4CL7A

Crystal structure of vegfr-1 domain 2 in presence of cobalt
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
RPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Biophysical Studies of the Induced Dimerization of Human Vegf R Receptor 1 Binding Domain by Divalent Metals Competing with Vegf-A
pubmed doi rcsb
molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 1
molecule tags Receptor
source organism Homo sapiens
total genus 18
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cl7A00
3NN8A 2QV2A 4PTUB 3EYVB 3UTSB 4NPYB 3VFGH 2DN7A 3AB0B 1U3JA 1JF1B 1O5DT 3PQYE 2EC8A 4U1NB 3BQUA 1MJ7H 1L7TL 1R3IH 4W81A 3VRLE 1MQKL 5ICXB 3U7WH 2OR9L 1N8ZB 3OKNB 4JO2L 2O5ZH 3HPLA 3FQRB 3PL6C 2F5AH 1BFOB 5ENWB 5HGDA 5EU6B 3KR3L 9CGTA 5AG8A 1SM3L 5J1SC 2EEAA 4M8QB 3MXWL 3HCVA 3LKQA 4CUCA 4YGVB 1NKOA 2XQBH 5IMMA 2VQTA 1BBJB 5DWUH 5GJTL 4G8IA 1MRDL 1A1NB 4X5XB 4OZIA 3QCTL 3ZKXC 3WV0A 1HK6A 3RKPA 3BXNB 2ERJB 4D9LH 1NAMB 1T03L 1F11B 3K4DA 2X44D 3T77A 3WE6A 1I3GH 1KENL 1Z9SA 4KK9D 3HZVB 2KPNA 1QZ1A 3F62A 4MCZB 4Z7VB 3SQBA 2UV3A 3VGFA 3HNSH 2NLJB 3W0WD 2ED8A 1VKXA 3O8XD 3DO7A 4QHUB 3V5DB 3TT3L 4Y5VA 1KOAA 3P4OA 3BZDA 3K2MC 5C0CE 4OI9A 4P57A 1JTPA 1Z0NA 4P46D 3RPKA 3CFDA 4LPCA 1HI6B 5D5MF 5ERWA 4ZUWB 5KSAA 2A6JB 3TJEH 4OZ4B 2I60L 1N7ML 2OXGA 1G84A 3BT2L 4ZQKB 4LIQH 5EDXA 5D7SL 3D18B 2IGFL 4M7LL 3MRPA 5GGSA 5I9QB 3U0WL 5FGBA 1EH9A 2PF6A 1AQKL 2NY6D 4YE4H 2E27L 5EZLB 3QZWG 4JY6B 5CSZB 3QQ9C 3MUGB 1A6VH 3H9SE 4H88L 4U1MB 3U0TA 3FZUD 4R4NC 1XF4A 3BVNA 1A3RL 4WIQA 1CS6A 4LARL 2PO6A 3KJ4B 2QADD 3HA0A 4ODSH 1KEGH 3BZ4A 3QJFB 4JLRA 3VXNB 4PJDE 1X7QB 3G6JF 4ONOA 1A7BA 4K7FB 3JTSB 5DA0B 2OBGA 2NCMA 1JGEB 3H7BB 3OKLB 5E9DA 4IRJD 3HS0B 4K3JH 4GW5A 4OZHE 2OK0L 2HA1A 1F6AA 1I8KA 3RJQB 2XZCL 1DDHB 1TQBB 3SDXA 5IT2L 3L3HB 3EJJX 5EBMA 4AIXA 1RQ5A 1RZGA 3TIEB 1EA9C 5EZJB 3AXLB 5IJKC 1LE9B 4XMKL 3L95B 5SV4A 3QFJD 3WIHA 5E8DH 4JEGB 4XP1L 3RZWA 3EYSL 3EZ8A 5L2KD 3BMVA 5KW9H 5LJYH 4FQHB 4OD2A 4QOKE 1CXFA 3GJEB 3X14B 2B20A 1CTOA 3HB3C 1M7IA 4H1LA 2WINA 5E2VL 4CN6A 5C0JB 1MHHB 4DUXA 4WI5A 2A83B 4NGHH 2FWOA 5FA4A 3T0DA 4UDTA 3LPFA 4X6EB 3IS1X 2VISA 1F02I 3BD3A 1IC4L 4OM1H 1J05B 1F90H 3ULUD 4OGAC 12E8H 1S7UA 4K3HA 4HJGB 3MQIA 3QDJB 1NBZA 4XNZB 1S9YB 3VJ6A 3NA4A 3S35X 2WP3O 3BIKA 3OV6A 2FEEI 1EZVX 1QVOB 2APXA 4U1JB 4J6RL 1N0XL 2Z31D 2AJXL 1RU9L 4U1IB 3QNZA 1QRND 4KROC 4FA8A 1L7IL 2P42B 3STLA 3HI6H 4FQJH 4LBEB 5SWZE 3VWKB 1H3PH 1QSEA 2D4FA 4GUPB 2LAAA 3HMWH 3GKZA 4YH6A 1C12B 3DSFH 4TPRH 4QXTA 4TSBH 4HC1L 1QLRA 3BIAX 1QFUL 1ZEAH 1T22A 1PAMA 2YA2A 1I3RA 4KJQC 4PJIB 1KN2L 4FNLL 3VI4E 1VPOH 4XAKD 4DKAA 3UTZA 1VFAA 4UBDD 4WUUA 4S1QH 3MV7E 3QEGL 4JREC 3S4SG 3T1FA 1D5XA 5IFJB 2VXTH 4LLMA 4U0RB 3MSPA 3MNWB 3FFCA 3VWJC 4PLOB 2YKLL 3QO0A 43C9B 1H9VA 5DC4B 2ARJA 1QP1A 1YEEL 1ADQH 4U3HA 5HHNA 1INDL 1A7RL 3WFCH 5DD5H 4D0DA 5SWSB 4CW1B 2PTVA 2OMNA 2CIIA 2PW1B 3LQAL 3GI8L 2MTPA 2V7NA 4L8BA 4JZOB 4GRLD 1M7DB 4MAYC 1IEBB 1S7SB 4YHIB 4X4YB 2WBJB 4U3CA 5C09E 3MRRA 3CU1A 4HUUA 4L8SC 3BX7C 2BNQA 3UAJD 1BJ8A 4YHMH 5C0GB 5F9OH 3RHWF 1KFAL 1CYGA 1H3GA 4O02H 3QP3A 1KJMA 5J9PA 4ORGA 3SCMC 1A6UL 1KCUH 3ZDZE 3TBWA 4P3CH 1BVLB 5AD0A 3LHPH 2X4RA 2H8PA 2AXGB 5H2BB 5DRXB 4CNIB 5EO0B 4PTUA 5HI5C 3EYVA 4J3OC 3CVIL 3UTSA 4NPYA 2J4WL 1VGKB 5IG7B 1BEYL 1JF1A 1MIML 3C5ZD 3OG4B 4U1NA 5HJ3B 3DVIA 3UTPD 5ICXA 4HBCL 3F65A 4APQD 1N8ZA 2IMMA 3OKNA 3FQRA 1BJ1J 4DW2H 4OF3A 5ENWA 5EU6A 1YY9C 4Z6AT 4M8QA 2DQDH 5E03A 2FGWH 4U05A 4C56B 2APVA 4YGVA 4LHUD 1QUNA 1BBJA 1RFDL 2VLKD 3LEYL 1E6JL 4UT7H 5BV7H 2OM5A 3EO0B 3FAWA 1A1NA 4X5XA 4XCYB 3RPIA 1MCEA 4K55A 4M5YL 1JYWA 3V6OA 1A6ZA 3BJ91 3WIFB 5F96H 3JWNC 1NAMA 1F11A 4HHAB 2QSCH 3RFZC 3U30B 5CFHA 5EORL 5ID0A 4KY1H 4DN3H 1GC1L 2AABH 3HZVA 2ZPKL 4Z7VA 4MCZA 1J8KA 4G9FE 5L6YH 2F58H 3TH3T 4KHTL 2QQKH 5F6HI 2NLJA 3WJJC 1QFWM 4UI2A 4R4BB 4MNQB 4NO0D 3VFVB 1A4KB 3V5DA 4IMKC 3QI9C 4HUVB 3BWAB 2YN5A 3V9FA 1NLDL 4KK8C 1HI6A 4ZUWA 1MHEB 3NZHL 1UKQA 2A6JA 3P0VL 1L0QA 4OZ4A 5CJQL 3FN3A 1QFOA 2NY5H 5A3ID 4ZQKA 4Z0XB 3WFZA 3D18A 5J11C 3T0EC 2L7UA 4QWWD 3D48R 3P9MA 4KJYB 2GSIB 5FCSH 1J18A 3QCVH 5FF6B 1NFDE 1Z9OA 4KTDL 4G8EB 5EZLA 2AGJH 3K1DA 4AIZB 4JY6A 3BGFC 5CSZA 3MUGA 3MOBL 4U1MA 2QQLH 1ZXQA 3O81A 1T1WB 4L4TE 4N90D 3WXWL 1HKLL 2OTUA 3TO4D 5J8OA 3QJFA 3VXNA 1U3ZA 1X7QA 2VLJE 3LPGA 4K7FA 3JTSA 2VLRD 2BCKB 1JGEA 3QEHB 4PJCB 3H7BA 3OKLA 3TWCL 3HS0A 3MLXH 3MV8B 4DFHA 5KVDL 5ISZB 4FTVE 3RU8L 1TTUA 5M7QA 1CD9B 1DDHA 5EUOB 1RIVL 3L3HA 5D7LA 3HAEH 2XPGA 3TIEA 5EZJA 3AXLA 1F45A 4G8GD 4WFFE 1EAJA 3P73B 1WEJL 5IFAH 1LE9A 2AEIT 3D2UD 3ZDXE 1DUYB 1W0VB 3DV6A 2XRAH 4FQHA 3ARDD 2NX5E 3D0VB 3GJEA 3X14A 4MJIE 5C0JA 4KRPB 1MHHA 2VITB 2A83A 4TVPD 4DK6A 2WQRA 4X6EA 1CBVH 2FD6H 1HHIB 1J05A 4JFFD 3K8LA 2CDEB 1UADC 4HJGA 1CDUA 3QDJA 2A6DB 1YN7B 1S9YA 3P77B 2BNRE 5MP6L 5L9DL 4TTGA 1XR8B 1QVOA 2OX5A 4U1JA 2PXYD 3GSOB 3BDYL 4WUKH 4NYLB 1KPRB 2YXFA 3MLUL 1NFKA 4LBEA 4FQ1L 3VWKA 5IIEB 1RK1B 4GUPA 3DGCR 4K23H 4UV7H 3ULVD 1GGBH 3NAAL 4JFED 4XNYL 1C12A 4WY7H 3EYQD 4JM4L 25C8L 4PPTA 2B39A 3GKWL 5I8CB 1NPUA 2N7AA 4PJIA 4XCFH 5DXWA 4UT6H 4HKXA 2BFVH 2D7TL 2W0PA 4YUEH 5JIHA 4TTDC 3SGKC 4E9LA 1JPTL 5IFJA 4S1RL 3KXFB 3L1OH 3MNWA 4UQ3B 4LSRH 4JY5H 3E0GA 1KCKA 1OTSD 4POZD 3WIIL 5E56A 4YFLF 1FNEB 1R5VB 5DA4A 1Z3GH 4FFVC 1U3HA 2EYTB 5DMGC 5SWSA 4CW1A 4C4KT 2PW1A 1PSKH 4PY8I 1U2CA 4JZOA 1M7DA 4RGMC 4ELME 4ZAKC 1IEBA 1S7SA 4WGWB 4YHIA 4LEXH 3RNQB 2WBJA 4X4YA 3RDTA 5JIIA 1WT5A 2MHAB 5C0GA 5I1LB 4TQEL 3QAZC 3QRGL 4MDIB 5T3ZD 4YEEA 1M4KA 2GIYA 3GBLA 2FSEB 2LTQC 1NL0L 2PN5A 5DEZA 1G1YA 3EHBD 1IMHC 4NP4H 3MRNB 4QRQB 2AXGA 5DZNA 5DRXA 1FQ9C 2YD1A 5EO0A 5H2BA 4CNIA 5BW7A 1JFQH 1BGXH 1FFNB 3RWFB 4MLSA 2HKFH 1INEH 1VGKA 5IG7A 2A9NH 3QG7H 2UWEF 1CDHA 5JMOC 2R15A 5HJ3A 5HHOD 1AFVL 2J5LC 4UILH 4LSPL 1AO7B 3TBYB 1Z0MA 2VDKH 4YBLB 4TSCH 1KUMA 4C56A 4EN3D 4FQIL 1YMME 2BVQB 4DCQB 2P8MB 2FBOJ 1B6UA 5DS8B 1YEFH 4WWKC 5B4MD 3EO0A 4OCSL 4RMVA 5I1HL 3G9VA 4XCYA 2CIKB 3A0OA 2FATL 4NWTL 4ORZC 2GJ6D 1BLNB 3SDDC 2V5TA 3KPLB 4HHAA 4LNRB 4NWUH 4TNWF 5DJAB 1FZKB 1BAFH 1AXSB 4V1DB 5IW1B 3E3QC 1QYGH 3DV4A 1RV6X 3MNZB 1I1AB 1LEGB 5K9QG 3ALWA 2HLAA 5D4QA 3UXFA 1MCLA 4HAFA 4PJEE 3EOAB 1DEEB 3CUPB 3OPZH 4R4BA 3PXHA 1CGTA 1PX4A 4HH9B 4MNQA 1FFPB 4F9PA 2D0FA 3VFVA 1A4KA 2B0SL 4NQTA 2W1NA 3HG1B 5FCUH 2CQVA 4JG1L 1TVHB 3W0WB 3LEVL 4HUVA 3BWAA 3O8XB 4WGVB 4PRDB 1IEAB 1DVFD 3QXWA 1MHEA 4JGJA 1OLLA 4P46B 5HGBB 1H8OA 4KGLA 1UEYA 4Z0XA 4MA7L 1DANT 1YUHB 5GZNC 2Y07L 5FUOH 3SJVE 4KJYA 2GSIA 5CCKH 5FF6A 4YBHA 5LWYH 2YD9A 1JNJA 1YPZE 3L5JA 2H9GB 4G8EA 2ILLA 4AIZA 5JOPE 2BMKB 2XWTB 2Z91A 3BJLA 2NY6B 5GQBA 1T1WA 2EE3A 3JV6B 1IGIH 2VLLB 5E2UH 4JPKL 3UO1L 2FECL 1S9VB 5JOEA 4PD4K 3Q6GL 4TULH 3QZWB 2CLRB 1WSST 1P9MA 5FO7B 1RZ7L 5IB2B 4KU1A 2BCKA 2QADB 4PJCA 3QEHA 3FQUB 2A9MH 4L4VE 3AMLA 4LCIL 3MV8A 2GEEA 5ISZA 4ZD3L 1MCCA 2YSSB 3FT2B 1T20B 4A6YB 4YXKH 4O9HH 3TFKD 4HJJH 1S9KC 5EUOA 2F53D 4IRJB 2L4OA 4HFUL 3CSYB 3LZFH 3K3QA 4DJMA 4N5ED 3W9EB 4KJWC 1LEKA 2NY3C 3P73A 1N6QH 4YXHH 4DTGH 4AMKL 2Y06H 1DUYA 1W0VA 4PD4J 4I3RL 2R1WB 4GS7C 3OKMB 3BKYL 2NY5C 3QFJB 3D0VA 5TFSH 1J1OH 4JFHE 4PBWD 1BREA 3GK8L 4ERSH 3BSZH 2VITA 3LOWA 3TYFA 1FYTE 4LCYB 4X7EC 4N0UB 2DKMA 3SKMB 5E0QA 3DX9B 2LV4A 3MCG1 2CDEA 3TT1H 4Z7UB 3MUHL 1MRCH 2A6DA 1YN7A 3PHOB 4GAGL 3P77A 2D0GA 1A6WL 1SEQH 1T7ZA 4WHYH 3T1WA 3VFOB 3TP4A 2V2XB 4YHPA 2E7HA 3GSOA 4GRWB 4DK3A 1HYRC 3O9WC 4NYLA 4JAMB 3RWCB 1KPRA 3OL2A 3MGOB 5CEZH 1OTTC 5IIEA 3FN9A 1RK1A 5IQ7L 5KS9E 1QRNB 4KI5C 1ZTXL 4HLJA 5JW5B 2DBJA 4N9GB 5DFVD 4ALAL 4LPXA 4NN6B 5DJ2B 4LPTA 5I1CL 3P4MB 2OL3B 2A0LC 2ED7A 4OIIL 5I8CA 4DVBB 2X6MA 1J8HE 5FYLD 3L5XH 5DGQA 1ZWIB 2FL5B 3Q48A 4JDTH 2AK4D 3WFHB 4GKSB 4MA1C 5KVFL 3KXFA 4IS6B 4U7MA 1G0XA 3GMPB 4M62L 4UNUA 4UQ3A 3B3IB 3MXVH 3QDAA 4GAYB 4OLXH 5BMFH 4G3YH 2QQQA 1ES0B 3NIGE 4EDWH 5ECJE 3BPCB 1FNEA 1R5VA 1QQDB 2EYTA 1F6LL 3S4SB 4MA8L 4FQQB 1NUNB 4PYHA 4U4BA 4LPWA 1UWXH 4MVBC 4OF5A 4AQ1B 4UV4H 4PJ5D 3OF6A 5DLML 5F7FA 2FX7L 1OSPH 3PF2A 3OSKA 3RNQA 4XWGH 2A77L 4YDJB 1DN0B 1O0VA 4GRLB 2MHAA 2VLME 5I1LA 3UBXI 5ADPL 4XVJL 3G04B 2KL6A 3PQYD 3SE3C 4MNHB 2VZTA 3TZVC 5DC9B 4LPUA 1II4E 5FM8A 2FSEA 5JQ6H 4BUHA 4FQCL 2DLFH 2XN9B 3F8UB 4BZ1H 1C1EL 2B7DT 3MRNA 4QRQA 1CDIA 5C0AE 1JRHL 4A2MA 5CWSB 3MRJB 1FFNA 2XICA 3K8KA 4G6KH 3NGBB 3RWFA 4Q9QL 5BVJB 2VUYA 3TGXA 5FYKD 5HGGS 3S88L 2B1AL 5EIQA 5GRJL 5C9KA 4R0LC 1BPVA 1ZGLM 4YHLL 4ZTOH 2D31B 3WO4B 5CJXC 4XP9L 3T3PE 3LRHA 2ZUTA 5T33H 1DTUA 3C5ZB 3TBSB 1K2DB 3FN0H 1AO7A 1WFTA 3TBYA 1J87A 2IMNA 4OFDA 3GGWB 4JN2B 4JFDE 1T83A 4APQB 3SJVB 2BVQA 1TQCC 2DMKA 4DCQA 3EDEA 5DS8A 3BN9D 2DDQH 4MAYD 5IGXH 5I1DB 5GS1B 1WV7T 2VXQH 2F8VA 4WCYH 2VLKB 2CIKA 2BNUB 3I02B 5F7EH 3ZT6A 1BLNA 1E4XI 4NC0B 4RIRB 2R1XB 4XRCB 3KPLA 4IRSC 4LNRA 1TTGA 5ILTL 5DJAA 4DAGH 4G7VL 1FZKA 1AXSA 4V1DA 1CL7I 3Q0HA 4M9OA 1TZGL 1QLEL 2HJKB 3MNZA 1I1AA 1LEGA 3IXAB 1L0XA 4KJPD 5GS2H 5HHQB 1EVUA 1FSKC 2VH5L 1DEEA 3CUPA 4M1DL 2DICA 4HH9A 1FFPA 3BUTA 5D7IE 1KB5B 4Y2DD 3HG1A 5F8QC 4X9FA 4HBQA 1TVHA 3W0WA 3O8XA 3ZE0E 2YC1B 1IEAA 3E8UL 1JWUB 1RMFL 2VXUH 1A9EB 1FIGL 5HGBA 3AUVA 3QEQD 4W6YB 3FHAA 1YUHA 3WHXB 5FFLA 1XF1A 1CLZL 3PP3K 1XEDA 1GPOH 1I85C 2Z9TA 5FYJD 1R5WB 2H9GA 2BMKA 2ICWJ 3BAEH 3KPSE 2XWTA 3RL2A 2HLFC 3T3MF 4HCRL 2BNRA 3JV6A 5EULV 2VLLA 4JRYE 5F21B 3LQMA 4IEFB 1S9VA 1SMOA 1JNNH 5D72L 2E9JA 3QZWA 2CLRA 5FO7A 4JJ5B 5IB2A 3TO4B 5L88L 3TNNB 3FQUA 1J0KA 1VFBB 2P48B 1TLKA 3VG0L 2YSSA 3FT2A 2VLRB 1T20A 4J3WA 4A6YA 5BZWB 2EYRA 2ENSA 4IRJA 3ZMRA 1QACA 3CSYA 3D5OF 2BVYA 1ZLUK 3CU7A 3W9EA 1TCMA 1QEWB 1E4JA 2R39A 3BUYB 1YEHL 4PJ8D 3MBXH 4G8GB 3HUJB 2H6PA 2R1WA 3OKMA 2BY0A 3D2UB 3QFJA 4DQOH 1NAKH 2JJTA 3I85A 5TGBB 3ZKQD 5JMRA 1RIUL 2Q87A 3QUXD 1B2WH 2WLZA 4LCYA 3ARDB 4D3CL 4GW1B 4N0UA 3BWUC 5DJZA 2PYED 3NABL 2V5SA 3DX9A 4PB0L 4LVHC 4Z7UA 3PHOA 3JV0A 5MERA 4P5MB 5I8EB 3BP6B 5DMYA 4Y4FB 5F71A 2G9HB 4NZTL 4JFFB 3VFOA 4HWBL 8FABB 1AGCB 2V2XA 4R2GD 3B2UC 1V3KA 2MQ3A 3RWCA 4ZTPL 2HFTA 1TJIH 4LVEA 3I6KB 3MGOA 5FB8B 3TF7C 3GMQB 1QRNA 4PGZA 4ZSOB 5HSFA 3Q3GB 5JW5A 2LABA 4N9GA 2YEZB 3ME0A 1AR1C 1A64A 3BP5B 5DJ2A 3P4MA 2OL3A 4JFEB 2NPLX 1L7TH 4DVBA 4XX1E 3JWDL 1MQKH 1VFOA 2OR9H 1T7YA 1ZWIA 1YQ2A 2FL5A 5KSBE 3WFHA 2IQAB 2ZCLL 3KR3H 1SM3H 4RWYL 4IOIB 5D71L 2YD5A 4IS6A 3SO3C 3GMPA 3NOIA 3B3IA 4GAYA 2ZUUA 5F9JB 5CGTA 1ES0A 5GJTH 1MCIA 5HYIA 1WQVT 1MRDH 3BPCA 1QQDA 3QCTH 3S4SA 4FQQA 4ZS6C 3ZKSD 2C4FT 3T0BA 3ZT5A 1P4LB 3DVNB 1KENH 4YDJA 1C7TA 1RUKL 1DN0A 4ZFGL 3SDAD 4GRLA 5CSBA 3G04A 4CRPA 3N9GL 3TJHD 4MNHA 1CFNB 1UA6L 2WIIB 2E9WA 2N7BA 1R24B 4KZDL 1MEXL 2BSTB 3JZ7A 2CMRH 4JFZH 3T0AA 2XN9A 5JORB 4X6FB 1AE6L 5CWSA 3MRJA 3ULUL 4PJHE 3S35H 1LHZA 5BVJA 1Q72L 4F9LC 2I60H 1N7MH 3BT2H 2D31A 1MJ8L 4MJ2A 1FHGA 4X7FC 5D7SH 4GG6E 2IGFH 1M05B 1OAUL 4HMDA 2AXHA 3U0WH 3RBGA 3C5ZA 1AQKH 4U7KA 3TBSA 5IROC 4RFNC 2E27H 1K2DA 1D5BB 1HHKB 1OAXH 4Z5RB 5H37H 1P6FA 3GGWA 4H88H 4JN2A 3EOBB 4K9EC 3SJVA 1A3RH 4OSUL 4GBXC 4YHOL 3PGFL 4F8TA 3ULUF 3TA3C 1IKFL 4AG4L 4MJ4A 1EEQA 5K9KB 4GRWF 5I1DA 3OB0K 4EN3B 5GS1A 1XF3A 5CP7A 4EVNB 1F3RB 5GGRB 1ZLVH 5J13B 2VLKA 1N2RB 2BNUA 3I02A 4OQTH 4P2QD 5E6IA 3OG6B 1T2XA 2NZIA 4RIRA 5F8RC 4XRCA 2OK0H 3MYZA 2E8ZA 4CADB 2XZCH 4ZUTB 3MRKA 2GJ6B 1FAIL 4PJFB 2HJKA 1V8HA 4AYFA 1P6AB 3VH8B 4JM2D 2A6IB 4EIZC 4N8VG 2H32H 4XP1H 1YQVH 1MCPH 2RGSA 4YEFA 3VDBA 1OP3K 1GGCL 5E2VH 2YC1A 5C0DB 3RUGE 4W4OC 1JWUA 1IC4H 1A9EA 3PWLB 2E5EA 2CO6B 3U79A 1ZHKB 2LAGB 4JKPL 1I7UB 4JFOB 1ZANL 4L3CB 5C8JB 2DQFB 3KPRE 3SOBL 1EZVY 4FFZL 2PCPB 4ODXB 5JXEC 5I0DA 4J6RH 1R5WA 4QRSB 1N0XH 1RU9H 4XPBL 1GGIL 1L7IH 2H1PL 5KSVB 2VDOL 2EDBA 4P2RD 1CFSB 1K4DB 1A7PL 4YR6B 1JMZA 2P45B 1I8LA 4HKJB 3PV6A 2V9RA 3DRTB 4GKNB 4JJ5A 4HC1H 3B9KD 4F80A 1QFUH 2UY6A 3QUMB 3TNNA 4KI1A 2B4CC 1VFBA 2D7MA 1KN2H 4FNLH 2GI7A 1WCBA 2Q20A 2VLRA 5BZWA 1RJYB 3JWOC 1QEWA 1AXIB 1MCBA 2F53B 2DQCL 2B5IB 3BUYA 2YKLH 3HZKB 2Y1VA 2ESVD 1VEMA 4QNPF 1CT8B 5TDNB 4YZFF 3WLBB 4G8GA 3HUJA 1YEEH 1K8IB 1NBYB 1UH2A 5E95B 1INDH 1A7RH 1T0MB 1RY7B 2K9UA 2MKWA 3A67H 3D2UA 5IM7B 2IG2L 4YBQC 3KLSA 2IAND 5TGBA 3LQAH 3GI8H 3HN3A 4FFWC 3ARDA 4PREB 1IVLA 2WAHA 2BZDA 4GW1A 1IBGL 2ED9A 4Q9CA 1IGJB 5E6YA 5C0ND 4NZJA 1KFAH 3V2AR 4P5MA 5I8EA 4Y4FA 2G9HA 2VDRL 3UTTD 1E0OB 4JFFA 8FABA 1CG9B 2EXYC 4AENB 4X9IA 5J3HC 5DT1L 3CMOL 1BJMA 4P99A 4JRWA 3I6KA 5FB8A 3GMQA 4ZOCA 3BISA 3L9RA 1VADB 3CVIH 3VI3E 2J4WH 4D9QD 3BP5A 1BEYH 1FE8L 5GGSY 1MIMH 4ONFL 2IBZX 5JR1L 4C58B 5DGRA 3V5HB 2ZUYA 1I8IB 5C0AA 4WI9A 1J7VR 4HBCH 1AP2B 3MCLL 1JWSB 1XCQA 4Y4HC 4IIQB 2IQAA 4N8CL 3IF1B 1NCWL 3RY4A 3QDGD 4IOIA 3BDXA 2AK4B 5GRUL 1N5AB 4NQDB 1ORSB 4TVSa 3MCKB 2W59A 2X05A 3RWJB 5F9JA 1RFDH 3LEYH 3T0EE 2HN7B 3HTLX 4X7TB 3S37L 4M5YH 5J1AB 1G0YR 1MFDL 1U93B 1J0YA 4WRLA 2R4SL 5CBAB 4FZ8L 3VD4A 4Y4KD 1OCWL 2J8UF 5EBGA 1FPTL 4I77L 1P4LA 3DVNA 2V9QA 5EORH 1ZLWK 2Y5TB 3UX9B 3WNPA 1LILA 4O2EB 2WIMA 1LO5B 3CZFB 3U48A 4PJ5B 3TV3L 2ZPKH 2J1KA 3GRWA 1WZKA 3GSNB 4KHTH 2D7PA 3IVKB 2WIIA 3HAEG 4LF3B 4M1CC 3IDIB 1R24A 3HI1B 2BSTA 4JHAL 1WTLA 1T5XB 3I3DA 3T0VA 5JORA 2UVFA 3IDUA 4OLUL 4X6FA 3QCUL 2R23B 1TMCB 3F7YB 3E2HC 4JY4B 1EGJH 4LSTL 4LLYB 2ZOKB 4RFEA 3MACL 2X4NB 3EBAA 3NZHH 3LN4B 5CAYB 3P0VH 3W82A 4KQ4L 1RZJC 3NFPA 3WIHL 5GRWA 2NYYD 4HUMB 5D96C 1M05A 2CJUL 4JANB 2K1MA 4KTDH 5CP3A 1T7VA 3PE9A 1RZKC 1D5BA 1HHKA 4OTXL 4Z5RA 3G5VB 4X0KB 4NKOB 4XXCC 3NCJH 1RULL 1UB6A 1G6RB 1Y6KR 3VGHA 1SBBA 1HKLH 3VW3H 5K9KA 3SKJH 4EN3A 4EVNA 1G9ML 5GGRA 3KPSA 1N2RA 4MAYB 3TWCH 1DCLA 3NPSC 5KVDH 1SJHB 4LCWD 1Q0YL 4CADA 4ZUTA 2GJ6A 2V7HB 1RIVH 5T1KD 2MSPA 4D8PB 1F00I 1U8OB 4NO5B 4PJFA 4RNRB 4MQTB 3VH8A 4PRIE 5E4IA 3MTRA 2AAVA 4UU9B 5HD8C 3QIUD 5HYEA 3DMMD 3T8XB 1DQLL 2A6IA 4QT5B 4H8WH 3BKCH 2BOCB 4XC3L 3DETD 2KZWA 3LY6A 2F9BT 4BSVB 3V7AG 5HYSG 1YEKL 5K9JL 1SMAA 4MWFB 4P23C 3QDHA 1JWMB 1ZSDB 3BI9X 3W9DB 5C0DA 4Y2DB 3OAYK 4CDHA 4KVCH 4GSDL 5D93C 2O5YL 3BZEA 2VXVL 4OF7A 1S78D 2APFA 3BQUC 1ZHKA 3SPVB 1I7UA 4JFOA 4L3CA 5C8JA 2DQFA 5MP6H 1RHHB 4JDVA 4ODXA 2PCPA 4QTIL 3QEQB 3FKUS 4QRSA 5F6HJ 4OCMC 3BDYH 5LGJB 1VFUA 4U6YB 4XPGL 2X42A 4YHKH 2EC9T 2GHWB 1LD9B 3MLUH 4ZPVB 1KJ2L 4FQ1H 1B0GA 1CFSA 4TSAL 5FKAB 3NAAH 1K4DA 2OP4L 4YR6A 4U6TA 4XNYH 2W9EL 3DRTA 2ARWA 4GKNA 5FO8B 1IAKB 4JM4H 4X83A 25C8H 3VXME 2GY5A 3GKWH 4YC2C 2J8OA 2AQ3A 5EU5B 3RI5K 2D7TH 1MCKA 5FOJA 1RJYA 4NKDB 3VXRD 1CFQB 2HT3D 4G6AC 5B38B 1KIPB 4K8RD 1JPTH 3R1GL 4UMGA 5T5NF 2F53A 3HZKA 1T89A 2A2QT 5KSBA 1CT8A 3CDYA 5TDNA 3WLBA 1B6DA 3O4LD 2D2OA 4Y5VC 1NBYA 2COQA 1JHTB 1T0MA 5IM7A 3LS4H 4XT1C 2ITDB 4PJ8B 4Z7NF 4KK5C 1L9NA 4FG6C 4Y5XC 5FM4A 4PREA 3UPRB 5KSAC 1DBKL 3UEZA 3G5XB 3V6FB 5C3LD 4OAWB 2EO1A 3IFLL 1IGJA 3QUXB 2ZOLB 3M17B 1GGTA 3INUL 3QRGH 1R3HB 2PYFB 4FXGB 4PRHE 5FGBC 4XH2B 1J8HD 1X5IA 2PYEB 2DYPD 5C3TA 2H41A 4BQ6A 3MZGB 4AENA 1NL0H 4KWUA 5J6HB 3S96B 4PLJC 4NQED 3RIAF 4R2GB 1EBPA 3QDME 4P9ML 1JZ7A 2YOCA 4P4RB 2PO6C 4KKAD 4I9WD 3E3QE 2P5EE 4HDIA 1VADA 4U3XA 4DOHB 5GGVY 5DK0B 3BE1H 4JGUA 4BJLA 1KELL 5HY9B 1EUUA 3V5HA 1AFVH 3DSNA 1I8IA 5EOQL 5LBSL 1AP2A 4X6CF 1JWSA 4KVNL 4IIQA 1G7LB 4LSPH 3IF1A 5F89A 3QUML 4PJGF 3T0WA 2AK4A 2AJ3B 4FQIH 1N5AA 4RZCB 5IOPB 4GXUM 1BD2E 3DLQR 4NQDA 1I8MB 3MCKA 3RWJA 1AQDB 4R90L 4H5SB 5I1HH 3C5SB 3L3IB 2HN7A 4GXVL 4X7TA 1IQWL 1A21A 3I6LD 5J1AA 1U9KA 3ILQC 5CBAA 3KGRA 1NCDL 1YNLL 1F3DJ 2Y5TA 1IKNA 4O2EA 3VA2C 4L4JA 1LO5A 3CZFA 3LIZL 4PJ5A 1A3QA 3GSNA 1I9IH 2Y7QB 1JPGB 3NH7L 3IVKA 4LF3A 1J86A 3SDAB 5IP4A 3IDIA 3PWPE 2B0SH 4XPHL 1AIFB 3BH9A 5ESQB 4L8CB 2DD8L 4JG1H 1LDPH 3LEVH 4EBQH 4I1NB 4IJ3B 3NCBB 3F7YA 3PIQB 4LLYA 3QUYC 3VG9B 1FZMA 2ZOKA 5FAAA 5K93A 2X4NA 3LN4A 1QTYT 4MA7H 5JNYB 1I9JL 2Y07H 5ITFB 1Q9LA 2DQHL 1LP9E 1TFHA 4HGKC 1U42A 5F70A 2BSRB 3OKKB 2G60L 4ODHL 4PRPE 2JCCE 4U1GB 1Q9OB 3MRBB 3MROA 3G5VA 4X0KA 5TF0A 4NKOA 3HMXA 4WHYG 2MQ0A 3GO1L 3PP4L 1G9NL 1G6RA 4JPKH 3UO1H 3RTQC 3Q6GH 1EJ6A 2VDQL 1VA9A 3B4NA 1P5UA 1RZ7H 3CFCL 4MAYA 2EE2A 1FG2B 2YUVA 5L7XL 1AGBB 4LCIH 5CEZD 2VSCA 3BPNB 5IB1B 1SJHA 1OSZB 3VFRB 4ZD3H 1MAJA 1OGAE 1T7XA 5I30L 1V7ML 4P2QB 4S2SB 1I3UA 2V7HA 4D8PA 3QH3A 1U8OA 4NO5A 4QXGH 4HFUH 4KI5E 4RNRA 1MI5D 2ENYA 4RMWA 4UU9A 1KBGL 3T8XA 4BA8A 4QT5A 1YYLH 2CUIA 2BOCA 3X3FH 5EO1B 3QJHB 4AMKH 1NJ9B 1FORH 3BKYH 4JM2B 2W91A 3ARGD 4HGMA 4MWFA 1JWMA 4S1DD 1ZSDA 3GK8H 3ZDYF 3W9DA 2AJYL 4Y2DA 4PJ9C 4N8VB 4JRYD 4I2XB 3AB0C 3GSUB 1D9KD 2PKDA 1TXKA 3O45A 1JYXA 1RZFL 2NY7L 5BJTA 4GAGH 1P53A 1A6WH 1RHHA 1NANI 4AM0B 2ZNWA 5GS0C 3QEQA 1KTLB 3GBMH 1IGCL 5LGJA 2XI9A 4U6YA 2X4PB 5GGTL 4J3TA 4ZPVA 4LLQB 5IQ7H 1TZIB 1HZHH 5J12B 5FKAA 3F12B 1ZTXH 2HJLA 5K9OB 3PWUB 2OTWB 1VENA 1OP5H 4ALAH 1EAPA 4P2RB 5FO8A 1IAKA 5I1CH 3V6OC 2IAMD 2ERJC 4MLIA 5IVXE 1B9ZA 4LDOB 3MGTB 3MRFB 1G7QB 3B9KB 5EU5A 3UMTA 3GIVB 4H8WC 5JHLL 3D69A 1KCVL 2ICES 3DJ9A 4NKDA 3IU3B 5MHSE 1CFQA 5B38A 1KIPA 3GMMB 1P7HL 5KVFH 2DF3A 1S7TB 2KH2B 4M62H 4PRBB 2OJZH 4IMKA 1BQUA 3P30L 2WUCL 1U95B 1K6QL 2RAMA 1DANU 1JHTA 3MLWH 3LB6D 1U8QB 2ESVB 2AKRA 2ITDA 4PJ8A 2WNGA 3O3UN 5C6PB 2FX7H 3UPRA 2EXWD 3G5XA 3V6FA 1MHPH 2A77H 4OAWA 1G7HB 3QUXA 2ZOLA 4OGYL 3M17A 4CDGC 5ADPH 3PGDB 4XVJH 1H8SA 4FXGA 2PYFA 3HE6D 5BV7B 3OHXB 1ACYL 4XH2A 5I9QC 2I5YL 1RURL 1LNUA 2PYEA 4HUKB 1DBBL 5D1QC 4FQCH 5J6HA 1QA9B 1PKQE 2Y6SD 3UTTB 4OLVL 1C1EH 3C08L 4NUGL 2Q86B 5GS2D 3UP1A 1JRHH 4P4RA 2P47B 4Q9QH 4WFHE 4WTXA 3S88H 2W60A 2B1AH 4XNUL 5DK0A 5GRJH 4KDVA 5IVZA 1ZGLB 1MLBB 2BJML 4YHLH 5HY9A 5DF0A 4OBRA 2FEEL 4TYUA 4XP9H 5I66B 1BJ1H 5DO2D 5CGMA 1YNTB 1F58L 1V3MA 3QPXL 1R5IB 4ZOAA 1TQBC 1WFNA 5E5RB 1G7LA 4Y1AD 4P59L 3DX6B 2AJ3A 2VMFA 5IOPA 4PJDF 4WV1B 5DC0A 1I8MA 1AQDA 3LH2H 2EE9A 3QDGB 4WEMB 2AV7B 5JHDB 4H5SA 3L3IA 2DOCA 43CAB 3WLWC 4OZHF 4Z77B 2MCG1 3C8HA 5BS0E 5GIRB 2FECI 3OZ9H 3MR9B 4G7VH 1NEZB 2QL1A 2PNDA 3SKUD 1QLEH 4XNZC 2Z35B 3FTGB 1WC7B 4PLKC 1FFOB 1JPGA 3SDAA 5EBLB 4DZBB 2JTDA 5BCAA 3QUZC 3RZCD 2EIDA 2KQMA 1AIFA 5ESQA 4R7NB 4L8CA 1X9QA 3S7GA 4PJAE 4HIEB 3BDBA 1H15B 1RUQL 2HKHL 2WWMD 3PIQA 2F8XC 3HAEB 3MJGX 3JBG7 5K59E 3IAQA 1FIGH 1OAYL 3GMNA 4PUBH 4MS8D 5JNYA 5ITFA 1CLZH 4OLYL 5J0BA 3IJHA 4ENEC 2BSRA 2X4QB 4MA1B 2OI9B 3SY0B 4MHHI 2HJFB 5TQ2L 3H2WA 3MRBA 4X6DE 1Q0XL 3X17A 5D7KD 4MMXC 4U0RC 2NY1D 3D39D 3ZKMD 3QQ4B 5IBLC 3GHBL 2JB5L 2Z93B 1Q94B 2V5MA 5D72H 4Y7MA 1I1FB 1IQDB 4R96B 5L88H 3FQXB 1RJCA 2D7QA 1OSZA 3VFRA 3VG0H 3DOSA 2WBJC 3JV4B 4P2QA 4S2SA 3TIDB 2DLTA 1WT5C 2QJDA 3OXSB 4LCWB 3WNMA 1HSAB 2DQTL 2ZUSA 3O2WL 2I9TA 3I6GB 2E9IA 3AU1B 4NKMB 1Z6JT 3ARPA 5EO1A 1YEHH 3HNVL 3BH8B 3QJHA 2LU3A 1NJ9A 5GRVK 1UKSA 4QRRD 4OB5H 3QIUB 3DMMB 4JM2A 3ORJA 1YECL 1IM9D 1PJ9A 5BW7C 5GSRB 4XPTL 4N8VA 3SGJC 4ZFZB 4I2XA 4D3CH 3GSUA 4LLVB 3GIZL 4HKZB 3U0PB 5IESL 2ID5A 2VQ1B 3NABH 3WYRA 1JGUH 5IK3B 1ZVYA 4JZJC 5HYSB 1UKTA 1H8NA 4PB0H 1ZVHA 3ZDZF 2XWJB 4FMFA 4HXBL 1W2KT 4AM0A 1ADQA 4HWBH 4UNVA 4X7SH 3WDJA 1KTLA 5DD3L 3D87B 1OW0A 4L9DA 2X4PA 4ZTPH 1NDMA 4PGCB 5D1XD 5T3XE 2HMID 4OLZL 1A6TB 1TZIA 1M6OB 1BVZA 3QHFH 3F12A 5K9OA 3PWUA 5FGCB 2OTWA 3LN9A 4P2RA 5MENE 2IPUK 3IDJB 5E8NB 3ZE2E 2J8HA 2EICA 4F7MB 5DD1L 3JWDH 3MRFA 2GITB 3MGTA 1G7QA 1DQML 1FO0L 3B9KA 3U30C 3GIVA 4YDLC 2ZCLH 3IU3A 2LVCA 1RVFL 3GMMA 5M94B 1FL6B 4RWYH 5D71H 4PP1D 1S7TA 4PRBA 5H37G 1U95A 1Y0LB 5FUZL 3MRCB 3MV9D 3FRUB 2BERA 2ZCKH 3MRLB 4AQOA 4L3ED 1U8QA 1U8MB 3LMJL 3O4LB 2J3SA 4LSUL 2W0FB 2GFBB 5KTEH 3L7EB 1ACZA 1G7HA 4LSVL 1FNSL 1X4YA 1AC6A 3PGDA 3N9GH 3OHXA 5BS0B 1ITCA 4MB3A 3ZL4L 5F1KC 4PJ7E 4KZDH 4FS0A 2AEWA 2Q8BL 1JI1A 5CIPB 4XHJD 3UBXB 2DYPB 3FJTA 4XPAL 2Q86A 1AE6H 3NA9L 1S9WB 4YQXL 1UM6L 4NO3A 3ULUH 4Z7OE 1Q72H 4NQEB 4GRWH 2AEPL 4JKLA 1MLBA 1NFDF 1MJ8H 3TLRA 5I66A 2XQYG 1QO3A 3B9AA 1JZ5A 5HHPB 1YNTA 4OI7A 5HGHB 2IPKB 4GQPH 1OB1B 1R5IA 4LRNL 3NTCH 4YPJA 3LN5B 3MA7B 2OL3H 4LP4A 1EIBA 4Y19E 3DX6A 3VD9A 3SDYL 2YD2A 1DR9A 3B43A 4EKXA 4OSUH 4WV1A 1GOGA 3PGFH 1CQYA 4GOSA 32C2A 4JB9L 4PJXE 1IKFH 3QDGA 4AG4H 5JHDA 2AV7A 4N0FA 4HK0A 3DUUB 1YZZA 1XGTB 2D9QB 3HNTH 2LU7A 5HYJD 4R4FL 3UYPA 43CAA 3QIBD 4Z77A 4F15B 1VDGA 5GIRA 1AI1L 1QPPA 5MEQB 1Q8MA 3HRPA 3MR9A 3EJZD 4MB4A 2Z8VC 1FAIH 5HDOA 1FV1B 1VACB 2Z35A 3QUKB 1WC7A 4ZFOL 1FFOA 2KDGA 3E6HB 2FCBA 5EBLA 3H9ZA 3PV7A 1R0AL 4DZBA 4OF0A 4RWHA 3PWJB 4LSQH 4LHJB 1GGCH 4HIEA 3HAEA 4M1GL 2X4SB 4JKPH 2WWKO 1ZANH 3SOBH 4FFZH 2X4QA 3SY0A 5T1DL 2HJFA 4XPBH 1GGIH 1NGXB 2C4FU 2HTLC 1P2CB 4PTTB 2VDOH 3QQ4A 1A7PH 1Q94A 1I1FA 1IQDA 4GXUN 4R96A 5GS3A 3DNKA 3RVXD 3D85D 1YMHB 2WMPA 1FJ1B 1CF8L 3FQXA 1E6OL 3QIWD 3GMRB 2BRQA 5CJ5A 3O3DB 3O3AB 5CD5D 3JV4A 1F4XH 3TIDA 3SE3A 3OXSA 4M6OH 1PLGL 4LCWA 1HSAA 1LGVA 5JQHC 3BRDA 2JIXD 3HPJB 2H2SC 3AU1A 4KAQL 2NY4D 4NKMA 1GOFA 3WNLA 1K3ZA 4PJBE 3BH8A 5C0BE 1MI5B 4XWOD 4Z9KB 1R6VA 3O6ML 3QIUA 1QBLH 3DMMA 1KJ3L 2EDWA 2EDJA 4ELMF 5GSRA 3ARED 4R0LA 1A7OL 1GGYA 3ARGB 2CK0L 4ZFZA 3CLFL 4LLVA 1IBGH 1KB5H 4HKZA 4IDLA 5HHME 3U0PA 2VQ1A 3MOAL 5IK3A 5HYSA 2AJSH 3EYOB 1JHLL 1IFHL 4IMLB 5F7YC 4OZGE 1IARB 2XWJA 2VDRH 1D9KB 3WHE1 5T1MB 3O0RL 4P2OD 5I15L 1QSFE 4BYHA 4Y16D 4YBLC 4OLWL 4K3GA 2EDOA 4PGBB 3LPWA 5DT1H 1J1XL 3NMEA 1QOKA 4PGCA 2AQ1A 1A6TA 1M6OA 2YA1A 1A8JH 1S7XB 4XBPB 4D94A 2J88L 3IJYB 3QWQB 3BD5A 5EC1B 4WW2B 1FE8H 3IDJA 4NN5B 5E8NA 4ONFH 2IBZY 5JR1H 1WIUA 3FQTA 5EPMB 4F7MA 5I6XB 4DN4L 3F7PC 1S3KL 2GT9B 2GITA 2WLYA 4QHNB 3TCLA 2HVKB 4MGXA 4GAFB 3MCLH 2CDFB 2IAMB 2NQCA 3S5LG 1DBJH 2EKJA 2P44B 4N8CH 1ZT1B 4LP5A 4RBPH 5F7LB 4NKIL 1NCWH 1ZA6B 5GRUH 3K2UL 2CUHA 1J0IA 4KK9C 5JPMB 1NC4D 2HWZH 3MRCA 3FRUA 4ODUB 4QHLB 3S37H 3MRLA 4LPYA 3WUWG 4ZNEE 1IAOB 1MFDH 1WF5A 1U8MA 3T4YB 4FZ8H 3AS3A 5I19L 3O4LA 1OCWH 1YJDL 2W0FA 1FPTH 2GFBA 4I77H 4XI5D 4HIXL 3L7EA 1B0RB 4P46C 3MV01 3ROOB 1SY6L 2I27N 2KKQA 4K3EL 2DLIA 4PJEF 2DMBA 4FMKA 3TV3H 4M6ML 2V2TB 1WIOA 4EI6A 5BS0A 3SGDH 4F2MB 4JHAH 1Z9LA 1AKJD 3HE6B 5CIPA 2DYPA 2NY6C 4OLUH 3QCUH 5TE6L 3TH4T 1S9WA 3JWDC 3L5WA 4E41E 3FZUC 4NQEA 3MACH 1SBSL 3MO1B 1BZ7B 3Q5YA 4KQ4H 5HHXH 2QADC 4QTHB 1PBYA 1FH5L 4Z7WE 1YPZF 1WAAA 2CJUH 3C5JA 4NZRL 5HHPA 5HGHA 3WFEL 4FOMA 1OB1A 3SKNB 4P4KD 3KPTA 3TO2B 4IRJC 4R3SB 3LN5A 1C5CL 3MA7A 4MXQD 4OTXH 4L9LB 1YC7A 1RULH 4M93B 4HWUA 2XACC 3U4BL 2ZSVB 3DUUA 1XGTA 2QSVA 3A6CL 5IB4B 4X6DA 1G9MH 2JJTC 1KACB 2FRGP 4WWID 1Q0YH 5MEQA 2F5BH 3KPQB 5IFHL 4J2XA 4JZNB 2JJUA 2VDMH 2EDTA 5ALBH 5ICZA 4RA3A 3OMZA 1FV1A 5LGHL 1VACA 3R06B 3PDOB 2VDPL 4AJ0A 4MSWB 2E7LA 4OZIE 2FYYB 1HXYB 1DQLH 3SDCD 3ULUC 3E6HA 5J06A 4RGOH 4XC3H 3VE0B 4DKEH 3P40A 4BELD 1NLBL 4HZLA 4PRPD 2XV6B 3C60C 2ADGB 5K9JH 3GRWH 2Z31C 4NIKB 1D6VL 3BESR 3HC3L 3IXTB 5C9JA 2M26A 3RZCB 2Y23A 3JXAA 5EO9B 4NN6C 4GSDH 2O5YH 2X4SA 2VXVH 4QY8B 5DI8B 4J4PD 2ATKB 2DWEB 4LRIC 4GMSL 2OLDA 2EYSB 4QTIH 1IGYB 5FKPB 1NGXA 1U8NB 4LSSL 1NGWB 5TQ0L 5KS9F 2NXZD 4XPGH 4UOW1 1I1RA 1P2CA 4PTTA 4CBPA 1TCRB 4UBDC 1KEML 1KJ2H 3LSOB 1JF6A 2AJZB 3RX7A 2YWZA 3RRQA 3PG2A 3BEVB 2OP4H 1MRFL 3EDFA 3D39B 4H26B 3RA7H 2W9EH 5I73B 4HFWA 5E00B 3PP3H 2OSLA 5EC2B 4Y0GA 1YMHA 5E2JA 1FJ1A 3RWGA 1N59B 1XMWA 4CN1A 3GMRA 3H42L 3RX8A 3WFBL 1VSCA 2L7JA 3O3AA 5FYKU 1AGFB 4GRLC 5D7JD 3R1GH 1KIUA 3NIGF 1G7IB 4D9RE 3HPJA 3RVTD 5AZ2H 2R29H 3UAJC 1NBQA 5E9DE 1KLFA 1MI5A 5FHBL 4OM0L 1E4XL 4DFIA 4Q6IC 1C7SA 2LU4A 3SDXE 4F9LA 4QRRB 3NGBC 1C5BL 1HNGA 5JO5B 3ARGA 1CL7L 1DBKH 3ARQA 1IM9B 1GH7A 5GISL 3ROLB 1ZLUH 3IFLH 3EYOA 3WO4C 3INUH 2YD8A 3HC0B 2VN4A 3F7VB 1TJHL 5GRVL 4YJZL 3C5ZC 4KUZL 3F7RA 2WK2A 1XGPA 4RGNC 4APQC 3OBAA 4P49A 4PGBA 3LQZB 1L4IA 5DHYB 5D5MB 2VAJA 2DJ4A 4P9MH 4G80B 5DURD 4XBPA 1S7XA 1NGYB 2FGZA 4PJ7A 3IJYA 5GS1C 5EC1A 2DIBA 4WW2A 3C09B 5D1XB 3T3PF 4X9GA 1RUPL 2MPAL 5EPMA 4KKCD 4LVNC 2GT9A 2NMSA 2WZPD 3H3KA 4HF5L 4QHNA 5LBSH 1SYSB 2HVKA 2ICCA 2L0DA 2IAMA 2CDFA 2EEBA 4KVNH 4O2FA 4N68A 3SE9L 1ZT1A 1QSEE 1ZA6A 2EDRA 3QUMH 4AEIL 4HULB 1B4JL 3VA6A 5E24E 4YGAB 1XCTB 4XPFL 2ZSWB 3EZJB 3G6JB 4I48B 1MFNA 5JPMA 5GGRY 5FYJU 4WTZG 4R90H 1DLFH 2OMBA 4QHLA 4GXVH 4D2NA 5DFWH 3T4YA 4JQXA 1RK0B 3X3GL 4WUUE 3MV9B 1NCDH 2YPVL 2YN3A 4L3EB 2EC9U 3VXUD 1J5OL 1B0RA 3NFSH 4UIMB 3FFCE 3ROOA 3LIZH 5DHVH 2UZXB 2V2TA 1IGML 4WFGE 3WS6C 5JXEA 3FO0H 3AROA 1XT5A 3TVMD 5D7IF 1OM3L 4NHUB 4PLNC 5FDWB 4NC2B 5A3IC 4P0DA 3NH7H 5F6IB 1CLOL 4F2MA 5C0RH 1YYML 5DQ9B 4QWWC 3ZE0F 2X4UB 3HE6A 3QWOB 4XPHH 1CQKA 3QRFM 2DD8H 1WFUA 3ELAT 3A6OA 4NN7B 3RWIB 2O26U 4WVRA 3MLTB 5F88B 2BNQE 2BOBB 4G9DB 1I8LC 4LLWB 3EOYG 4J1UB 4M6AA 4RX4D 1H5BB 4YC2B 3MO1A 1BZ7A 3HR5B 3TO4C 2BC4B 2EDFA 4QTHA 3TPUA 1NSNL 1I9JH 1KLGB 4KH2A 2DQUL 2H32B 2DQHH 4Z18A 4J23A 2WM0A 5HI4D 4BSJA 2F74B 3SKNA 4ODHH 2DKSA 4NSKB 4NRZB 4UT9L 1SEBB 4L9LA 3OKEB 1CXHA 3GO1H 5EOCL 4FFYH 4N0YL 5HGAA 3UTSE 4U1HB 3PP4H 5L8JB 4U6HB 3B9VA 2R9HD 4HX1B 3EW3B 1R3JB 5FYLH 5IB4A 1CDYA 7CGTA 5GSVA 2DIAA 5E8PB 3CFCH 2VYRE 5L7XH 5EU6E 5HYJB 3ARDC 3QIBB 3KPQA 3MLYL 5ICYA 2O61B 5I30H 5KAQF 5HYQB 3R06A 3PDOA 4MSWA 1SQ2N 4I4WB 2FYYA 1HXYA 5C6WH 4R7DB 3V6OE 1S9XB 3VE0A 2ADIB 5J4MA 1QHOA 4K7PX 1BQSA 2ADGA 2PXYC 3V5KB 3RZCA 2AJYH 4Y5YB 2YPLE 1CXIA 4PJBA 5EO9A 4Z7VE 4KDTA 3GB7B 4QY8A 3ULVC 5DI8A 5BZDB 3DWTA 2UY7A 1RZFH 2FX9L 2DWEA 1CWVA 1NQBA 3EYQC 1OAQL 1FVEA 2EYSA 5LGKA 2MOVA 3KS0J 1IGYA 4N1EA 1OP3H 3MBED 3STZB 5FKPA 1BFVL 1IGCH 1U8NA 1EHLL 1YEIL 1MCWW 1E28B 2BDNL 1O7VA 5GGTH 4AEHL 1TCRA 4OIAA 2ZWLT 3DXAD 3LSOA 2AJZA 3SBWA 2C3XA 1X5LA 3BEVA 5IF0B 5EG6C 2VOTA 1QSFA 3D39A 4H26A 2M8XA 5DRNB 1IC5L 1CICD 5E2WL 5E00A 1OTSC 4O51B 5EC2A 4POZC 4LCCB 3T65B 1N59A 1CXLA 1GZQA 1F5WA 3VXSD 1MHCB 5IUSA 3D85B 3KPMB 1BECA 1KCVH 1T21B 3R0MA 3QIWB 1AGFA 4NOFA 1KJVB 1FC1A 5SWQB 1LO0L 1PYWB 1OF2B 2AI0L 3ZYIA 3P30H 2WUCH 2YK1L 3NIFF 4MQ7B 5DJXB 4GMTH 1YY8B 2JIXB 2NTSP 1BBDL 5E5UB 2NY4B 3WHE0 3AAZB 4OBSA 4DUWA 3QQ3B 5T3XD 4UB0L 1XF2B 3EHBC 5JO5A 1IM9A 3ROLA 2H26B 1IL1B 1WZMA 1K8DA 3AREB 4HMCA 2C1PB 1FLRH 3HC0A 1NCAL 1ACYH 4NQCB 4V2CB 2I5YH 3IDGB 5AWNL 4EXKA 5EN2A 1DBBH 4TOYL 1TDQA 5A2KH 3X11B 2SEBB 1UJ3B 5DJYB 3OX8B 4TNVK 1MSPA 5IHBA 2APWA 2HFFB 4OLVH 4PJHF 3LQZA 4P2OB 4WHCA 4X7DC 3C08H 5DHYA 5D5MA 5E7BA 1GIGL 4G80A 3RTQB 2H45A 3CX2A 1F4WH 5IWLA 1NGYA 3KVQA 4ODWA 4EN3C 3QDJE 3PGCB 4XNUH 3DVFA 2C3VB 5D1XA 1M1SA 4LSDA 4DKFL 5J13C 1CFVL 2BJMH 2IQ9L 3BOVA 4J12A 4J3UA 3T2NH 5B4MC 3O6LL 4G6FD 5KANI 4AEEA 1T80A 5I71C 5GGQL 1F58H 3RNKB 1SYSA 4AY0A 4HS8L 3QPXH 4QLRA 4FQPA 4MXWL 2JKXA 2F8OA 4PBXA 1RZIB 4P59H 1JBJA 4RAHA 4KXZI 3S36L 4Q58C 1XCTA 2ZSWA 1T3FB 4PP2B 2W0KA 2QBWA 3G6JA 5EU7C 4I48A 5IMOB 5DK3A 5GZOD 1DBML 3S5LB 4PJIE 5B3JE 5AYQA 2R2BB 4PJ9B 1RK0A 1CDCA 1NC4B 3MV9A 3BEWB 5L8KB 5D1ZD 4ZUVB 1UWEL 4L3EA 3JUZA 1A02N 1T2JA 4UIMA 1CDJA 4HS6B 1DVFC 5IHUL 3WUWB 1YA5A 3NACL 2FIKB 1UYWL 2XTLA 3VFTA 1BF8A 4NHUA 5FDWA 3IETB 2QSQA 5SWSE 1IC1A 5DQ9A 1TIUA 4OQTA 2X4UA 3BKML 3RUGF 5DJCB 1JZ3A 4I0PD 3IFNH 1U8PB 3RWIA 2Q7YB 1FP5A 1RUQH 2HKHH 1AKJB 1ZLWH 3MLTA 5F88A 2BOBA 4G9DA 3HKFA 4HIHB 4LLWA 4J1UA 4P9HC 1H5BA 1P7QD 3HR5A 1OAYH 2BC4A 1KLGA 4HXAL 3P11L 2H32A 4U7SA 4WEBL 4QGYA 4OLYH 2YPLB 4NSKA 4NRZA 2CPCA 4MX7A 5TQ2H 5D2LB 3WEXA 1SEBA 1PW3A 4U1HA 3TFKC 2GYSA 5DR5L 4U6HA 1BHGA 4P4KB 1CZ8L 2QTEA 3WKNA 2B5IC 2CUMA 1YEGH 4OD1L 3GHBH 2R8SL 1T89C 2X9YA 3PABB 4JKKA 2FHBA 2JB5H 1WJ3A 4HX1A 4N5EC 1R3JA 4H0GA 2VC2H 4I3SH 2F19H 1U8LB 5E8PA 4C54A 4POUB 3CFBA 4Y5XA 5C08D 2WWKT 2DLGA 5FGSA 5JZ7D 4X4ME 1QKZL 5HYJA 3QIBA 2DQGL 4C56E 4MD5B 2O61A 4YDVB 5FECA 5HYQA 5AAMA 2DQTH 3O2WH 1JPFB 1XFPA 1VHPA 2R0WL 4I4WA 5D1QB 2CLZB 3MV11 4HC1A 2ADIA 1F2XK 3HNVH 4L1HA 2G2RB 5DQDL 2UVEA 2CR3A 1ZHBA 3L3OB 3SDCB 5AG9A 4XC1L 3MJ9H 4F57L 3V5KA 3VD5A 4Y5YA 4XPTH 2AEQL 2QHRL 3RKDD 3U2SA 4UOW0 2VZVA 3BGMB 3GIZH 5IESH 2X1QA 3GB7A 5BZDA 5F93C 5DFVC 4MNQE 1W0WA 1MJ7L 1RPQA 1EHNA 4HXBH 5F1NB 3ARBD 4Y2OA 4S11A 3ARSA 4IIQC 4UINH 3U7WL 4NT6B 4B41A 5DD3H 3STZA 1A2YB 4XAWH 1E28A 2VE6B 4U6VL 5MI0C 4KFZC 1GSMA 1LDSA 4OLZH 4NUJB 4JPIB 5IF0A 2UWEB 3R0NA 5J7CC 3SN6N 3DRQB 1MREH 2CR6A 2DIJA 5DRNA 1A1OB 4O51A 1W72L 1JGLL 3T65A 4F58L 4BFIB 5DD1H 1GJIA 2DQJL 5HVGB 2P5WD 1XGRA 1DQMH 1FO0H 1MHCA 3ZKND 3D85A 2R2EB 3KPMA 1AY1L 1T21A 2K3TA 1KPUB 1IKNC 3CMGA 3QIWA 2E3VA 1RVFH 1B88A 3C60D 1KJVA 1L6XA 4ODVH 3I84A 2EH7L 4XMPL 5SWQA 3K4AA 4ODTL 1PYWA 1OF2A 3QUZB 5ESAB 1LO2L 3DUSB 5D7JB 4PJCE 5FUZH 4YX2L 1V3JA 1JNLL 4MQ7A 5IV2B 3UJTH 4WI7A 1YY8A 2JIXA 3MV8E 1Z5LA 5ISZE 5CHNB 3L6FB 3AAZA 3QUYA 3LMJH 3S6CA 5C2UB 5EUOE 1ND0B 3QQ3A 4GQ9L 3D3VD 1XF2A 2QLVB 1EBAA 4S0TD 1DBAH 1KXQE 5CJ8A 3SGEI 1IL1A 1HOCB 1HN1A 5CKGA 3VD7A 3WXVL 4LSVH 1FNSH 3TJEL 3AREA 1LE5B 5GPRA 2EDYA 2C1PA 5IKCB 4NQCA 1JZ4A 3IDGA 3D1MC 3OJMB 3C6LD 2CH8A 2AW2A 1WWBX 1QLFB 3X11A 2Q8BH 2SEBA 1UJ3A 2Z8WC 5DJYA 3OX8A 2HFFA 4KC3B 3O2VL 4P2OA 4XPAH 3NA9H 4N8PA 3RTQA 4EDXB 4YQXH 1UM6H 4WFEE 3G6AB 3P9WB 1XF5B 2BRRL 5LCVH 2AEPH 3PGCA 2C3VA 5IW3A 3VFSB 3BN9C 5DURB 1YC8A 3TBVB 2X1PA 5HVHB 4LVOC 4XCNB 4LRNH 1N64L 3IDYB 4L8DA 4FQ2L 1RZIA 5D70L 3SDYH 2EECA 1EGJA 4WDIB 1S5HB 3OKOB 3O3EB 4X8JB 1T3FA 4PP2A 4JO3L 4YO0B 5I1GL 4YK4B 3S5LA 4KJPC 1SVCP 4Q74A 1X3DA 4XHQA 3N50A 2ICEB 5KW9L 2R2BA 1MCHA 4PJ9A 1F3DH 1NC4A 2NY2D 3BEWA 3W11D 4Y2DC 4G43B 3K8MA 4ZUVA 3KXFE 3R8BB 4G8FB 4JZJB 4ZDHB 1IE5A 4PS4L 3WUWA 4RGND 2FIKA 1F90L 3KYNB 1X4ZA 3VXUB 12E8L 1BFOA 1JPSL 4Z8FL 4LHUG 5MEOB 4X80L 3IETA 4KKNA 1T04B 1FGNL 3TVMB 1RUAL 5DJCA 4Q97A 2DL9A 1U8PA 2Q7YA 3J8F7 1AKJA 2DI8A 1H3PL 2YRLA 4HIHA 3HMWL 3BXNA 4M1GH 3UJIH 3IRZA 4NRXB 1YEJH 3FRPG 2DQEH 2UYLB 1KPVB 4YDLB 3P4LA 1LQSR 2YPLA 5T1DH 4KZEL 3QHZH 3VRIB 4UZGA 3O41B 5DVKA 5FXCH 1P84K 3UC0L 5DZLA 1ZA3B 4P4KA 4QHUA 2VXTL 3S97C 3PABA 4V2BA 2DM2A 3UDWA 3I9GL 4R97C 3BP4B 1U8LA 5CZXD 4F37K 1T1XB 1UVQB 1CF8H 4PJ8C 1E6OH 1AO7E 3QA3B 1EEYB 1HH6B 1KC5H 3QYCA 4MD5A 4YDVA 3QUXC 1F2QA 1N4XL 1PLGH 5FM5M 1P84J 3Q5OA 1JPFA 4NO2B 3U9UB 2ZKHL 2WANA 2OS7A 5D1QA 1IM3B 4U49A 2NR6D 3O6KL 4G7YH 1G6VK 3ARUA 4L5FL 4OZFB 3L3OA 3SDCA 1KJ3H 4R2GC 4YNYB 3LHPL 4JFYB 4O2CB 4M8VA 4V1DE 4MYWB 1A7OH 2NXYD 2CK0H 3CLFH 4ZOEA 2X70B 3BGMA 3G5YB 1SHMA 1U3YA 3E6FB 1OPGL 1AD0B 1U8HB 3MJ8B 1IFHH 4NCC2 5DD0L 5EA0L 4PYGA 4RAVB 5F1NA 3U7YL 3HG1E 5D6DA 1NCNA 2KUTA 5I15H 3W0WE 4G5ZL 4J4PA 4NT6A 1MLCB 4LLAA 1A2YA 4OLWH 5HDLA 3L95A 3JVGA 2VE6A 4K3DH 1J1XH 1F8TL 3FO2B 1PQZB 1PY9A 3MBEB 4NZDA 4NUJA 2R2CA 4LQFL 5I1JL 3GI9L 3LAFA 5CEYB 4CVWA 5DK2B 2UWEA 2F54D 5HDQL 2J88H 1JUFB 1CXKA 4UT7L 3DRQA 4MNGB 1A1OA 3VGEA 3DXAB 1C5DB 2IBBA 4LQ1A 5L0QB 2W07A 4X98B 1S3KH 1A5FL 4PG9B 1OTUD 1CICB 3W5NA 1JL8A 4HIJB 2R2EA 4M5ZL 3EYFB 1KPUA 3H3BC 3K81A 4NKIH 5ANMB 3VXSB 5C07D 1C08B 2P8LB 3K2UH 4U1IA 2GQHA 2E7BA 3QUZA 3QO1B 4M4RA 5ESAA 3SDAC 3DUSA 5D7JA 1KULA 5L6YL 5D2LF 3UROR 1MY5A 3TJHC 5CHNA 4IJ3C 5I19H 1FNGB 4CJ1A 1ND0A 4LLUB 1DFBL 3VG9C 3SHSA 4R6UA 4HIXH 2CK2A 3AY4A 1HOCA 3C9NB 1SY6H 4K3EH 4M6MH 5IKCA 2NY5L 1U2HA 3UZEA 3N85H 2DTSA 3QFJE 4U1GC 4QKXB 3QCVL 1QLFA 5L2KE 2J12B 1IAII 4W6XB 5ABDE 4J3XA 1U6AH 1NC2B 2FO1A 4N0UE 5TE6H 1U41A 43C9A 5CGYC 4EDXA 3G6AA 5JTWA 4Z7UE 1XF5A 1EJOH 1WBZB 2CRIA 1F97A 3VFSA 4NQXB 1TJGL 3S9DB 5BRZD 5F1OB 3TBVA 3ULUE 1FH5H 3OJDB 2JCCF 3BPNC 3HZYB 2VSDA 4GRWE 4NZRH 4P5TD 4XCNA 1QFPA 3WFEH 2B1HL 3MUY1 4OD3H 4G6FB 2CKNA 1C5CH 2EDNA 1QRNE 2CD0A 5TE4L 1S5HA 3OKOA 3MMEB 1T2QH 3O3EA 4NKQB 1XGYH 4X8JA 4I5BB 2Q6WB 3W39B 1BVLA 1P1ZB 4JG0H 4PY7B 4OCWL 5CSGA 4FP8H 2XKSA 4ZO9A 3A6CH 2YR3A 4JM2C 2ICEA 5T5NG 1FCGA 1L6ZA 3SGJA 4E5XB 1BWWA 5DMKB 4K8RH 5DZOA 3OTTA 4G43A 2OZ4L 1UC6A 2P1YA 5IFHH 4KI5F 4G8FA 3C87A 4JZJA 4XAKE 3EJYD 4WTZA 1N3NB 5B39G 4ZDHA 4NJAL 5D1ZB 1H3VA 1T66D 1UH3A 5LGHH 2YD3A 2VDPH 3GSVB 2ZG2A 1CGYA 3KYNA 2YS4A 3VXUA 5KOVC 5MEOA 4X4MA 5IVNA 4BK4A 1P5VA 1CD0A 2MKLC 3IAPA 3HE7D 3RWDB 1HDMB 1FGVL 1OW0C 3TVMA 4FN0A 5E70A 1MFEL 1BQHG 4AT6B 1D6VH 3HC3H 3UTSD 5J12C 2P46B 3VH8G 3WIFA 1IC7L 4I0PB 5CIPH 4NRXA 4WY7L 2UYLA 2XTJD 1T1YB 1BOYA 4RX4A 4GMSH 5EFIB 5CZVL 2C7UB 2AS5M 1P7QB 3B9KC 2XN9E 2DAVA 4LOUD 2CO7B 1IJ9A 3VRIA 2AXJA 2X41A 2NTFB 1QD0A 4LSSH 5TQ0H 3MYJB 4QRPD 4OIBA 1PEWA 5DQJB 1ZA3A 1KEMH 4Q9RL 1NMAL 2Y9RT 1MCRA 2GJJA 5FA3B 4AEFA 1MRFH 2VN7A 5IVXF 3BP4A 4LGRB 1FVDB 1V3LA 1T1XA 3FMGL 1UVQA 4NOBA 1X5ZA 3H42H 3DURB 3MRGB 2IFFL 3QA3A 3UTPE 1EEYA 1HH6A 3KPNB 1NCCH 4LEXL 1OOAA 3HZMB 1AGDB 4HJ0D 2P24B 3BD4A 5BV7C 2AK1H 1EFXD 2VERN 4NNXB 3U9UA 1NCUA 2EDKA 4MCYB 1IM3A 2XXMB 5C71A 5C0NC 2VLKE 1CD1B 4U33A 4XXDB 5FHBH 5FK9B 3FB6B 3G08B 4OM0H 3DYOA 4GW4B 5I18H 5IJVB 3OAUH 1E4XH 1FIEA 4FQXD 4YNYA 3OAZH 4JFYA 4O2CA 2FR4B 3DROB 2VRAA 1C5BH 4ONGL 1F13A 4JHZA 2X70A 5EIIB 3G5YA 3V4PL 3E6FA 1I75A 3IU4L 1NCBH 1AD0A 1HQRB 2I26N 1U8HA 3MJ8A 4ONHB 4ZS7H 5EU4B 2MCPH 4RAVA 5AAWA 4KUZH 4NBXB 1ZLVK 1JNHB 5JUEL 3WD5L 1QNZL 2GTZB 4OLEA 1MLCA 4UILL 3ARBB 3CC5B 1WWWX 3FO2A 4G42B 4WV1C 1PQZA 4UTAL 3MBEA 4GKOA 2CRZA 5LG1A 5EZOH 3D6GA 5CEYA 2X9XA 4QXUL 1YEFL 1JUFA 5E08H 3L5IA 3FO1B 4MNGA 1C5DA 1DJSA 5L2KB 2K7PA 5BVPL 2MPAH 1OT1A 4X98A 2X2YA 3EO1B 4PG9A 2X5PA 1HHIA 4HF5H 5GHWL 1CICA 5F7HA 3QXAB 1J1PL 5D7LD 4HIJA 3EYFA 3SE9H 4NWUL 4Y4KC 5ANMA 2P5WB 4JRXD 5TPWL 5CZKA 1XR8A 4MQXD 4AEIH 1C08A 1B4JH 2P8LA 3CAFA 1QYGL 4XPFH 4OFIA 5JIKA 3QO1A 4N90E 3C60B 3VGGA 3VFWB 4CGTA 4HLZH 2Z31B 3OPZL 2VZ3A 4PG2A 4U1KB 3LV3B 2XZAL 5D2NB 5HTSA 2X4TB 2VLRE 1JTOA 3X3GH 5DUPH 1FNGA 3RVVD 3CLEL 3LCYA 4LLUA 2YPVH 1HYSD 1J5OH 2DS4A 4R9HA 3C9NA 4K7PH 3D3VB 3WJLC 3STBA 1JHKL 1IGMH 2NZ9D 1PDKA 3HUJE 4G8GE 1OM3H 2FDBP 2OI9C 2V6HA 2EDQA 1CLOH 2NYYC 4QO1A 4OV6F 4PJAF 4NHCL 1WITA 1T0NB 5JW4N 5H35B 4LDLB 5E94B 3ETBF 3VWKD 3C6LB 4BQCA 4MZ3A 1NC2A 3B8SA 4Z76B 3CK0L 3SQOL 5K59F 2DTML 4TVPE 2FH6A 1WBZA 4NQXA 1IAIM 4JPWL 3U1SH 4JFFE 2EDXA 4NNPL 5DUML 1WWCA 1X6LA 3OJDA 3HZYA 3KLHD 2CSPA 3KYAA 2CRYA 1J88A 3S8WA 4MDIA 1U0QA 4O9HL 4ZSOE 4KK6D 2WBWB 5EOCH 4N0YH 3O2DL 3MMEA 3MRHB 4NQVB 5F7WC 3NZ8B 4I5BA 2V5YA 2Q6WA 3W39A 1Q1JL 1P1ZA 3ULVE 1U3HD 4JFEE 3FAXA 4PY7A 3I2CL 5BXFB 1N6QL 4Q6IB 3QIUC 3DMMC 3VFUB 2IH1B 3TNMB 4MAUH 2CGRL 3LRGA 3DETC 2GUOB 4E5XA 1CFBA 1J1OL 4Q9BA 5DMKA 2DWDB 3U2SB 5I1IL 3RDTD 5JOFB 4XVTH 3LRSB 4QRTB 3MA9L 2XA8L 3MLYH 4JJHA 1N3NA 4N0CD 2NY2B 4YPGB 5D1ZA 4HCRA 5IEKB 2GAZB 2XNAB 4U2YA 3GSVA 4LK4A 4DEPB 3HRZB 5B8CB 3LD8B 3GNML 1S78C 1MFCH 4RGNB 3RWDA 1A9BB 4P5KB 2P8MA 5T3XL 3TN0D 3MODH 2AJUL 1MNUH 4AT6A 2BSED 4X6BB 4LHUB 3Q6FB 4TN9A 4OI8A 1JGVL 4I0PA 3CVHL 3H8NA 5C0CD 5HI3D 4LVNB 3BYTA 1ZT7B 2FX9H 2JE8A 1I7TB 2C7UA 1OAQH 1P7QA 5T3ZE 5IW1A 5I1EL 1NKRA 2ZJSL 1PG7L 4KKBD 1BFVH 4JDTL 1EHLH 1YEIH 2NTFA 5FDYA 3HPLB 4C55A 3MYJA 2BDNH 3EOAA 5DQJA 4AEHH 3B2VL 2HT3C 3HCVB 4K8RC 5IW6B 5FA3A 4DVRL 4WTWA 3H9SD 2I9LB 4G3YL 1UM4L 4NO0B 4PRDA 1IC5H 1QBAA 5E2WH 4EDWL 4G6JL 4Z7QE 2J6EL 1FVDA 2GTWB 1CFTB 4HWBA 5HHOE 2FX8L 1QR4A 2QKIB 3DURA 3MRGA 5DDHB 4K9EL 5TE7L 4P46A 4NBYB 4WU7B 4RMUA 4CKVX 3A6BL 2FB4H 3HZMA 4XWGL 4HT1L 5ALCH 1AGDA 2P24A 4NNXA 1LO0H 5DJ8B 4MNQD 2XKNB 4MCYA 2AI0H 2HG5B 2VZ1A 1CD1A 4OQ1A 4XXDA 4XTRD 2YK1H 5FK9A 3FB6A 3G08A 4GW4A 5IJVA 1VKXB 5JQ6L 1BBDH 3EFDL 2V17L 3RY6A 3QPQD 2DLFL 2J8UB 1OD9A 1GOHA 1KTKE 1A14H 3RVUD 2GJ6E 3KDMB 2FR4A 5HPMB 5B38G 4PJFE 4UB0H 4QOKD 4BFGA 5C7XL 5ERWB 4K07A 5EIIA 1BVKB 1E4KA 5KVGL 4KKAC 1HQRA 5KG9B 3CPLB 2NXYB 4ONHA 5EU4A 4CU6A 1NCAH 2XFXB 1OWRM 4F37F 1JNHA 4TOYH 2C5DC 2GTZA 3ARFD 1CE6B 4OCRL 2BVPB 2EZ0D 4IRZL 4YLQT 3ARBA 1YNKL 3RQ3A 3ARYA 3CC5A 4Z7OF 4G42A 3RVWD 1GIGH 1UZ8B 4GLRI 1NEUA 4D0BB 4ZUSB 3RL1B 5HXMA 3FO1A 4DKFH 5L2KA 5SWZD 4F15C 2IQ9H 3O6LH 5DD6B 2F54B 3EO1A 4FQLL 5GGQH 2CKBL 3SKMA 4XVUD 5F72S 3QXAA 1IT9L 4EQ3A 4MXWH 1VERA 4LU5H 1EFQA 5JIPA 3S36H 4PJXF 4PGEB 2E7LC 1DLHB 3KHOA 3C60A 2B4CL 4JAMA 2ARJQ 3MV7D 3VFWA 5K9QI 5C07B 2XG4A 2D9CA 2PXYB 3MRIB 2Z31A 2YMXL 4KRPD 4NBZB 4U1KA 3LV3A 5D2NA 5D8JL 4LGPB 5FGRA 4MXVE 5KBNC 3IYLW 3JWOL 2FJGB 2WINB 1JTTA 5F44A 4IOFD 2FWOB 3CSGA 4LRIA 1B4RA 2F53E 5IHUH 3NACH 1U8JB 4JO2H 3F5WB 1UYWH 1A0QL 1NGPL 4GKSA 3V52L 5C09D 3MXWH 3BIKB 1T0NA 5H35A 5E94A 3BKMH 3NIDE 3C6LA 5CILL 2OCFD 4I3GA 3HLAB 4Z76A 1ED3B 1TNMA 4P3DB 1ZV5A 5JW4Q 2HP4A 2OTPA 4QHKJ 1MPAL 3GBNL 3DYPA 1MVUB 4MA3B 1T03H 3RGVD 3IFPB 4MD4B 3B5HA 4HXAH 3P11H 1MWAL 2DQIL 5BRZB 2G75B 1RIHL 4EOWL 4P5TB 4Q7DA 1T0PB 5DR5H 4NQVA 1CZ8H 1TVDA 3NZ8A 1DSFL 1HINL 4OD1H 3TT3H 3AFLA 4G6ML 5BXFA 4FZEL 3WUZA 1XIWD 4Q6IA 2Q3ZA 3LKNB 3VFUA 2IH1A 3TNMA 2ICWB 5ETUB 4EZMA 3TEUA 3CH1B 2GUOA 2XT1B 1SJXA 2ZG1A 2DWDA 1MQ8A 1QKZH 2CIIB 3FFDB 2IFGA 2D7OA 3ARGC 4S10A 5FYLE 4QRTA 5JOFA 2DQGH 3HFML 4L8BB 2O5XL 5HDBE 5TJWK 2AK4E 4S1DC 4M7LH 4KKLD 4NQDE 4YPGA 5LKNA 1KJ2B 3ZDYE 2GAZA 4HEME 2XNAA 4M43L 2O93L 1JZ8A 5HHOB 2R0WH 5CGYD 2I24N 3HRZA 5B8CA 1D9KC 1MCNA 3KPOB 1A9BA 4ORGB 4APQA 4P5KA 5B39B 5DQDH 4G9FD 4LARH 4XC1H 2GK0B 4TNWK 1K5NB 3HE7B 3O6FD 15C8L 2X4RB 4GG8B 4F57H 4X6BA 4LHUA 4XP4L 4PJ5E 3Q6FA 2AEQH 2QHRH 3DGGB 3EDJA 4WW2C 3LS5L 4NN5C 4OZGF 5I71B 2R1XA 3B9DA 1ZT7A 5I6XC 1BQHB 5JW3L 1I7TA 5IT2H 4GRMB 2PW2B 1AO7D 2IAMC 2XTJB 1P4IL 3IXAA 5E8EB 1X5KA 5HHQA 2ORBL 4XMKH 1X5YA 3FRPA 1RZJL 3F7QA 3IDNB 4U6VH 3GJFH 3EYSH 5F1IB 1KB5A 5IW6A 4NCC1 4QRPB 2I9LA 5FYKE 4NO0A 2FH8A 5GRYA 1RZKL 3K1KC 4GT7A 1MJUL 4L4TD 1W72H 1JGLH 2GTWA 4JQXC 4F58H 1V5JA 3RPIB 4B7LA 4X6CB 1BM3L 1CFTA 2DQJH 2QKIA 5DDHA 1A6ZB 2VLJD 1IEHA 4V1DD 3LB6C 4WU7A 1DVFB 1AY1H 4PJGB 3WHXA 1I1AD 3WS6A 5H8DA 4F7PB 1QFWI 2HVJB 5ID0B 2EH7H 2NNAB 4XMPH 2EXWC 4FTVD 2AJXH 4ODTH 5DJ8A 2XKNA 1LO2H 2HG5A 3NVQA 3HG1D 4YX2H 1JNLH 3HE6C 1EFXB 2NW2B 1S7RB 1D5MB 4WFFD 4U1LB 1MF2L 2J8UA 2CMRL 4JFZL 4N1CA 3BP7B 3KDMA 5HPMA 3BRGC 3RX5A 4GQ9H 2Y6SC 2HAZA 5DTFB 3TO4A 4FQXB 2NX5D 3S35L 3NPZB 1BVKA 4CL7A 2ZNXA 4MJID 3WXVH 5KG9A 3CPLA 1UQSB 2XFXA 3QEGH 3P9MB 4ZODA 3BZFB 5DO2C 1CE6A 4L9LC 2BVPA 1ZLSL 2BNRD 2VWEC 2WQ8A 1OAXL 5DJ0B 4ZFFB 3O2VH 4M93C 3Q5TA 1X5JA 1UM5L 1UZ8A 4LASL 4D0BA 4ZUSA 3RL1A 2BK8A 3ZE1E 2BRRH 2VABB 3JTTB 2OTUB 5DHVB 4Z7WF 5KSUB 2BXYA 3REVB 2QEJA 3QEQE 3V6ZB 5DD6A 5LAXB 2AJVL 2F54A 2EEDA 4OQTL 1ONQB 3QWRD 1N64H 1G9EA 5FYJE 1BFTA 4FQ2H 4LGSB 3WFDL 3ARZA 3BP6A 1LVEA 1HHJB 5D70H 1YDPB 1X5AA 3O3BB 5SX4I 1A6UH 1AGCA 5D7LB 1UZ6E 4PGEA 5FO9B 1DLHA 2XPGB 3ZTNL 4JO3H 3WNKA 4JRXB 5I1GH 4M7JL 5C07A 1AGEB 3R4DA 5LQBL 5CKAA 3AMKA 2PXYA 3MRIA 4PGDB 3UJJL 1YQVL 1MCPL 3OR7B 4ZSOA 1JV5B 3DV6B 1P7KB 3Q3GA 1KIRB 2YEZA 3RZCC 2OXHA 1HQ4B 4P3WA 2FJGA 4DUVA 4JFEA 4KDTC 2BSSB 4N9OB 1BP3B 4PS4H 4OZIF 2Q1EA 2WWMC 3PUCA 1OHQA 1U8JA 3F5WA 5HPOA 1JPSH 4Z8FH 1OP5K 3RWEB 2CRMA 1OGTB 4X80H 1FGNH 4MS8C 4M4PA 5MI0B 5ITBL 1XGQB 1RUAH 1E6JH 1NEZG 3MRDB 5FOBB 3HLAA 3SBWC 1ED3A 4P3DA 3IAGC 4PIRF 4AL8L 2NY1C 3ZKMC 1WK0A 3S3PA 5I73C 4GH7B 4NRYB 2BHUA 1MVUA 4MA3A 2PYEE 3IFPA 4MD4A 3VMNA 2HRLA 1QFHA 2Y5EA 1GC1H 4KTEL 5BRZA 2G75A 1UH4A 3DUHA 3SE4A 4KZEH 4HKXB 1A1MB 4P5TA 1CFNA 3UC0H 1A4JB 5IBUB 4DOHE 4NZUL 3PQYB 2MQCA 3FO9B 3VD3A 3I9GH 1WIPA 2X09A 2UUDH 1NLDH 1S7VB 1YMMD 3LKNA 2VR4A 2ICWA 5ETUA 5BO1L 1U3HB 2YA0A 3CH1A 3A67L 4ZPTB 1WVZA 4X9HA 5CJQH 3FFDA 4RSVA 4EUPG 1I7ZB 4DGYL 2FO4B 4XNMB 1QSZA 2FEDD 1TPXB 1CCZA 1KJ2A 1N4XH 2DKUA 1CD8A 3RDTB 4YFEA 4LIQE 5HHOA 1W8NA 4RAUB 2ZKHH 1BX2B 2BY1A 5I8KL 3CDGB 3KPOA 3MOBH 2XN9D 3EOBA 1JZ6A 3O6KH 5B39A 1H0DB 3SDXF 4L5FH 3WXWH 1ROWA 2GK0A 2VXSL 1K5NA 3HE7A 4GG8A 1KTRL 1RJLB 3C2AL 3TN0B 5IWLC 4OFKA 4LHQB 3DGGA 1QBML 1WUNT 3C09C 5D1XC 2HMIC 4LVOB 1OPGH 1GVIA 2ZG3A 3RU8H 1BQHA 3KS0H 3S37X 5EA0H 1Q9WB 5DD0H 2FBJL 3MRMB 5C0CB 5GRXG 4GRMA 3U7YH 2PW2A 2DI9A 3C8KB 4G5ZH 5E8EA 3T2OA 4JE4B 1WEJH 3SJVD 2DBLL 4J3VA 1F8TH 3IDNA 4HWEL 5F1IA 5JOPD 4LFHG 4LQFH 5I1JH 3GI9H 5EZIL 4QRPA 4WO4D 5HDQH 1LO4L 4RDQF 4PP1C 4O00A 5E6ID 4RMRA 4LFHD 3FOLB 1EO5A 4X6CA 3H9SB 5FHAL 1A5FH 4YHYB 3PWLA 4BQBA 1ZS8B 1DVFA 2OYPA 4M5ZH 4PJGA 4F7PA 4TUKL 4L4VD 2HVJA 2DJUA 5L9DH 4PJDB 4UUJB 2NNAA 5TDOB 1OARL 3DV4B 3KYKL 5CUSL 5F6IC 2HLAB 5J56B 3OKDB 5KSVA 3HHRB 4OZHB 3U9PL 3AGVA 2RCSL 1EFXA 4KV5F 2NW2A 1S7RA 4OUOA 1D5MA 5ID1B 1A6PA 4U1LA 4NN7C 1KIQB 3BP7A 4P2QE 4HKJA 4XHJC 1DFBH 4UAOB 5DTFA 2W9DL 3QUMA 1EGJL 1L0YA 4FQXA 1H5BC 3WDHA 5INDB 4JFHD 5F7MC 3FB8B 3I3BA 4OFYD 1WICA 1UQSA 3VXOB 4OCXL 1FYTD 4QOKB 2FHFA 2VDNL 4S1RH 5A2JH 1I3VA 3T2PA 3BZFA 2Q76B 2VDLL 5DJ0A 3QG6B 4ZFFA 4I2XE 3WIIH 2EH8L 3VGAB 3DBXB 2Z91B 3NCJL 1K8IA 3ARFB 4R97B 5FUCC 2VABA 3JTTA 5GS0L 5DHVA 5ADOL 3VW3L 5KSUA 1TJGH 5A16B 3REVA 3SKJL 1W0YT 5IB3B 4W6WB 3V6ZA 5LAXA 1NANH 4ODBD 4S0SD 5HVWA 4WHTB 3QIBC 3UBXG 5SWZB 1ONQA 1I1YB 2B1HH 4MDJB 4TQEH 1I9EA 1HHJA 1YDPA 2HTKD 3O3BA 3EJZC 5FO9A 1CG9A 1OL0A 5TE4H 1CVRA 4FXLA 4OT1L 1UXWB 5E7FA 4P2RE 2YD6A 1LEKB 1HXMB 1NAML 4JRXA 1OWWA 1AGEA 4OCWH 4H8WL 3BKCL 4PGDA 4JPVL 3OR7A 1JV5A 1P7KA 1KIRA 2HT2D 3MV7B 5EBWB 2JB6B 5D6CB 4Y5YC 1HQ4A 4RISL 2OZ4H 1MUJB 3TYFB 2R0KL 4R8WL 2BSSA 3O4OB 4NJAH 3THML 4PV9B 4IDJL 4KVCL 4ZXBD 4Y4FD 1UCTA 1K3IA 1JE6A 1MAML 3RWEA 1OGTA 2YD7A 2WBKA 3IKCB 3IGAB 4MMZC 4O5LL 2ESVE 1CE1L 1MFAL 1FGVH 3LQAC 2VLMD 3IDMB 4YHPB 1XGQA 2YPKB 3QQNA 1ORSA 1MFEH 1BMGA 1B90A 5C09B 5GGVL 2N56A 4OCSH 3MRDA 2CDGB 5FOBA 5I17B 2IANE 1OAKL 3QULB 4YHKL 4Z7VF 1D7FA 5HBBA 3PWVB 1OLZA 1XZ0B 5JA8B 2IF7A 1KCRL 4X99B 1U93A 2FATH 4NWTH 1IC7H 1WBYB 1J9CT 4NRYA 4LCCC 5C0AD 4Z0BL 2P4AB 2VL4A 3P0YL 1VEPA 5CZVH 3RVXC 3UTTE 3RGVB 3QIWC 3T4AB 2NY0D 1A1MA 1XR9B 2YXMA 5CD5C 1A4JA