA 2VISA 4NZUH 4K3HA 4OLZH 2MPAL 2VXVH 3N1MC 4Y2OA 1CCZA 3ARBD 1KB9J 5JNYA 5AAMA 1OY3B 1I8IA 4MCYB 4X6CE 5MENE 1YEIL 4HIXH 1E4XH 2R1YA 3WD5H 1NGYB 1FO0A 1YEJH 3QDJB 3O8XA 3T1WA 2P5WE 5D2LE 5D7KE 2L0DA 3STLA 3FQRB 4Z7UF 3QUML 1CF8H 3W0WE 5IB3B 3IXTA 2ZG1A 3H6JA 1SJEB 4ZOBA 1TENA 1FGNH 3WFHA 4ZFGH 3BEWA 2GT9B 4Y5YB 3V4PL 3IDMA 3MUGA 3HFML 1EZVX 4J3VA 5C9JB 4U1IA 1A7OL 3E3QC 5F21B 5ENWB 3N1GC 3U0WH 1HYRC 3GI9H 4APQD 1X5KA 3QDGA 2MCPL 3VRJA 5EIQA 2C3WA 3MRPA 1ORSA 1DUZB 4NC1C 1M05B 4JRYD 4L9LC 3O11A 4PUBL 4QT5A 3B9VA 5ICXA 2YPLD 5BRZE 1WZMA 5CSBA 2NR6C 3LQAC 1U8MA 2Z4QB 2AJXH 4EXKA 3FAWA 2VC2L 4LLMB 4GRLB 5HPMB 1PEWA 1S7WA 2IC2A 2IPKA 1S5IL 1UQSA 2DQGL 1YEGH 3TYFB 3RUGA 4LVHC 2VLJB 5ERWA 4RFOL 4BQ6A 5HYQB 3MOAH 1RPQA 3B3IA 3HZVB 4NP4H 4OCSL 3MRKB 3GGWB 1AQKL 4DZ8A 1MWAH 4LCUB 1IKFL 1UA6H 4YDVB 1DVFD 3BW9A 5E2UL 4R8WL 1U3HB 3F62A 3PJSA 2CXGA 5IESL 4LSPL 5EWIH 3JV0A 3WS6A 5EZIL 5TGBA 3H9SA 3DIFA 2VISB 3DVGA 5F1IA 2AK1H 2XIDA 3KDMB 4G8IB 4HC1H 1XH3A 5D6DC 4LRNL 3F7YB 1CICA 2C1OB 1D3CA 5HHNA 5DZOA 3EDKA 4RDQG 1UH3A 4G9DA 3QISA 5CKGA 3NCCB 4KK9C 3LQAL 4LF3A 4ZS6C 2V5RA 4PJ5A 3STLB 3VG9C 2AK4E 3GK8H 1V7MH 4OD3H 2YD9A 1FH5H 3IXTB 1A3LH 2HA1A 4OLEA 2YUZA 4L4TA 2E9BA 3BZFA 4JDTL 3BEWB 5FA3B 2Q6WA 3IDMB 3C08H 1FRGL 4QO1A 4NRZA 4ONHA 3QXUA 4XP6H 1QOKA 3QXDA 2FHBA 1MI5E 3TIDB 4U6TA 2B2XH 4H20L 2HTLC 2C3VA 4I1NB 1NKOA 4PJAA 4U1IB 3BESR 4C83A 5B3JF 4IRJD 4J4PA 2OSLA 1CGSH 4XMPH 4K94C 1J1OL 4AQ1B 1FCCA 3MRPB 1ORSB 2VYRE 4RQQA 3O11B 4QT5B 3EO0B 2A6JA 3K81A 5ICZA 1XGRA 4LVOC 2GJ6A 4ODHL 4XBPA 4XGZA 1MCWW 2RQ8A 4Y2DA 2UVEA 4Z8FH 4Y1AA 1S7WB 1U58A 3O6MH 1UQSB 3ULVH 3GM8A 5HHOA 3X12B 1RU9H 3OB8A 1MHEB 3RUGB 3P4LA 3HMWH 5ERWB 3T0AA 3QFJD 1A4JA 3B3IB 1FIGL 1MCDA 1T04A 1C12A 5MERA 3ARFA 1E4KA 1DQDL 1KNOA 1V3LA 4QRPA 3L5XL 1OSPL 4DZ8B 1SVCP 5JW4Q 4OFYA 2MTPA 3MUHL 1RFDH 4R96A 3Q3GA 3PJSB 4TUKL 5ITFA 5IW1A 4QOKD 1NMCC 2V5MA 1JPTL 1NMBH 1B88A 3H9SB 3DIFB 3LS5H 3B9KC 1F6LL 3PP3H 1XH3B 2LVCA 3D9AH 3L9RA 2OZ4L 4K94L 1NPUA 4IJ3C 5H35A 5D9SB 2JIXB 4I18A 4N8VB 5DGQA 3OF6A 5FM5O 1I1YB 1E27A 4G9DB 1DQQB 3NIFE 4U2ZA 5BS0A 1CDHA 1B4JL 3JVGA 2V9QA 4LF3B 4MMZC 3RZCC 2FEDC 4WDIA 4MA8L 1BZ9A 5CMAA 2P47B 4P59H 1YPZE 3ULVE 4E0RA 1Y6MR 5F6HJ 2XKUA 4L4TB 3S37H 3PDGA 3JV5A 2BCKA 4CDGC 3PGCB 1AO7E 1YECL 4FQXD 3PWPE 2UZIH 4W6XB 3QXDB 1N7MH 5JOFA 3T77B 1RZ8A 4NQEE 5TDPB 4JHWH 4UV7L 3FRPA 2VO5A 3FFCE 1QLEH 3SKJH 5GJTH 4LKXA 4HBCH 4DEPC 1RIHH 2DL2A 2R8SH 4LEXH 4PV9B 3S36H 2ADFL 4IRSC 2NNAA 4DGIH 3Q6GH 5IMLA 3KPMA 3I6GA 4QRRA 1XGRB 2BC4B 2GJ6B 4HJGA 4XHJD 4O5LL 2NY3D 2YMXL 1NAMA 4Y2DB 3Q6FA 4JFZL 1UZ8B 3BRFA 4JRXE 3FT4A 5CZVL 3HNSL 2OR9L 5EZLA 2XG5A 5FHBH 3CFJB 3CZFA 1KTRL 4XPGL 1J5OH 1A4JB 4C54A 4Y4KC 1T04B 3ZTNH 1C12B 3ARFB 1KNOB 4QRPB 4MLIA 4CW1A 2XOTA 3TBWA 1F6AA 5E9DE 3IDYB 2EDNA 5IFHL 4JY6A 4AEEA 3MROB 4R96B 2DAVA 4X9FA 1CR9L 1U91B 1DLFL 2ERJB 5IW1B 1MCRA 1UKQA 2P5EB 3RVTD 3WLBA 1EHAA 3KPPA 4EQ2A 2J2ZA 2K1MA 1KT2B 4L8SA 5CEYA 5EIIA 4ZSOE 1IC7L 4WI5A 4XI5C 3UTTB 5H35B 1NUFA 5DVMA 4I18B 2W60A 1RJCA 5SX4I 1VA9A 1WQVT 2N4IA 5D71H 2ARWA 1E27B 3FQUB 1M71A 2IBZX 1J0IA 5BS0B 3UAJD 4BZ2L 1ZVHA 4V2CB 4EN3A 4YHZH 3SDDC 5CMAB 1BZ9B 5DA0B 1YZZA 2N7AA 4PRPB 3WUWB 4JDVB 3GFUA 5J6GA 3CCHA 1G9NH 3NCJH 3WFDH 2IGFH 4WO4A 1VERA 4XXCC 2YK1L 5C3TA 3QAZB 5E95B 5HVFB 1HINH 4PUBH 3ULUF 4OCNC 4GAFB 3TPUB 5JOFB 1XF4A 4QGYA 3S5LA 2ICWI 3BN9C 5GS2D 1TVDA 1RZ8B 3BEVA 1MRFL 2P7TA 2Q3ZA 3MODL 5J89A 2QSCL 3HUJE 4LKXB 1ZT4A 3R0NA 1S5IH 3IS1X 3O9WD 4ODTH 4NC2B 3OJVC 2V5YA 3BSZL 5IMLB 3ZTJG 4RFOH 3KPMB 3I6GB 4J8RA 2WBJB 1Q72H 3MLSL 3QUYA 1CG9A 4HJGB 2NX5B 2A1WH 1CXFA 2HLAA 1NAMB 2UV3A 2FBOJ 4R90L 4AG4L 1AKJD 4AT6B 3PWUA 3HAEA 3FT4B 4G7VH 3H9HA 1PFCA 2R2BA 3QP3A 4LLQA 4MA1C 1KJ2L 2DIAA 2R0WH 4G8GE 4HQQL 5DURB 1D9KD 3C60C 2VLKA 4MVBC 3UXFA 4PGDA 3UZQA 3QPXL 3ME0A 3RVWC 5FOJA 3SGJA 4LSRL 3TBWB 1F6AB 5CJXA 3HC0B 5DHYA 5AAWA 1OB1A 1X3DA 3CVHA 1QBMH 2B20A 1HHKA 2I07B 3MV7D 3A6BL 2MKWA 5DJZA 4HULB 4M6OH 1EHLH 2KQMA 3WLBB 3KPPB 1Q9LA 4Y19A 2DJSA 5CEYB 5EIIB 5I71C 2QR0B 3Q5OA 1N6UA 4LPTA 1S7VB 4OJFH 5A2FA 4KROB 1SM3H 3C6LD 1QSFB 2W60B 4PJ9C 4M1GH 3KYMA 1M71B 1G7JA 1TZIA 1QZ1A 1JRHL 2J8OA 2NZ9C 3ZHKA 2KBGA 4ELME 3HMXA 5ESQA 4KJPC 5J6GB 4WO4B 2VLRE 1J1OH 1IEAB 5EU6E 3T0EE 1SBBA 4X9IA 4JO1L 1DFBL 2ITCB 1BVLA 4OCRL 4OLVH 1G7HB 1I4FA 3S5LB 3BD3A 4WNQB 1I1AA 2P7TB 3QUXB 1G7IA 1GGIL 1B90A 4NQDE 2Y4SA 5C3LD 1MVUB 3O0RH 5FEBA 1SYVA 1CLOH 1ZT4B 1F3RB 1DBMH 1IBGL 5C6TH 3UDWC 4FFWD 1NL0L 4F3FB 2M26A 3AY4A 2D0FA 2JE8A 3PABA 1CFVL 4I3SL 4LHUG 3MJ8A 4GLRI 1FYHB 12E8H 1F13A 1DJSA 1NBVL 2DBLL 4J8RB 4GBXD 1DQDH 2EDLA 4JHAL 4MJ6B 5BXFB 2EDTA 2HLAB 1LHZA 3JSSA 2PYEE 3VCLA 4C55A 4P3CH 1HILA 3L3OB 2H32H 4LASH 3PWUB 4ZDHB 3RL2B 3HAEB 4PJ8C 2R2BB 3BUYA 1LVEA 2VXQL 3OZ9L 3QYCA 1IAIL 1QBLL 2DL9A 4KKNA 1U6AL 1IGFH 3QXVA 5DD0H 2VLKB 4JANB 4GXVL 3VRLF 3X3GH 4PGDB 4PLOB 4M5ZL 4NJ9L 2BHYA 2DWDA 3JWOC 5DHYB 4DN4L 1CL7I 2OZ4H 3CVHB 1JNNH 1HHKB 2C4FU 4HLJA 3UZVB 4U0QB 2BJMH 4DGVL 1U8HA 2CGRH 5IM7A 2NY4B 1T6VN 4MLSA 3KS0H 4TNVK 4BFIB 4Y19B 3DYOA 3HPLA 4NQVB 5D1QD 1MAKA 3P9WB 4MNHA 4JB9H 1OQOA 4HWEH 5EOCL 3X14B 4O9HH 1CLYL 1S9XA 5DJAA 3KYMB 4X6CA 5MENA 4M6ML 5SX5H 3IRPX 1FFOB 5E8NA 1FLRL 3RL1B 5F9DC 5HHPB 4UT9L 2P5WA 5ESQB 1ZLSL 5D2LA 1B2WH 3W0WA 4YBHA 2AABL 3C5ZA 4WTZA 3TO4D 2YC1B 3F58H 5GIRA 5EA0H 4CUCA 4EUPA 4LGSB 4PR5A 2QQQA 5FHAH 2XTLA 3DGGB 4LLAA 4IEFB 3PDDA 5E99L 4PJ7E 1G7IB 4QY8B 3JWOL 1MUJA 3D3VB 3OAYK 3Q1SH 3ARGD 1SYVB 1E4WL 2E7MA 4JFZH 5J57B 2ICES 1F4XH 1RUML 3SY0A 1NC2A 3PF2A 1BFSA 3HNSH 3PABB 3MJ8B 4HK3J 2IBBA 5BMFL 3UYPA 5F8RC 5BRZA 4X9BA 5BV7C 1CXKA 2Y36H 1CYGA 4L8BB 5DJCA 4X6BB 3LQZA 4AZ8A 5A2KH 1RV6X 1HILB 4PJEE 5IIEA 3GSVB 2HLFC 4XBGA 5FYJH 3MJ9H 3MLVL 5IROA 4CAGA 3QXAA 4OUUB 3I6KA 3S8WA 4HMCA 3V0WL 1U8KA 2FGZA 2VAAA